1XRAA

Crystal structure of s-adenosylmethionine synthetase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule tags Methyltransferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
total genus 129
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA01
1O9TA 1XRCA 2YWCA 5A1IA 4L2ZA 5T8TA 1MXAA 2DPLA 1MXBA 1XRAA 1P7LA 4NDNA 2YWBA 3S82A 4KTVA 5T8SA 1FUGA 1QM4A 1RG9A 4L7IA 5A19A 3A4IA 3UOWA 3IMLA 4HPVA 5H9UA 2P02A 3TQIA 1XRBA 4KTTA 3TDEA 3RV2A 1O93A 4LE5A 1GPMA 4L4QA 4ODJA 4WS9A 5A1GA 1O90A 1O92A 4K0BA 3SO4A 1MXCA 2OBVA
chains in the Genus database with same CATH superfamily
2QW0X 2QVYX 1VEHA 5CZVA 1N36C 4KTVA 3I08A 2V7BA 3IEUA 4JYAC 4FTFA 2P2QA 1J5EC 3PROC 4WV3A 2M5HA 3CW9A 4JI2C 4X66C 2OBVA 3VNRA 2OO4A 1HR0C 1RY2A 2D1SA 2UXCC 4PUGA 2QVXX 2CU6A 4B3MC 4TPSB 2VQEC 2ZM6C 5K85A 3NI2A 4G36A 4DCVA 5AE1A 1HNWC 2UUAC 2QL8A 5BURA 3TR3A 3T1YC 1IB8A 4DV2C 5KYVA 4U5YD 5T8TA 1YJ7A 2DPLA 4AQYC 4DR7C 5BSMA 4DR4C 3NPDA 3TUFA 4DV6C 1V60A 4D4GA 4BSZA 2WP0C 2E8FA 3IMLA 2HHHC 1XNQC 3L8CA 4PUIA 4LF4C 2PROA 4KTTA 3VNQA 2MM9A 2D27A 4LF6C 2MMAB 1MDBA 4GKJC 1PG4A 3I07A 1MXCA 3C5EA 3R44A 2D28C 2PN2A 5CZXA 5FLXD 1N2FA 4B3TC 1NYEA 4DV3C 1HNXC 3NYQA 4JV5C 1MD9A 3SO4A 1WF3A 1QWIA 1IBMC 2DYJA 1MXAA 4BC7A 4JI1C 4NDNA 2YWBA 1ZB8A 4LF7C 3B7WA 2VQFC 1AMUA 1KKGA 2HJGA 1NY8A 4JI6C 2AYAA 4RM2A 2MCQA 4ZJZA 2YCBA 5H9UA 4ZLPA 2UUBC 3TDEA 3LGXA 4LE5A 3LUSA 3A9UA 4L4QA 3A9VA 5A1GA 1XMOC 1XS3A 5A2QD 3UX2A 4PROC 4D4IA 5KYTA 2XR1A 4JI0C 2BH1X 2ATWA 4BCAA 1ML8A 3S82A 1JOSA 3AY0A 3R9WA 3FCEA 3N2QA 4GXRA 4RM3A 4BC9A 4I9FA 4D57A 4LF8C 2P2BA 2Y27A 3DHVA 4K0BA 5IFIA 5LCIA 1T5DX 1P4EC 4RVNA 2YX1A 1PA4A 3FCCA 1M6XC 2D7VA 1UWDA 2JNVA 4XX2A 2UXDC 2JMPA 2M5OA 4LF9C 4PUHA 4GKKC 4MTNA 4ODJA 3KXWA 4RLFA 3H2TA 3IEVA 3UZ0A 4EATA 2KZ0A 4IR7A 1N34C 3DLPX 1IBKC 5KEIA 1RG9A 2OPLB 4FUQA 2Z51A 4D56A 4DUYC 2DHMA 4DR5C 3T1HC 2P02A 2Y4NA 1XRBA 4DV5C 2P20A 2D1QA 1VLAA 4ISBA 1GPMA 4MH4A 4FUTA 5BUSA 3J80D 4G37A 4RVOA 1XRAA 4GXQA 5LMNC 2P2JA 1ULTA 4NXNC 2VSQA 3G7SA 4DR1C 4DR2C 2KDNA 3GR0A 3L95X 3TQIA 1USPA 4PZPA 4JI7C 4IZ6A 3CQ1A 4DG9A 1N33C 1I94C 4YY3C 4DUZC 3J81D 3LNOA 2Y4OA 5AE3A 3PBKA 1XMQC 3ETOA 5JRHA 4LF5C 3GR1A 1XNRC 2F4VC 4B3RC 2E7GA 1FUGA 3AF5A 3GKUA 2KZFA 5IT9D 3RG2A 4K0KC 4I9GA 1FLOA 4JI4C 3ETCA 3UEBA 5BSWA 1K0RA 3UX3A 1MXBA 4BBYA 1HH2P 3AF6A 2E8CA 2D1TA 1MKYA 1USPB 1N32C 1LQLA 1HNZC 2UU9C 3IPLA 5IWAC 2EGTA 3A25A 1BA3A 1WCJA 3EQ6A 5BSUA 2QVZX 3CQ3A 3GPCA 4G1IA 2P2MA 3EERA 1P7LA 3DAYA 4DV0C 5DV9A 3R9XA 2ZZNA 4X64C 4LFCC 4DV1C 4DV7C 3A4IA 3CW8X 4HPVA 3LNVA 1V26A 4OYCA 1IBLC 2YWCA 1UKKA 2CXCA 4X65C 4R1MA 4JI5C 4OX9C 4DV4C 4L7IA 5BSVA 4GS5A 1M6XA 3RV2A 1O93A 4DR6C 3PESA 4X62C 3NYRA 4NXMC 1V25A 2UUCC 4DCSA 1O9TA 3N54B 2CY1A 4PHTA 5BSRA 1EGAA 4RLQA 3JAMD 4KHPC 2PT7G 5AE2A 1TH5A 3UOWA 4JI3C 4DCTA 1PG3A 3VNSA 1PU1A 1ZB9A 2BJOA 1O90A 2VZEA 1O92A 4R1LA 2E0GA 2WD9A 1XRCA 2E8EA 1XHJA 5ADZA 2OPLA 3CJEA 3O2EA 3K6RA 4NOZA 1LCIA 5T8SA 1QM4A 5A19A 5LMUC 4DR3C 4OXIA 2NCLA 5BSTA 1P4EA 5E7QA 2P2FA 3OTOC 3E7XA 4JI8C 2D1RA 1L2FA 4JM1A 5A1IA 3E7WA 4DG8A 1FJGC 4L2ZA 2UXBC 1MDFA 3CQ2A 5BR8C 5GTDA 4B3SC 5BUQA 4YHHC 4R0MA 4DCUA 2ONFA 4LFAC 1T5HX 2E5LC 3LAXA 1WH9A 3A26A 5K8FA 4WS9A 4LFBC 4RMNA 2ZZMA 2ASBA
chains in the Genus database with same CATH topology
2QW0X 2QVYX 5CZVA 1N36C 4KTVA 3I08A 2V7BA 3IEUA 4JYAC 4FTFA 2P2QA 1J5EC 3PROC 4WV3A 3CW9A 4JI2C 4X66C 2OBVA 3VNRA 2OO4A 1HR0C 1RY2A 2D1SA 2UXCC 2QVXX 4B3MC 4TPSB 2VQEC 2ZM6C 5K85A 3NI2A 4G36A 4DCVA 5AE1A 1HNWC 2UUAC 2QL8A 5BURA 3T1YC 4DV2C 5KYVA 4U5YD 5T8TA 1YJ7A 2DPLA 4AQYC 4DR7C 5BSMA 4DR4C 3NPDA 3TUFA 4DV6C 4D4GA 4BSZA 2WP0C 2E8FA 3IMLA 2HHHC 1XNQC 3L8CA 4LF4C 2PROA 4KTTA 3VNQA 2D27A 4LF6C 1MDBA 4GKJC 1PG4A 3I07A 1MXCA 3C5EA 3R44A 2D28C 2PN2A 5CZXA 5FLXD 1N2FA 4B3TC 1NYEA 4DV3C 1HNXC 3NYQA 4JV5C 1MD9A 3SO4A 1WF3A 1QWIA 1IBMC 2DYJA 1MXAA 4BC7A 4JI1C 4NDNA 2YWBA 1ZB8A 4LF7C 3B7WA 2VQFC 1AMUA 1KKGA 2HJGA 4JI6C 2AYAA 4RM2A 4ZJZA 2YCBA 5H9UA 4ZLPA 2UUBC 3TDEA 3LGXA 4LE5A 3LUSA 3A9UA 4L4QA 3A9VA 5A1GA 1XMOC 5A2QD 4PROC 4D4IA 5KYTA 2XR1A 4JI0C 2BH1X 2ATWA 4BCAA 1ML8A 3S82A 1JOSA 3R9WA 3FCEA 3N2QA 4GXRA 4RM3A 4BC9A 4I9FA 4D57A 4LF8C 2P2BA 2Y27A 3DHVA 4K0BA 5IFIA 1T5DX 4RVNA 1PA4A 3FCCA 2D7VA 4XX2A 2UXDC 2JMPA 4LF9C 4GKKC 4MTNA 4ODJA 3KXWA 4RLFA 3H2TA 3IEVA 3UZ0A 4EATA 4IR7A 1N34C 3DLPX 1IBKC 5KEIA 1RG9A 2OPLB 4FUQA 4D56A 4DUYC 4DR5C 3T1HC 2P02A 2Y4NA 1XRBA 4DV5C 2P20A 2D1QA 1VLAA 4ISBA 1GPMA 4MH4A 4FUTA 5BUSA 3J80D 4G37A 4RVOA 1XRAA 4GXQA 5LMNC 2P2JA 1ULTA 4NXNC 2VSQA 3G7SA 4DR1C 4DR2C 3GR0A 3L95X 3TQIA 1USPA 4PZPA 4JI7C 4IZ6A 4DG9A 1N33C 1I94C 4YY3C 4DUZC 3J81D 2Y4OA 5AE3A 3PBKA 1XMQC 3ETOA 5JRHA 4LF5C 3GR1A 1XNRC 2F4VC 4B3RC 2E7GA 1FUGA 3AF5A 3GKUA 2KZFA 5IT9D 3RG2A 4K0KC 4I9GA 4JI4C 3ETCA 5BSWA 1K0RA 1MXBA 4BBYA 1HH2P 3AF6A 2E8CA 2D1TA 1MKYA 1USPB 1N32C 1LQLA 1HNZC 2UU9C 3IPLA 5IWAC 2EGTA 1BA3A 3EQ6A 5BSUA 2QVZX 3GPCA 4G1IA 2P2MA 3EERA 1P7LA 3DAYA 4DV0C 5DV9A 3R9XA 4X64C 4LFCC 4DV1C 4DV7C 3A4IA 3CW8X 4HPVA 3LNVA 1V26A 4OYCA 1IBLC 2YWCA 1UKKA 2CXCA 4X65C 4R1MA 4JI5C 4OX9C 4DV4C 4L7IA 5BSVA 4GS5A 3RV2A 1O93A 4DR6C 3PESA 4X62C 3NYRA 4NXMC 1V25A 2UUCC 4DCSA 1O9TA 3N54B 2CY1A 4PHTA 5BSRA 1EGAA 4RLQA 3JAMD 4KHPC 2PT7G 5AE2A 3UOWA 4JI3C 4DCTA 1PG3A 3VNSA 1ZB9A 2BJOA 1O90A 2VZEA 1O92A 4R1LA 2E0GA 2WD9A 1XRCA 2E8EA 5ADZA 2OPLA 3CJEA 4NOZA 1LCIA 5T8SA 1QM4A 5A19A 5LMUC 4DR3C 4OXIA 5BSTA 5E7QA 2P2FA 3OTOC 3E7XA 4JI8C 2D1RA 1L2FA 4JM1A 5A1IA 3E7WA 4DG8A 1FJGC 4L2ZA 2UXBC 1MDFA 5BR8C 5GTDA 4B3SC 5BUQA 4YHHC 4R0MA 4DCUA 2ONFA 4LFAC 1T5HX 2E5LC 3LAXA 1WH9A 5K8FA 4WS9A 4LFBC 4RMNA 2ASBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9T A;  1XRC A;  2YWC A;  5A1I A;  4L2Z A;  5T8T A;  1MXA A;  2DPL A;  1MXB A;  1XRA A;  1P7L A;  4NDN A;  2YWB A;  3S82 A;  4KTV A;  5T8S A;  1FUG A;  1QM4 A;  1RG9 A;  4L7I A;  5A19 A;  3A4I A;  3UOW A;  3IML A;  4HPV A;  5H9U A;  2P02 A;  3TQI A;  1XRB A;  4KTT A;  3TDE A;  3RV2 A;  1O93 A;  4LE5 A;  1GPM A;  4L4Q A;  4ODJ A;  4WS9 A;  5A1G A;  1O90 A;  1O92 A;  4K0B A;  3SO4 A;  1MXC A;  2OBV A; 
#chains in the Genus database with same CATH topology
 2QW0 X;  2QVY X;  1VEH A;  5CZV A;  1N36 C;  4KTV A;  3I08 A;  2V7B A;  3IEU A;  4JYA C;  4FTF A;  2P2Q A;  1J5E C;  3PRO C;  4WV3 A;  2M5H A;  3CW9 A;  4JI2 C;  4X66 C;  2OBV A;  3VNR A;  2OO4 A;  1HR0 C;  1RY2 A;  2D1S A;  2UXC C;  4PUG A;  2QVX X;  2CU6 A;  4B3M C;  4TPS B;  2VQE C;  2ZM6 C;  5K85 A;  3NI2 A;  4G36 A;  4DCV A;  5AE1 A;  1HNW C;  2UUA C;  2QL8 A;  5BUR A;  3TR3 A;  3T1Y C;  1IB8 A;  4DV2 C;  5KYV A;  4U5Y D;  5T8T A;  1YJ7 A;  2DPL A;  4AQY C;  4DR7 C;  5BSM A;  4DR4 C;  3NPD A;  3TUF A;  4DV6 C;  1V60 A;  4D4G A;  4BSZ A;  2WP0 C;  2E8F A;  3IML A;  2HHH C;  1XNQ C;  3L8C A;  4PUI A;  4LF4 C;  2PRO A;  4KTT A;  3VNQ A;  2MM9 A;  2D27 A;  4LF6 C;  2MMA B;  1MDB A;  4GKJ C;  1PG4 A;  3I07 A;  1MXC A;  3C5E A;  3R44 A;  2D28 C;  2PN2 A;  5CZX A;  5FLX D;  1N2F A;  4B3T C;  1NYE A;  4DV3 C;  1HNX C;  3NYQ A;  4JV5 C;  1MD9 A;  3SO4 A;  1WF3 A;  1QWI A;  1IBM C;  2DYJ A;  1MXA A;  4BC7 A;  4JI1 C;  4NDN A;  2YWB A;  1ZB8 A;  4LF7 C;  3B7W A;  2VQF C;  1AMU A;  1KKG A;  2HJG A;  1NY8 A;  4JI6 C;  2AYA A;  4RM2 A;  2MCQ A;  4ZJZ A;  2YCB A;  5H9U A;  4ZLP A;  2UUB C;  3TDE A;  3LGX A;  4LE5 A;  3LUS A;  3A9U A;  4L4Q A;  3A9V A;  5A1G A;  1XMO C;  1XS3 A;  5A2Q D;  3UX2 A;  4PRO C;  4D4I A;  5KYT A;  2XR1 A;  4JI0 C;  2BH1 X;  2ATW A;  4BCA A;  1ML8 A;  3S82 A;  1JOS A;  3AY0 A;  3R9W A;  3FCE A;  3N2Q A;  4GXR A;  4RM3 A;  4BC9 A;  4I9F A;  4D57 A;  4LF8 C;  2P2B A;  2Y27 A;  3DHV A;  4K0B A;  5IFI A;  5LCI A;  1T5D X;  1P4E C;  4RVN A;  2YX1 A;  1PA4 A;  3FCC A;  1M6X C;  2D7V A;  1UWD A;  2JNV A;  4XX2 A;  2UXD C;  2JMP A;  2M5O A;  4LF9 C;  4PUH A;  4GKK C;  4MTN A;  4ODJ A;  3KXW A;  4RLF A;  3H2T A;  3IEV A;  3UZ0 A;  4EAT A;  2KZ0 A;  4IR7 A;  1N34 C;  3DLP X;  1IBK C;  5KEI A;  1RG9 A;  2OPL B;  4FUQ A;  2Z51 A;  4D56 A;  4DUY C;  2DHM A;  4DR5 C;  3T1H C;  2P02 A;  2Y4N A;  1XRB A;  4DV5 C;  2P20 A;  2D1Q A;  1VLA A;  4ISB A;  1GPM A;  4MH4 A;  4FUT A;  5BUS A;  3J80 D;  4G37 A;  4RVO A;  1XRA A;  4GXQ A;  5LMN C;  2P2J A;  1ULT A;  4NXN C;  2VSQ A;  3G7S A;  4DR1 C;  4DR2 C;  2KDN A;  3GR0 A;  3L95 X;  3TQI A;  1USP A;  4PZP A;  4JI7 C;  4IZ6 A;  3CQ1 A;  4DG9 A;  1N33 C;  1I94 C;  4YY3 C;  4DUZ C;  3J81 D;  3LNO A;  2Y4O A;  5AE3 A;  3PBK A;  1XMQ C;  3ETO A;  5JRH A;  4LF5 C;  3GR1 A;  1XNR C;  2F4V C;  4B3R C;  2E7G A;  1FUG A;  3AF5 A;  3GKU A;  2KZF A;  5IT9 D;  3RG2 A;  4K0K C;  4I9G A;  1FLO A;  4JI4 C;  3ETC A;  3UEB A;  5BSW A;  1K0R A;  3UX3 A;  1MXB A;  4BBY A;  1HH2 P;  3AF6 A;  2E8C A;  2D1T A;  1MKY A;  1USP B;  1N32 C;  1LQL A;  1HNZ C;  2UU9 C;  3IPL A;  5IWA C;  2EGT A;  3A25 A;  1BA3 A;  1WCJ A;  3EQ6 A;  5BSU A;  2QVZ X;  3CQ3 A;  3GPC A;  4G1I A;  2P2M A;  3EER A;  1P7L A;  3DAY A;  4DV0 C;  5DV9 A;  3R9X A;  2ZZN A;  4X64 C;  4LFC C;  4DV1 C;  4DV7 C;  3A4I A;  3CW8 X;  4HPV A;  3LNV A;  1V26 A;  4OYC A;  1IBL C;  2YWC A;  1UKK A;  2CXC A;  4X65 C;  4R1M A;  4JI5 C;  4OX9 C;  4DV4 C;  4L7I A;  5BSV A;  4GS5 A;  1M6X A;  3RV2 A;  1O93 A;  4DR6 C;  3PES A;  4X62 C;  3NYR A;  4NXM C;  1V25 A;  2UUC C;  4DCS A;  1O9T A;  3N54 B;  2CY1 A;  4PHT A;  5BSR A;  1EGA A;  4RLQ A;  3JAM D;  4KHP C;  2PT7 G;  5AE2 A;  1TH5 A;  3UOW A;  4JI3 C;  4DCT A;  1PG3 A;  3VNS A;  1PU1 A;  1ZB9 A;  2BJO A;  1O90 A;  2VZE A;  1O92 A;  4R1L A;  2E0G A;  2WD9 A;  1XRC A;  2E8E A;  1XHJ A;  5ADZ A;  2OPL A;  3CJE A;  3O2E A;  3K6R A;  4NOZ A;  1LCI A;  5T8S A;  1QM4 A;  5A19 A;  5LMU C;  4DR3 C;  4OXI A;  2NCL A;  5BST A;  1P4E A;  5E7Q A;  2P2F A;  3OTO C;  3E7X A;  4JI8 C;  2D1R A;  1L2F A;  4JM1 A;  5A1I A;  3E7W A;  4DG8 A;  1FJG C;  4L2Z A;  2UXB C;  1MDF A;  3CQ2 A;  5BR8 C;  5GTD A;  4B3S C;  5BUQ A;  4YHH C;  4R0M A;  4DCU A;  2ONF A;  4LFA C;  1T5H X;  2E5L C;  3LAX A;  1WH9 A;  3A26 A;  5K8F A;  4WS9 A;  4LFB C;  4RMN A;  2ZZM A;  2ASB A; 
#chains in the Genus database with same CATH homology
 2QW0 X;  2QVY X;  5CZV A;  1N36 C;  4KTV A;  3I08 A;  2V7B A;  3IEU A;  4JYA C;  4FTF A;  2P2Q A;  1J5E C;  3PRO C;  4WV3 A;  3CW9 A;  4JI2 C;  4X66 C;  2OBV A;  3VNR A;  2OO4 A;  1HR0 C;  1RY2 A;  2D1S A;  2UXC C;  2QVX X;  4B3M C;  4TPS B;  2VQE C;  2ZM6 C;  5K85 A;  3NI2 A;  4G36 A;  4DCV A;  5AE1 A;  1HNW C;  2UUA C;  2QL8 A;  5BUR A;  3T1Y C;  4DV2 C;  5KYV A;  4U5Y D;  5T8T A;  1YJ7 A;  2DPL A;  4AQY C;  4DR7 C;  5BSM A;  4DR4 C;  3NPD A;  3TUF A;  4DV6 C;  4D4G A;  4BSZ A;  2WP0 C;  2E8F A;  3IML A;  2HHH C;  1XNQ C;  3L8C A;  4LF4 C;  2PRO A;  4KTT A;  3VNQ A;  2D27 A;  4LF6 C;  1MDB A;  4GKJ C;  1PG4 A;  3I07 A;  1MXC A;  3C5E A;  3R44 A;  2D28 C;  2PN2 A;  5CZX A;  5FLX D;  1N2F A;  4B3T C;  1NYE A;  4DV3 C;  1HNX C;  3NYQ A;  4JV5 C;  1MD9 A;  3SO4 A;  1WF3 A;  1QWI A;  1IBM C;  2DYJ A;  1MXA A;  4BC7 A;  4JI1 C;  4NDN A;  2YWB A;  1ZB8 A;  4LF7 C;  3B7W A;  2VQF C;  1AMU A;  1KKG A;  2HJG A;  4JI6 C;  2AYA A;  4RM2 A;  4ZJZ A;  2YCB A;  5H9U A;  4ZLP A;  2UUB C;  3TDE A;  3LGX A;  4LE5 A;  3LUS A;  3A9U A;  4L4Q A;  3A9V A;  5A1G A;  1XMO C;  5A2Q D;  4PRO C;  4D4I A;  5KYT A;  2XR1 A;  4JI0 C;  2BH1 X;  2ATW A;  4BCA A;  1ML8 A;  3S82 A;  1JOS A;  3R9W A;  3FCE A;  3N2Q A;  4GXR A;  4RM3 A;  4BC9 A;  4I9F A;  4D57 A;  4LF8 C;  2P2B A;  2Y27 A;  3DHV A;  4K0B A;  5IFI A;  1T5D X;  4RVN A;  1PA4 A;  3FCC A;  2D7V A;  4XX2 A;  2UXD C;  2JMP A;  4LF9 C;  4GKK C;  4MTN A;  4ODJ A;  3KXW A;  4RLF A;  3H2T A;  3IEV A;  3UZ0 A;  4EAT A;  4IR7 A;  1N34 C;  3DLP X;  1IBK C;  5KEI A;  1RG9 A;  2OPL B;  4FUQ A;  4D56 A;  4DUY C;  4DR5 C;  3T1H C;  2P02 A;  2Y4N A;  1XRB A;  4DV5 C;  2P20 A;  2D1Q A;  1VLA A;  4ISB A;  1GPM A;  4MH4 A;  4FUT A;  5BUS A;  3J80 D;  4G37 A;  4RVO A;  1XRA A;  4GXQ A;  5LMN C;  2P2J A;  1ULT A;  4NXN C;  2VSQ A;  3G7S A;  4DR1 C;  4DR2 C;  3GR0 A;  3L95 X;  3TQI A;  1USP A;  4PZP A;  4JI7 C;  4IZ6 A;  4DG9 A;  1N33 C;  1I94 C;  4YY3 C;  4DUZ C;  3J81 D;  2Y4O A;  5AE3 A;  3PBK A;  1XMQ C;  3ETO A;  5JRH A;  4LF5 C;  3GR1 A;  1XNR C;  2F4V C;  4B3R C;  2E7G A;  1FUG A;  3AF5 A;  3GKU A;  2KZF A;  5IT9 D;  3RG2 A;  4K0K C;  4I9G A;  4JI4 C;  3ETC A;  5BSW A;  1K0R A;  1MXB A;  4BBY A;  1HH2 P;  3AF6 A;  2E8C A;  2D1T A;  1MKY A;  1USP B;  1N32 C;  1LQL A;  1HNZ C;  2UU9 C;  3IPL A;  5IWA C;  2EGT A;  1BA3 A;  3EQ6 A;  5BSU A;  2QVZ X;  3GPC A;  4G1I A;  2P2M A;  3EER A;  1P7L A;  3DAY A;  4DV0 C;  5DV9 A;  3R9X A;  4X64 C;  4LFC C;  4DV1 C;  4DV7 C;  3A4I A;  3CW8 X;  4HPV A;  3LNV A;  1V26 A;  4OYC A;  1IBL C;  2YWC A;  1UKK A;  2CXC A;  4X65 C;  4R1M A;  4JI5 C;  4OX9 C;  4DV4 C;  4L7I A;  5BSV A;  4GS5 A;  3RV2 A;  1O93 A;  4DR6 C;  3PES A;  4X62 C;  3NYR A;  4NXM C;  1V25 A;  2UUC C;  4DCS A;  1O9T A;  3N54 B;  2CY1 A;  4PHT A;  5BSR A;  1EGA A;  4RLQ A;  3JAM D;  4KHP C;  2PT7 G;  5AE2 A;  3UOW A;  4JI3 C;  4DCT A;  1PG3 A;  3VNS A;  1ZB9 A;  2BJO A;  1O90 A;  2VZE A;  1O92 A;  4R1L A;  2E0G A;  2WD9 A;  1XRC A;  2E8E A;  5ADZ A;  2OPL A;  3CJE A;  4NOZ A;  1LCI A;  5T8S A;  1QM4 A;  5A19 A;  5LMU C;  4DR3 C;  4OXI A;  5BST A;  5E7Q A;  2P2F A;  3OTO C;  3E7X A;  4JI8 C;  2D1R A;  1L2F A;  4JM1 A;  5A1I A;  3E7W A;  4DG8 A;  1FJG C;  4L2Z A;  2UXB C;  1MDF A;  5BR8 C;  5GTD A;  4B3S C;  5BUQ A;  4YHH C;  4R0M A;  4DCU A;  2ONF A;  4LFA C;  1T5H X;  2E5L C;  3LAX A;  1WH9 A;  5K8F A;  4WS9 A;  4LFB C;  4RMN A;  2ASB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...