1XRAA

Crystal structure of s-adenosylmethionine synthetase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule tags Methyltransferase
total genus 129
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA01
4K0BA 1O9TA 2OBVA 4L2ZA 2YWCA 4ODJA 3S82A 2YWBA 4L4QA 1XRAA 1MXBA 4WS9A 3UOWA 1FUGA 5A1GA 5T8TA 1MXAA 1P7LA 1GPMA 3A4IA 4HPVA 1O93A 1MXCA 1O90A 1O92A 2DPLA 3TQIA 1XRCA 3SO4A 5A1IA 1QM4A 4KTVA 4KTTA 4LE5A 1XRBA 5A19A 4NDNA 4L7IA 3IMLA 3TDEA 2P02A 5T8SA 1RG9A 5H9UA 3RV2A
chains in the Genus database with same CATH superfamily
4B3TC 1VLAA 5IWAC 5AE3A 1XS3A 4LF9C 1XRAA 2OPLA 4FTFA 3A25A 3N2QA 3UOWA 4X66C 3T1YC 5GTDA 3VNQA 1IBLC 3A4IA 1MXCA 1O90A 3I07A 1O92A 3FCEA 4OXIA 2ONFA 4DR7C 3AF5A 3PROC 5LCIA 3TDEA 5T8SA 3A9VA 2CU6A 2M5HA 4ODJA 2MCQA 2P2FA 4DG8A 3LUSA 4LF7C 4PUGA 2EGTA 4DV4C 2D1SA 5BSWA 4TPSB 1N33C 4RLFA 1IBMC 1FJGC 1XMOC 2F4VC 3CQ1A 2YCBA 3DAYA 3J80D 4BSZA 4K0BA 1J5EC 4NXMC 1ULTA 2OO4A 4FUTA 4X64C 4WS9A 4D4GA 4DV5C 4JYAC 1IBKC 2QW0X 4IR7A 4DV2C 3FCCA 2Y27A 5BURA 4PUIA 1MD9A 1WF3A 4MTNA 3I08A 1EGAA 1RG9A 1IB8A 4JI5C 4LF4C 4JM1A 4DV7C 2D7VA 5BUQA 3JAMD 3UEBA 4DCSA 2ASBA 2HHHC 2MMAB 2DPLA 1XRCA 4BCAA 4DR1C 1XMQC 4KTTA 2M5OA 4LE5A 5BUSA 5FLXD 4NDNA 3A26A 3TR3A 5BR8C 1USPB 2P02A 1XHJA 1NY8A 1V26A 3E7WA 4G1IA 2UUBC 5K85A 3GKUA 2ZZNA 5KYVA 4B3RC 4OYCA 3OTOC 4GXRA 4KHPC 2VQEC 3R9XA 4BC9A 1P4EA 3KXWA 4DCVA 2D27A 4U5YD 4YY3C 4YHHC 4LFCC 4LFBC 1MDFA 2VSQA 4FUQA 1HNZC 4X62C 2ZM6C 1N32C 2BH1X 3CW9A 1LQLA 2UUAC 4DR5C 2E8FA 2PROA 2E0GA 1YJ7A 4XX2A 4JV5C 2VQFC 3IEVA 1WH9A 1V60A 2P20A 2DYJA 4ZJZA 1T5HX 4JI8C 1VEHA 1I94C 2QVXX 4EATA 3DHVA 4RLQA 2UXCC 3ETCA 4JI3C 1N2FA 4RVNA 5BSMA 5ADZA 5LMNC 4DCUA 1N34C 3AY0A 3GR0A 2D1TA 1RY2A 3AF6A 3PESA 5KYTA 4JI7C 3EERA 3UZ0A 4DR4C 1TH5A 1PU1A 1T5DX 2HJGA 2UU9C 2D1QA 1XRBA 1PG3A 3VNRA 1USPA 5A2QD 1O9TA 2DHMA 1N36C 2PT7G 3CQ2A 2Y4OA 3T1HC 5IT9D 3NI2A 5T8TA 4JI6C 4PHTA 2KZFA 4B3MC 4R1LA 4NXNC 2KDNA 2P2QA 2Z51A 4GXQA 4MH4A 1AMUA 1WCJA 2YWCA 4DV3C 4G37A 2UXBC 4JI2C 3L8CA 5AE1A 4RVOA 1NYEA 4DV1C 4GS5A 3SO4A 2D1RA 5A1IA 1QM4A 1PA4A 4D4IA 4PROC 3C5EA 4L7IA 4DR3C 2P2MA 2YX1A 3RV2A 1KKGA 3O2EA 3R44A 4DUZC 2CXCA 3LNVA 2NCLA 2WD9A 2E8EA 4BBYA 3LGXA 1MXAA 2QL8A 4I9FA 1O93A 4RMNA 4OX9C 4X65C 4G36A 4GKKC 2BJOA 5CZVA 4RM2A 2V7BA 4LF6C 5AE2A 4RM3A 3TUFA 2E8CA 3E7XA 1MXBA 3LAXA 1V25A 2UXDC 1ZB9A 1M6XC 4I9GA 4PZPA 4K0KC 3K6RA 3L95X 2PN2A 2E5LC 2UUCC 5LMUC 2E7GA 3R9WA 1QWIA 4ZLPA 3RG2A 2YWBA 1HNWC 1XNRC 1FUGA 3B7WA 4LF8C 1UWDA 4DV6C 4D57A 2ATWA 2VZEA 1MKYA 4KTVA 2QVZX 5E7QA 3IEUA 2JNVA 5IFIA 2D28C 4JI4C 3CJEA 2ZZMA 3A9UA 4DG9A 4DR6C 5CZXA 4JI0C 3IPLA 2Y4NA 1ZB8A 3NYRA 1BA3A 2XR1A 4LFAC 1HR0C 1HH2P 4DCTA 4WV3A 5BSRA 3PBKA 4GKJC 3N54B 3G7SA 4IZ6A 2KZ0A 2OBVA 4BC7A 2MM9A 1JOSA 5BSTA 2OPLB 4L4QA 4D56A 1ML8A 1XNQC 2WP0C 4R0MA 4DUYC 1HNXC 5DV9A 4NOZA 3VNSA 4PUHA 1MDBA 5A19A 3IMLA 2P2JA 5K8FA 4ISBA 1L2FA 1UKKA 4L2ZA 2JMPA 3S82A 5A1GA 4DR2C 1LCIA 1P7LA 5JRHA 1GPMA 5KEIA 4HPVA 3LNOA 2QVYX 3UX2A 4DV0C 3TQIA 1K0RA 1FLOA 4AQYC 5BSVA 3GR1A 1P4EC 4R1MA 3EQ6A 2CY1A 3NYQA 3ETOA 3NPDA 3J81D 4LF5C 3H2TA 2AYAA 3CW8X 3GPCA 5BSUA 3DLPX 4JI1C 3UX3A 4B3SC 2P2BA 1PG4A 1M6XA 3CQ3A 5H9UA
chains in the Genus database with same CATH topology
4B3TC 1VLAA 5IWAC 5AE3A 4LF9C 1XRAA 2OPLA 4FTFA 3N2QA 3UOWA 4X66C 3T1YC 5GTDA 3VNQA 1IBLC 3A4IA 1MXCA 1O90A 3I07A 1O92A 3FCEA 4OXIA 2ONFA 4DR7C 3AF5A 3PROC 3TDEA 5T8SA 3A9VA 4ODJA 2P2FA 4DG8A 3LUSA 4LF7C 2EGTA 4DV4C 2D1SA 5BSWA 4TPSB 1N33C 4RLFA 1IBMC 1FJGC 1XMOC 2F4VC 2YCBA 3DAYA 3J80D 4BSZA 4K0BA 1J5EC 4NXMC 1ULTA 2OO4A 4FUTA 4X64C 4WS9A 4D4GA 4DV5C 4JYAC 1IBKC 2QW0X 4IR7A 4DV2C 3FCCA 2Y27A 5BURA 1MD9A 1WF3A 4MTNA 3I08A 1EGAA 1RG9A 4JI5C 4LF4C 4JM1A 4DV7C 2D7VA 5BUQA 3JAMD 4DCSA 2ASBA 2HHHC 2DPLA 1XRCA 4BCAA 4DR1C 1XMQC 4KTTA 4LE5A 5BUSA 5FLXD 4NDNA 5BR8C 1USPB 2P02A 3E7WA 1V26A 4G1IA 2UUBC 5K85A 3GKUA 5KYVA 4B3RC 4OYCA 3OTOC 4GXRA 4KHPC 2VQEC 3R9XA 4BC9A 3KXWA 4DCVA 2D27A 4U5YD 4YY3C 4YHHC 4LFCC 4LFBC 1MDFA 2VSQA 4FUQA 1HNZC 4X62C 2ZM6C 1N32C 2BH1X 3CW9A 1LQLA 2UUAC 4DR5C 2E8FA 2PROA 2E0GA 1YJ7A 4XX2A 4JV5C 2VQFC 3IEVA 1WH9A 2P20A 2DYJA 4ZJZA 1T5HX 4JI8C 1I94C 2QVXX 4EATA 3DHVA 4RLQA 2UXCC 3ETCA 4JI3C 1N2FA 4RVNA 5BSMA 5ADZA 5LMNC 4DCUA 1N34C 3GR0A 2D1TA 1RY2A 3AF6A 3PESA 5KYTA 4JI7C 3EERA 3UZ0A 4DR4C 1T5DX 2HJGA 2UU9C 2D1QA 1XRBA 1PG3A 3VNRA 1USPA 5A2QD 1O9TA 1N36C 2PT7G 2Y4OA 3T1HC 5IT9D 3NI2A 5T8TA 4JI6C 4PHTA 2KZFA 4B3MC 4R1LA 4NXNC 2P2QA 4GXQA 4MH4A 1AMUA 2YWCA 4DV3C 4G37A 2UXBC 4JI2C 3L8CA 5AE1A 4RVOA 1NYEA 4DV1C 4GS5A 3SO4A 2D1RA 5A1IA 1QM4A 1PA4A 4D4IA 4PROC 3C5EA 4L7IA 4DR3C 2P2MA 3RV2A 1KKGA 3R44A 4DUZC 2CXCA 3LNVA 2WD9A 2E8EA 4BBYA 3LGXA 1MXAA 2QL8A 4I9FA 1O93A 4RMNA 4OX9C 4X65C 4G36A 4GKKC 2BJOA 5CZVA 4RM2A 2V7BA 4LF6C 5AE2A 4RM3A 3TUFA 2E8CA 3E7XA 1MXBA 3LAXA 1V25A 2UXDC 1ZB9A 4I9GA 4PZPA 4K0KC 3L95X 2PN2A 2E5LC 2UUCC 5LMUC 2E7GA 3R9WA 1QWIA 4ZLPA 3RG2A 2YWBA 1HNWC 1XNRC 1FUGA 3B7WA 4LF8C 4DV6C 4D57A 2ATWA 2VZEA 1MKYA 4KTVA 2QVZX 5E7QA 3IEUA 5IFIA 2D28C 4JI4C 3CJEA 3A9UA 4DG9A 4DR6C 5CZXA 4JI0C 3IPLA 2Y4NA 1ZB8A 3NYRA 1BA3A 2XR1A 4LFAC 1HR0C 1HH2P 4DCTA 4WV3A 5BSRA 3PBKA 4GKJC 3N54B 3G7SA 4IZ6A 2OBVA 4BC7A 1JOSA 5BSTA 2OPLB 4L4QA 4D56A 1ML8A 1XNQC 2WP0C 4R0MA 4DUYC 1HNXC 5DV9A 4NOZA 3VNSA 1MDBA 5A19A 3IMLA 2P2JA 5K8FA 4ISBA 1L2FA 1UKKA 4L2ZA 2JMPA 3S82A 5A1GA 4DR2C 1LCIA 1P7LA 5JRHA 1GPMA 5KEIA 4HPVA 2QVYX 4DV0C 3TQIA 1K0RA 4AQYC 5BSVA 3GR1A 4R1MA 3EQ6A 2CY1A 3NYQA 3ETOA 3NPDA 3J81D 4LF5C 3H2TA 2AYAA 3CW8X 3GPCA 5BSUA 3DLPX 4JI1C 4B3SC 2P2BA 1PG4A 5H9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0B A;  1O9T A;  2OBV A;  4L2Z A;  2YWC A;  4ODJ A;  3S82 A;  2YWB A;  4L4Q A;  1XRA A;  1MXB A;  4WS9 A;  3UOW A;  1FUG A;  5A1G A;  5T8T A;  1MXA A;  1P7L A;  1GPM A;  3A4I A;  4HPV A;  1O93 A;  1MXC A;  1O90 A;  1O92 A;  2DPL A;  3TQI A;  1XRC A;  3SO4 A;  5A1I A;  1QM4 A;  4KTV A;  4KTT A;  4LE5 A;  1XRB A;  5A19 A;  4NDN A;  4L7I A;  3IML A;  3TDE A;  2P02 A;  5T8S A;  1RG9 A;  5H9U A;  3RV2 A; 
#chains in the Genus database with same CATH topology
 4B3T C;  1VLA A;  5IWA C;  5AE3 A;  1XS3 A;  4LF9 C;  1XRA A;  2OPL A;  4FTF A;  3A25 A;  3N2Q A;  3UOW A;  4X66 C;  3T1Y C;  5GTD A;  3VNQ A;  1IBL C;  3A4I A;  1MXC A;  1O90 A;  3I07 A;  1O92 A;  3FCE A;  4OXI A;  2ONF A;  4DR7 C;  3AF5 A;  3PRO C;  5LCI A;  3TDE A;  5T8S A;  3A9V A;  2CU6 A;  2M5H A;  4ODJ A;  2MCQ A;  2P2F A;  4DG8 A;  3LUS A;  4LF7 C;  4PUG A;  2EGT A;  4DV4 C;  2D1S A;  5BSW A;  4TPS B;  1N33 C;  4RLF A;  1IBM C;  1FJG C;  1XMO C;  2F4V C;  3CQ1 A;  2YCB A;  3DAY A;  3J80 D;  4BSZ A;  4K0B A;  1J5E C;  4NXM C;  1ULT A;  2OO4 A;  4FUT A;  4X64 C;  4WS9 A;  4D4G A;  4DV5 C;  4JYA C;  1IBK C;  2QW0 X;  4IR7 A;  4DV2 C;  3FCC A;  2Y27 A;  5BUR A;  4PUI A;  1MD9 A;  1WF3 A;  4MTN A;  3I08 A;  1EGA A;  1RG9 A;  1IB8 A;  4JI5 C;  4LF4 C;  4JM1 A;  4DV7 C;  2D7V A;  5BUQ A;  3JAM D;  3UEB A;  4DCS A;  2ASB A;  2HHH C;  2MMA B;  2DPL A;  1XRC A;  4BCA A;  4DR1 C;  1XMQ C;  4KTT A;  2M5O A;  4LE5 A;  5BUS A;  5FLX D;  4NDN A;  3A26 A;  3TR3 A;  5BR8 C;  1USP B;  2P02 A;  1XHJ A;  1NY8 A;  1V26 A;  3E7W A;  4G1I A;  2UUB C;  5K85 A;  3GKU A;  2ZZN A;  5KYV A;  4B3R C;  4OYC A;  3OTO C;  4GXR A;  4KHP C;  2VQE C;  3R9X A;  4BC9 A;  1P4E A;  3KXW A;  4DCV A;  2D27 A;  4U5Y D;  4YY3 C;  4YHH C;  4LFC C;  4LFB C;  1MDF A;  2VSQ A;  4FUQ A;  1HNZ C;  4X62 C;  2ZM6 C;  1N32 C;  2BH1 X;  3CW9 A;  1LQL A;  2UUA C;  4DR5 C;  2E8F A;  2PRO A;  2E0G A;  1YJ7 A;  4XX2 A;  4JV5 C;  2VQF C;  3IEV A;  1WH9 A;  1V60 A;  2P20 A;  2DYJ A;  4ZJZ A;  1T5H X;  4JI8 C;  1VEH A;  1I94 C;  2QVX X;  4EAT A;  3DHV A;  4RLQ A;  2UXC C;  3ETC A;  4JI3 C;  1N2F A;  4RVN A;  5BSM A;  5ADZ A;  5LMN C;  4DCU A;  1N34 C;  3AY0 A;  3GR0 A;  2D1T A;  1RY2 A;  3AF6 A;  3PES A;  5KYT A;  4JI7 C;  3EER A;  3UZ0 A;  4DR4 C;  1TH5 A;  1PU1 A;  1T5D X;  2HJG A;  2UU9 C;  2D1Q A;  1XRB A;  1PG3 A;  3VNR A;  1USP A;  5A2Q D;  1O9T A;  2DHM A;  1N36 C;  2PT7 G;  3CQ2 A;  2Y4O A;  3T1H C;  5IT9 D;  3NI2 A;  5T8T A;  4JI6 C;  4PHT A;  2KZF A;  4B3M C;  4R1L A;  4NXN C;  2KDN A;  2P2Q A;  2Z51 A;  4GXQ A;  4MH4 A;  1AMU A;  1WCJ A;  2YWC A;  4DV3 C;  4G37 A;  2UXB C;  4JI2 C;  3L8C A;  5AE1 A;  4RVO A;  1NYE A;  4DV1 C;  4GS5 A;  3SO4 A;  2D1R A;  5A1I A;  1QM4 A;  1PA4 A;  4D4I A;  4PRO C;  3C5E A;  4L7I A;  4DR3 C;  2P2M A;  2YX1 A;  3RV2 A;  1KKG A;  3O2E A;  3R44 A;  4DUZ C;  2CXC A;  3LNV A;  2NCL A;  2WD9 A;  2E8E A;  4BBY A;  3LGX A;  1MXA A;  2QL8 A;  4I9F A;  1O93 A;  4RMN A;  4OX9 C;  4X65 C;  4G36 A;  4GKK C;  2BJO A;  5CZV A;  4RM2 A;  2V7B A;  4LF6 C;  5AE2 A;  4RM3 A;  3TUF A;  2E8C A;  3E7X A;  1MXB A;  3LAX A;  1V25 A;  2UXD C;  1ZB9 A;  1M6X C;  4I9G A;  4PZP A;  4K0K C;  3K6R A;  3L95 X;  2PN2 A;  2E5L C;  2UUC C;  5LMU C;  2E7G A;  3R9W A;  1QWI A;  4ZLP A;  3RG2 A;  2YWB A;  1HNW C;  1XNR C;  1FUG A;  3B7W A;  4LF8 C;  1UWD A;  4DV6 C;  4D57 A;  2ATW A;  2VZE A;  1MKY A;  4KTV A;  2QVZ X;  5E7Q A;  3IEU A;  2JNV A;  5IFI A;  2D28 C;  4JI4 C;  3CJE A;  2ZZM A;  3A9U A;  4DG9 A;  4DR6 C;  5CZX A;  4JI0 C;  3IPL A;  2Y4N A;  1ZB8 A;  3NYR A;  1BA3 A;  2XR1 A;  4LFA C;  1HR0 C;  1HH2 P;  4DCT A;  4WV3 A;  5BSR A;  3PBK A;  4GKJ C;  3N54 B;  3G7S A;  4IZ6 A;  2KZ0 A;  2OBV A;  4BC7 A;  2MM9 A;  1JOS A;  5BST A;  2OPL B;  4L4Q A;  4D56 A;  1ML8 A;  1XNQ C;  2WP0 C;  4R0M A;  4DUY C;  1HNX C;  5DV9 A;  4NOZ A;  3VNS A;  4PUH A;  1MDB A;  5A19 A;  3IML A;  2P2J A;  5K8F A;  4ISB A;  1L2F A;  1UKK A;  4L2Z A;  2JMP A;  3S82 A;  5A1G A;  4DR2 C;  1LCI A;  1P7L A;  5JRH A;  1GPM A;  5KEI A;  4HPV A;  3LNO A;  2QVY X;  3UX2 A;  4DV0 C;  3TQI A;  1K0R A;  1FLO A;  4AQY C;  5BSV A;  3GR1 A;  1P4E C;  4R1M A;  3EQ6 A;  2CY1 A;  3NYQ A;  3ETO A;  3NPD A;  3J81 D;  4LF5 C;  3H2T A;  2AYA A;  3CW8 X;  3GPC A;  5BSU A;  3DLP X;  4JI1 C;  3UX3 A;  4B3S C;  2P2B A;  1PG4 A;  1M6X A;  3CQ3 A;  5H9U A; 
#chains in the Genus database with same CATH homology
 4B3T C;  1VLA A;  5IWA C;  5AE3 A;  4LF9 C;  1XRA A;  2OPL A;  4FTF A;  3N2Q A;  3UOW A;  4X66 C;  3T1Y C;  5GTD A;  3VNQ A;  1IBL C;  3A4I A;  1MXC A;  1O90 A;  3I07 A;  1O92 A;  3FCE A;  4OXI A;  2ONF A;  4DR7 C;  3AF5 A;  3PRO C;  3TDE A;  5T8S A;  3A9V A;  4ODJ A;  2P2F A;  4DG8 A;  3LUS A;  4LF7 C;  2EGT A;  4DV4 C;  2D1S A;  5BSW A;  4TPS B;  1N33 C;  4RLF A;  1IBM C;  1FJG C;  1XMO C;  2F4V C;  2YCB A;  3DAY A;  3J80 D;  4BSZ A;  4K0B A;  1J5E C;  4NXM C;  1ULT A;  2OO4 A;  4FUT A;  4X64 C;  4WS9 A;  4D4G A;  4DV5 C;  4JYA C;  1IBK C;  2QW0 X;  4IR7 A;  4DV2 C;  3FCC A;  2Y27 A;  5BUR A;  1MD9 A;  1WF3 A;  4MTN A;  3I08 A;  1EGA A;  1RG9 A;  4JI5 C;  4LF4 C;  4JM1 A;  4DV7 C;  2D7V A;  5BUQ A;  3JAM D;  4DCS A;  2ASB A;  2HHH C;  2DPL A;  1XRC A;  4BCA A;  4DR1 C;  1XMQ C;  4KTT A;  4LE5 A;  5BUS A;  5FLX D;  4NDN A;  5BR8 C;  1USP B;  2P02 A;  3E7W A;  1V26 A;  4G1I A;  2UUB C;  5K85 A;  3GKU A;  5KYV A;  4B3R C;  4OYC A;  3OTO C;  4GXR A;  4KHP C;  2VQE C;  3R9X A;  4BC9 A;  3KXW A;  4DCV A;  2D27 A;  4U5Y D;  4YY3 C;  4YHH C;  4LFC C;  4LFB C;  1MDF A;  2VSQ A;  4FUQ A;  1HNZ C;  4X62 C;  2ZM6 C;  1N32 C;  2BH1 X;  3CW9 A;  1LQL A;  2UUA C;  4DR5 C;  2E8F A;  2PRO A;  2E0G A;  1YJ7 A;  4XX2 A;  4JV5 C;  2VQF C;  3IEV A;  1WH9 A;  2P20 A;  2DYJ A;  4ZJZ A;  1T5H X;  4JI8 C;  1I94 C;  2QVX X;  4EAT A;  3DHV A;  4RLQ A;  2UXC C;  3ETC A;  4JI3 C;  1N2F A;  4RVN A;  5BSM A;  5ADZ A;  5LMN C;  4DCU A;  1N34 C;  3GR0 A;  2D1T A;  1RY2 A;  3AF6 A;  3PES A;  5KYT A;  4JI7 C;  3EER A;  3UZ0 A;  4DR4 C;  1T5D X;  2HJG A;  2UU9 C;  2D1Q A;  1XRB A;  1PG3 A;  3VNR A;  1USP A;  5A2Q D;  1O9T A;  1N36 C;  2PT7 G;  2Y4O A;  3T1H C;  5IT9 D;  3NI2 A;  5T8T A;  4JI6 C;  4PHT A;  2KZF A;  4B3M C;  4R1L A;  4NXN C;  2P2Q A;  4GXQ A;  4MH4 A;  1AMU A;  2YWC A;  4DV3 C;  4G37 A;  2UXB C;  4JI2 C;  3L8C A;  5AE1 A;  4RVO A;  1NYE A;  4DV1 C;  4GS5 A;  3SO4 A;  2D1R A;  5A1I A;  1QM4 A;  1PA4 A;  4D4I A;  4PRO C;  3C5E A;  4L7I A;  4DR3 C;  2P2M A;  3RV2 A;  1KKG A;  3R44 A;  4DUZ C;  2CXC A;  3LNV A;  2WD9 A;  2E8E A;  4BBY A;  3LGX A;  1MXA A;  2QL8 A;  4I9F A;  1O93 A;  4RMN A;  4OX9 C;  4X65 C;  4G36 A;  4GKK C;  2BJO A;  5CZV A;  4RM2 A;  2V7B A;  4LF6 C;  5AE2 A;  4RM3 A;  3TUF A;  2E8C A;  3E7X A;  1MXB A;  3LAX A;  1V25 A;  2UXD C;  1ZB9 A;  4I9G A;  4PZP A;  4K0K C;  3L95 X;  2PN2 A;  2E5L C;  2UUC C;  5LMU C;  2E7G A;  3R9W A;  1QWI A;  4ZLP A;  3RG2 A;  2YWB A;  1HNW C;  1XNR C;  1FUG A;  3B7W A;  4LF8 C;  4DV6 C;  4D57 A;  2ATW A;  2VZE A;  1MKY A;  4KTV A;  2QVZ X;  5E7Q A;  3IEU A;  5IFI A;  2D28 C;  4JI4 C;  3CJE A;  3A9U A;  4DG9 A;  4DR6 C;  5CZX A;  4JI0 C;  3IPL A;  2Y4N A;  1ZB8 A;  3NYR A;  1BA3 A;  2XR1 A;  4LFA C;  1HR0 C;  1HH2 P;  4DCT A;  4WV3 A;  5BSR A;  3PBK A;  4GKJ C;  3N54 B;  3G7S A;  4IZ6 A;  2OBV A;  4BC7 A;  1JOS A;  5BST A;  2OPL B;  4L4Q A;  4D56 A;  1ML8 A;  1XNQ C;  2WP0 C;  4R0M A;  4DUY C;  1HNX C;  5DV9 A;  4NOZ A;  3VNS A;  1MDB A;  5A19 A;  3IML A;  2P2J A;  5K8F A;  4ISB A;  1L2F A;  1UKK A;  4L2Z A;  2JMP A;  3S82 A;  5A1G A;  4DR2 C;  1LCI A;  1P7L A;  5JRH A;  1GPM A;  5KEI A;  4HPV A;  2QVY X;  4DV0 C;  3TQI A;  1K0R A;  4AQY C;  5BSV A;  3GR1 A;  4R1M A;  3EQ6 A;  2CY1 A;  3NYQ A;  3ETO A;  3NPD A;  3J81 D;  4LF5 C;  3H2T A;  2AYA A;  3CW8 X;  3GPC A;  5BSU A;  3DLP X;  4JI1 C;  4B3S C;  2P2B A;  1PG4 A;  5H9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...