1XRAA

Crystal structure of s-adenosylmethionine synthetase
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Crystal structure of S-adenosylmethionine synthetase.
pubmed doi rcsb
molecule tags Methyltransferase
total genus 129
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1995-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1xraA01
3SO4A 3TQIA 1O92A 3RV2A 1O90A 1FUGA 4K0BA 5A19A 4L4QA 4ODJA 3UOWA 1QM4A 5T8SA 5T8TA 4KTTA 3IMLA 1XRBA 3S82A 3TDEA 3A4IA 2YWCA 4WS9A 1XRAA 2YWBA 5H9UA 1XRCA 2P02A 1MXBA 1MXCA 1P7LA 2DPLA 5A1IA 4HPVA 2OBVA 5A1GA 1O9TA 4NDNA 1RG9A 4LE5A 4KTVA 4L2ZA 4L7IA 1O93A 1MXAA 1GPMA
chains in the Genus database with same CATH superfamily
2YX1A 2E8FA 3PBKA 4PUHA 4BCAA 5K85A 2D1SA 4DR5C 3C5EA 2ZM6C 3A25A 1YJ7A 4BBYA 3UX2A 2M5HA 4DV2C 1WF3A 3EQ6A 4DR4C 1MXBA 4ZJZA 4NDNA 3N54B 3L8CA 1MXAA 2XR1A 4L4QA 2ATWA 3NI2A 5ADZA 4DR3C 4RM3A 1MKYA 3ETCA 5DV9A 2OO4A 1MXCA 5A1IA 5CZVA 3AY0A 4JI1C 1PA4A 5IT9D 4D57A 2HJGA 3A9VA 2E8CA 4R1MA 1KKGA 5BSVA 2ONFA 2MCQA 2MMAB 1T5HX 5GTDA 4G36A 3CQ1A 4RLQA 2MM9A 3VNQA 3IMLA 2Y4OA 1PU1A 4IR7A 4JI2C 3LNOA 2E7GA 3IPLA 3GKUA 1N2FA 3R9WA 1RG9A 4JI4C 1K0RA 1O92A 5A19A 1XMOC 1UWDA 1XHJA 2EGTA 4FUTA 5FLXD 4DG9A 4GKJC 2VQFC 4OX9C 2UUAC 1UKKA 3CW9A 2DPLA 3L95X 4OYCA 5KEIA 2PT7G 5BSTA 4KTVA 4MTNA 2OPLA 2VSQA 1GPMA 1L2FA 4K0BA 4IZ6A 4BC9A 2Y27A 2CXCA 3I07A 4ZLPA 3S82A 1QWIA 2WP0C 4WS9A 2D27A 1RY2A 4DUZC 1N32C 3AF6A 1IBLC 2AYAA 2QVZX 4GS5A 4I9GA 4X64C 1N36C 1O9TA 4D56A 4RMNA 1NYEA 2F4VC 4WV3A 2UXBC 3RV2A 4B3MC 2UUBC 3JAMD 2P2QA 1EGAA 5K8FA 3LAXA 4PHTA 2ZZNA 3LGXA 1MDBA 1ZB8A 4I9FA 2P02A 4BSZA 4DCVA 4JI5C 2P2BA 3O2EA 3GR1A 4FUQA 3UZ0A 4NOZA 4L2ZA 4JI8C 4DCUA 3N2QA 5CZXA 1O90A 2PN2A 4G37A 4DV6C 1LCIA 1USPB 5BSMA 1AMUA 2P2FA 1T5DX 1V26A 4DV3C 1M6XC 2M5OA 3GPCA 3T1HC 4LF5C 4G1IA 5LMNC 2D7VA 5IFIA 2HHHC 4RLFA 1MDFA 4DCSA 1XNRC 2KZFA 4PZPA 4R1LA 4DV4C 4DUYC 2KZ0A 3J81D 1XRAA 4JI3C 4D4IA 1I94C 3A9UA 4NXMC 3PESA 1P7LA 4LE5A 5IWAC 4TPSB 1BA3A 4DR7C 4FTFA 4JI6C 1XRBA 4DV1C 1ML8A 2YWCA 3RG2A 4DR1C 2BJOA 1HR0C 2D1RA 1VLAA 4LF9C 1P4EA 4JM1A 3GR0A 4L7IA 1IBMC 4GXRA 4LF4C 4NXNC 3EERA 3VNRA 3NYQA 4D4GA 3UOWA 3CQ2A 1QM4A 4PROC 2UXDC 4KTTA 5BSUA 3TR3A 2JMPA 5BSWA 2E0GA 1N34C 1XRCA 1NY8A 3K6RA 4DV7C 1ZB9A 4JYAC 1IBKC 2YCBA 3E7WA 4LF6C 3DLPX 3B7WA 2KDNA 5AE1A 1V25A 3CW8X 4DR2C 1WH9A 5LCIA 5BUQA 2NCLA 4LF7C 3DAYA 2JNVA 5KYTA 5BURA 3IEVA 4R0MA 2E5LC 2P20A 4PUIA 4MH4A 4YHHC 2PROA 2ASBA 2D1TA 3TQIA 2CU6A 3A26A 2UU9C 1FUGA 1P4EC 4DV0C 4ODJA 3FCCA 3LNVA 3E7XA 4RM2A 3CQ3A 4B3TC 2P2JA 2YWBA 4RVNA 3AF5A 4LFBC 4EATA 2Z51A 2UUCC 4X65C 3ETOA 3FCEA 4KHPC 2D28C 3IEUA 3NYRA 5KYVA 2QL8A 1HNXC 5T8SA 2V7BA 5T8TA 4XX2A 4JI7C 3TDEA 3A4IA 2UXCC 3UEBA 4LFAC 1XNQC 5LMUC 5BUSA 2E8EA 2OBVA 3PROC 4ISBA 2P2MA 3H2TA 1USPA 1O93A 2BH1X 4GXQA 3SO4A 3I08A 1WCJA 1XS3A 4RVOA 3G7SA 1TH5A 3KXWA 3NPDA 4BC7A 2DHMA 1MD9A 3OTOC 4GKKC 2OPLB 5A2QD 5JRHA 2WD9A 1IB8A 1N33C 1HH2P 1ULTA 2VQEC 1V60A 2CY1A 4JI0C 3UX3A 2QW0X 1FLOA 4YY3C 2DYJA 1HNWC 3LUSA 3R44A 4OXIA 4X66C 4B3SC 4X62C 4DR6C 2ZZMA 4DG8A 4B3RC 1VEHA 4DCTA 5H9UA 1PG4A 1J5EC 2QVXX 4HPVA 5E7QA 2VZEA 1PG3A 4PUGA 5BR8C 4DV5C 4U5YD 1JOSA 4K0KC 2QVYX 3VNSA 5AE2A 1LQLA 5BSRA 2D1QA 5AE3A 2Y4NA 3T1YC 4JV5C 3TUFA 4LFCC 1HNZC 3J80D 1XMQC 4LF8C 3R9XA 1M6XA 4AQYC 1FJGC 3CJEA 5A1GA 3DHVA
chains in the Genus database with same CATH topology
2E8FA 3PBKA 4BCAA 5K85A 2D1SA 4DR5C 3C5EA 2ZM6C 1YJ7A 4BBYA 4DV2C 1WF3A 3EQ6A 4DR4C 1MXBA 4ZJZA 4NDNA 3N54B 3L8CA 1MXAA 2XR1A 4L4QA 2ATWA 3NI2A 5ADZA 4DR3C 4RM3A 1MKYA 3ETCA 5DV9A 2OO4A 1MXCA 5A1IA 5CZVA 4JI1C 1PA4A 5IT9D 4D57A 2HJGA 3A9VA 2E8CA 4R1MA 1KKGA 5BSVA 2ONFA 1T5HX 5GTDA 4G36A 4RLQA 3VNQA 3IMLA 2Y4OA 4IR7A 4JI2C 2E7GA 3IPLA 3GKUA 1N2FA 3R9WA 1RG9A 4JI4C 1K0RA 1O92A 5A19A 1XMOC 2EGTA 4FUTA 5FLXD 4DG9A 4GKJC 2VQFC 4OX9C 2UUAC 1UKKA 3CW9A 2DPLA 3L95X 4OYCA 5KEIA 2PT7G 5BSTA 4KTVA 4MTNA 2OPLA 2VSQA 1GPMA 1L2FA 4K0BA 4IZ6A 4BC9A 2Y27A 2CXCA 3I07A 4ZLPA 3S82A 1QWIA 2WP0C 4WS9A 2D27A 1RY2A 4DUZC 1N32C 3AF6A 1IBLC 2AYAA 2QVZX 4GS5A 4I9GA 4X64C 1N36C 1O9TA 4D56A 4RMNA 1NYEA 2F4VC 4WV3A 2UXBC 3RV2A 4B3MC 2UUBC 3JAMD 2P2QA 1EGAA 5K8FA 3LAXA 4PHTA 3LGXA 1MDBA 1ZB8A 4I9FA 2P02A 4BSZA 4DCVA 4JI5C 2P2BA 3GR1A 4FUQA 3UZ0A 4NOZA 4L2ZA 4JI8C 4DCUA 3N2QA 5CZXA 1O90A 2PN2A 4G37A 4DV6C 1LCIA 1USPB 5BSMA 1AMUA 2P2FA 1T5DX 1V26A 4DV3C 3GPCA 3T1HC 4LF5C 4G1IA 5LMNC 2D7VA 5IFIA 2HHHC 4RLFA 1MDFA 4DCSA 1XNRC 2KZFA 4PZPA 4R1LA 4DV4C 4DUYC 3J81D 1XRAA 4JI3C 4D4IA 1I94C 3A9UA 4NXMC 3PESA 1P7LA 4LE5A 5IWAC 4TPSB 1BA3A 4DR7C 4FTFA 4JI6C 1XRBA 4DV1C 1ML8A 2YWCA 3RG2A 4DR1C 2BJOA 1HR0C 2D1RA 1VLAA 4LF9C 4JM1A 3GR0A 4L7IA 1IBMC 4GXRA 4LF4C 4NXNC 3EERA 3VNRA 3NYQA 4D4GA 3UOWA 1QM4A 4PROC 2UXDC 4KTTA 5BSUA 2JMPA 5BSWA 2E0GA 1N34C 1XRCA 4DV7C 1ZB9A 4JYAC 1IBKC 2YCBA 3E7WA 4LF6C 3DLPX 3B7WA 5AE1A 1V25A 3CW8X 4DR2C 1WH9A 5BUQA 4LF7C 3DAYA 5KYTA 5BURA 3IEVA 4R0MA 2E5LC 2P20A 4MH4A 4YHHC 2PROA 2ASBA 2D1TA 3TQIA 2UU9C 1FUGA 4DV0C 4ODJA 3FCCA 3LNVA 3E7XA 4RM2A 4B3TC 2P2JA 2YWBA 4RVNA 3AF5A 4LFBC 4EATA 2UUCC 4X65C 3ETOA 3FCEA 4KHPC 2D28C 3IEUA 3NYRA 5KYVA 2QL8A 1HNXC 5T8SA 2V7BA 5T8TA 4XX2A 4JI7C 3TDEA 3A4IA 2UXCC 4LFAC 1XNQC 5LMUC 5BUSA 2E8EA 2OBVA 3PROC 4ISBA 2P2MA 3H2TA 1USPA 1O93A 2BH1X 4GXQA 3SO4A 3I08A 4RVOA 3G7SA 3KXWA 3NPDA 4BC7A 1MD9A 3OTOC 4GKKC 2OPLB 5A2QD 5JRHA 2WD9A 1N33C 1HH2P 1ULTA 2VQEC 2CY1A 4JI0C 2QW0X 4YY3C 2DYJA 1HNWC 3LUSA 3R44A 4OXIA 4X66C 4B3SC 4X62C 4DR6C 4DG8A 4B3RC 4DCTA 5H9UA 1PG4A 1J5EC 2QVXX 4HPVA 5E7QA 2VZEA 1PG3A 5BR8C 4DV5C 4U5YD 1JOSA 4K0KC 2QVYX 3VNSA 5AE2A 1LQLA 5BSRA 2D1QA 5AE3A 2Y4NA 3T1YC 4JV5C 3TUFA 4LFCC 1HNZC 3J80D 1XMQC 4LF8C 3R9XA 4AQYC 1FJGC 3CJEA 5A1GA 3DHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SO4 A;  3TQI A;  1O92 A;  3RV2 A;  1O90 A;  1FUG A;  4K0B A;  5A19 A;  4L4Q A;  4ODJ A;  3UOW A;  1QM4 A;  5T8S A;  5T8T A;  4KTT A;  3IML A;  1XRB A;  3S82 A;  3TDE A;  3A4I A;  2YWC A;  4WS9 A;  1XRA A;  2YWB A;  5H9U A;  1XRC A;  2P02 A;  1MXB A;  1MXC A;  1P7L A;  2DPL A;  5A1I A;  4HPV A;  2OBV A;  5A1G A;  1O9T A;  4NDN A;  1RG9 A;  4LE5 A;  4KTV A;  4L2Z A;  4L7I A;  1O93 A;  1MXA A;  1GPM A; 
#chains in the Genus database with same CATH topology
 2YX1 A;  2E8F A;  3PBK A;  4PUH A;  4BCA A;  5K85 A;  2D1S A;  4DR5 C;  3C5E A;  2ZM6 C;  3A25 A;  1YJ7 A;  4BBY A;  3UX2 A;  2M5H A;  4DV2 C;  1WF3 A;  3EQ6 A;  4DR4 C;  1MXB A;  4ZJZ A;  4NDN A;  3N54 B;  3L8C A;  1MXA A;  2XR1 A;  4L4Q A;  2ATW A;  3NI2 A;  5ADZ A;  4DR3 C;  4RM3 A;  1MKY A;  3ETC A;  5DV9 A;  2OO4 A;  1MXC A;  5A1I A;  5CZV A;  3AY0 A;  4JI1 C;  1PA4 A;  5IT9 D;  4D57 A;  2HJG A;  3A9V A;  2E8C A;  4R1M A;  1KKG A;  5BSV A;  2ONF A;  2MCQ A;  2MMA B;  1T5H X;  5GTD A;  4G36 A;  3CQ1 A;  4RLQ A;  2MM9 A;  3VNQ A;  3IML A;  2Y4O A;  1PU1 A;  4IR7 A;  4JI2 C;  3LNO A;  2E7G A;  3IPL A;  3GKU A;  1N2F A;  3R9W A;  1RG9 A;  4JI4 C;  1K0R A;  1O92 A;  5A19 A;  1XMO C;  1UWD A;  1XHJ A;  2EGT A;  4FUT A;  5FLX D;  4DG9 A;  4GKJ C;  2VQF C;  4OX9 C;  2UUA C;  1UKK A;  3CW9 A;  2DPL A;  3L95 X;  4OYC A;  5KEI A;  2PT7 G;  5BST A;  4KTV A;  4MTN A;  2OPL A;  2VSQ A;  1GPM A;  1L2F A;  4K0B A;  4IZ6 A;  4BC9 A;  2Y27 A;  2CXC A;  3I07 A;  4ZLP A;  3S82 A;  1QWI A;  2WP0 C;  4WS9 A;  2D27 A;  1RY2 A;  4DUZ C;  1N32 C;  3AF6 A;  1IBL C;  2AYA A;  2QVZ X;  4GS5 A;  4I9G A;  4X64 C;  1N36 C;  1O9T A;  4D56 A;  4RMN A;  1NYE A;  2F4V C;  4WV3 A;  2UXB C;  3RV2 A;  4B3M C;  2UUB C;  3JAM D;  2P2Q A;  1EGA A;  5K8F A;  3LAX A;  4PHT A;  2ZZN A;  3LGX A;  1MDB A;  1ZB8 A;  4I9F A;  2P02 A;  4BSZ A;  4DCV A;  4JI5 C;  2P2B A;  3O2E A;  3GR1 A;  4FUQ A;  3UZ0 A;  4NOZ A;  4L2Z A;  4JI8 C;  4DCU A;  3N2Q A;  5CZX A;  1O90 A;  2PN2 A;  4G37 A;  4DV6 C;  1LCI A;  1USP B;  5BSM A;  1AMU A;  2P2F A;  1T5D X;  1V26 A;  4DV3 C;  1M6X C;  2M5O A;  3GPC A;  3T1H C;  4LF5 C;  4G1I A;  5LMN C;  2D7V A;  5IFI A;  2HHH C;  4RLF A;  1MDF A;  4DCS A;  1XNR C;  2KZF A;  4PZP A;  4R1L A;  4DV4 C;  4DUY C;  2KZ0 A;  3J81 D;  1XRA A;  4JI3 C;  4D4I A;  1I94 C;  3A9U A;  4NXM C;  3PES A;  1P7L A;  4LE5 A;  5IWA C;  4TPS B;  1BA3 A;  4DR7 C;  4FTF A;  4JI6 C;  1XRB A;  4DV1 C;  1ML8 A;  2YWC A;  3RG2 A;  4DR1 C;  2BJO A;  1HR0 C;  2D1R A;  1VLA A;  4LF9 C;  1P4E A;  4JM1 A;  3GR0 A;  4L7I A;  1IBM C;  4GXR A;  4LF4 C;  4NXN C;  3EER A;  3VNR A;  3NYQ A;  4D4G A;  3UOW A;  3CQ2 A;  1QM4 A;  4PRO C;  2UXD C;  4KTT A;  5BSU A;  3TR3 A;  2JMP A;  5BSW A;  2E0G A;  1N34 C;  1XRC A;  1NY8 A;  3K6R A;  4DV7 C;  1ZB9 A;  4JYA C;  1IBK C;  2YCB A;  3E7W A;  4LF6 C;  3DLP X;  3B7W A;  2KDN A;  5AE1 A;  1V25 A;  3CW8 X;  4DR2 C;  1WH9 A;  5LCI A;  5BUQ A;  2NCL A;  4LF7 C;  3DAY A;  2JNV A;  5KYT A;  5BUR A;  3IEV A;  4R0M A;  2E5L C;  2P20 A;  4PUI A;  4MH4 A;  4YHH C;  2PRO A;  2ASB A;  2D1T A;  3TQI A;  2CU6 A;  3A26 A;  2UU9 C;  1FUG A;  1P4E C;  4DV0 C;  4ODJ A;  3FCC A;  3LNV A;  3E7X A;  4RM2 A;  3CQ3 A;  4B3T C;  2P2J A;  2YWB A;  4RVN A;  3AF5 A;  4LFB C;  4EAT A;  2Z51 A;  2UUC C;  4X65 C;  3ETO A;  3FCE A;  4KHP C;  2D28 C;  3IEU A;  3NYR A;  5KYV A;  2QL8 A;  1HNX C;  5T8S A;  2V7B A;  5T8T A;  4XX2 A;  4JI7 C;  3TDE A;  3A4I A;  2UXC C;  3UEB A;  4LFA C;  1XNQ C;  5LMU C;  5BUS A;  2E8E A;  2OBV A;  3PRO C;  4ISB A;  2P2M A;  3H2T A;  1USP A;  1O93 A;  2BH1 X;  4GXQ A;  3SO4 A;  3I08 A;  1WCJ A;  1XS3 A;  4RVO A;  3G7S A;  1TH5 A;  3KXW A;  3NPD A;  4BC7 A;  2DHM A;  1MD9 A;  3OTO C;  4GKK C;  2OPL B;  5A2Q D;  5JRH A;  2WD9 A;  1IB8 A;  1N33 C;  1HH2 P;  1ULT A;  2VQE C;  1V60 A;  2CY1 A;  4JI0 C;  3UX3 A;  2QW0 X;  1FLO A;  4YY3 C;  2DYJ A;  1HNW C;  3LUS A;  3R44 A;  4OXI A;  4X66 C;  4B3S C;  4X62 C;  4DR6 C;  2ZZM A;  4DG8 A;  4B3R C;  1VEH A;  4DCT A;  5H9U A;  1PG4 A;  1J5E C;  2QVX X;  4HPV A;  5E7Q A;  2VZE A;  1PG3 A;  4PUG A;  5BR8 C;  4DV5 C;  4U5Y D;  1JOS A;  4K0K C;  2QVY X;  3VNS A;  5AE2 A;  1LQL A;  5BSR A;  2D1Q A;  5AE3 A;  2Y4N A;  3T1Y C;  4JV5 C;  3TUF A;  4LFC C;  1HNZ C;  3J80 D;  1XMQ C;  4LF8 C;  3R9X A;  1M6X A;  4AQY C;  1FJG C;  3CJE A;  5A1G A;  3DHV A; 
#chains in the Genus database with same CATH homology
 2E8F A;  3PBK A;  4BCA A;  5K85 A;  2D1S A;  4DR5 C;  3C5E A;  2ZM6 C;  1YJ7 A;  4BBY A;  4DV2 C;  1WF3 A;  3EQ6 A;  4DR4 C;  1MXB A;  4ZJZ A;  4NDN A;  3N54 B;  3L8C A;  1MXA A;  2XR1 A;  4L4Q A;  2ATW A;  3NI2 A;  5ADZ A;  4DR3 C;  4RM3 A;  1MKY A;  3ETC A;  5DV9 A;  2OO4 A;  1MXC A;  5A1I A;  5CZV A;  4JI1 C;  1PA4 A;  5IT9 D;  4D57 A;  2HJG A;  3A9V A;  2E8C A;  4R1M A;  1KKG A;  5BSV A;  2ONF A;  1T5H X;  5GTD A;  4G36 A;  4RLQ A;  3VNQ A;  3IML A;  2Y4O A;  4IR7 A;  4JI2 C;  2E7G A;  3IPL A;  3GKU A;  1N2F A;  3R9W A;  1RG9 A;  4JI4 C;  1K0R A;  1O92 A;  5A19 A;  1XMO C;  2EGT A;  4FUT A;  5FLX D;  4DG9 A;  4GKJ C;  2VQF C;  4OX9 C;  2UUA C;  1UKK A;  3CW9 A;  2DPL A;  3L95 X;  4OYC A;  5KEI A;  2PT7 G;  5BST A;  4KTV A;  4MTN A;  2OPL A;  2VSQ A;  1GPM A;  1L2F A;  4K0B A;  4IZ6 A;  4BC9 A;  2Y27 A;  2CXC A;  3I07 A;  4ZLP A;  3S82 A;  1QWI A;  2WP0 C;  4WS9 A;  2D27 A;  1RY2 A;  4DUZ C;  1N32 C;  3AF6 A;  1IBL C;  2AYA A;  2QVZ X;  4GS5 A;  4I9G A;  4X64 C;  1N36 C;  1O9T A;  4D56 A;  4RMN A;  1NYE A;  2F4V C;  4WV3 A;  2UXB C;  3RV2 A;  4B3M C;  2UUB C;  3JAM D;  2P2Q A;  1EGA A;  5K8F A;  3LAX A;  4PHT A;  3LGX A;  1MDB A;  1ZB8 A;  4I9F A;  2P02 A;  4BSZ A;  4DCV A;  4JI5 C;  2P2B A;  3GR1 A;  4FUQ A;  3UZ0 A;  4NOZ A;  4L2Z A;  4JI8 C;  4DCU A;  3N2Q A;  5CZX A;  1O90 A;  2PN2 A;  4G37 A;  4DV6 C;  1LCI A;  1USP B;  5BSM A;  1AMU A;  2P2F A;  1T5D X;  1V26 A;  4DV3 C;  3GPC A;  3T1H C;  4LF5 C;  4G1I A;  5LMN C;  2D7V A;  5IFI A;  2HHH C;  4RLF A;  1MDF A;  4DCS A;  1XNR C;  2KZF A;  4PZP A;  4R1L A;  4DV4 C;  4DUY C;  3J81 D;  1XRA A;  4JI3 C;  4D4I A;  1I94 C;  3A9U A;  4NXM C;  3PES A;  1P7L A;  4LE5 A;  5IWA C;  4TPS B;  1BA3 A;  4DR7 C;  4FTF A;  4JI6 C;  1XRB A;  4DV1 C;  1ML8 A;  2YWC A;  3RG2 A;  4DR1 C;  2BJO A;  1HR0 C;  2D1R A;  1VLA A;  4LF9 C;  4JM1 A;  3GR0 A;  4L7I A;  1IBM C;  4GXR A;  4LF4 C;  4NXN C;  3EER A;  3VNR A;  3NYQ A;  4D4G A;  3UOW A;  1QM4 A;  4PRO C;  2UXD C;  4KTT A;  5BSU A;  2JMP A;  5BSW A;  2E0G A;  1N34 C;  1XRC A;  4DV7 C;  1ZB9 A;  4JYA C;  1IBK C;  2YCB A;  3E7W A;  4LF6 C;  3DLP X;  3B7W A;  5AE1 A;  1V25 A;  3CW8 X;  4DR2 C;  1WH9 A;  5BUQ A;  4LF7 C;  3DAY A;  5KYT A;  5BUR A;  3IEV A;  4R0M A;  2E5L C;  2P20 A;  4MH4 A;  4YHH C;  2PRO A;  2ASB A;  2D1T A;  3TQI A;  2UU9 C;  1FUG A;  4DV0 C;  4ODJ A;  3FCC A;  3LNV A;  3E7X A;  4RM2 A;  4B3T C;  2P2J A;  2YWB A;  4RVN A;  3AF5 A;  4LFB C;  4EAT A;  2UUC C;  4X65 C;  3ETO A;  3FCE A;  4KHP C;  2D28 C;  3IEU A;  3NYR A;  5KYV A;  2QL8 A;  1HNX C;  5T8S A;  2V7B A;  5T8T A;  4XX2 A;  4JI7 C;  3TDE A;  3A4I A;  2UXC C;  4LFA C;  1XNQ C;  5LMU C;  5BUS A;  2E8E A;  2OBV A;  3PRO C;  4ISB A;  2P2M A;  3H2T A;  1USP A;  1O93 A;  2BH1 X;  4GXQ A;  3SO4 A;  3I08 A;  4RVO A;  3G7S A;  3KXW A;  3NPD A;  4BC7 A;  1MD9 A;  3OTO C;  4GKK C;  2OPL B;  5A2Q D;  5JRH A;  2WD9 A;  1N33 C;  1HH2 P;  1ULT A;  2VQE C;  2CY1 A;  4JI0 C;  2QW0 X;  4YY3 C;  2DYJ A;  1HNW C;  3LUS A;  3R44 A;  4OXI A;  4X66 C;  4B3S C;  4X62 C;  4DR6 C;  4DG8 A;  4B3R C;  4DCT A;  5H9U A;  1PG4 A;  1J5E C;  2QVX X;  4HPV A;  5E7Q A;  2VZE A;  1PG3 A;  5BR8 C;  4DV5 C;  4U5Y D;  1JOS A;  4K0K C;  2QVY X;  3VNS A;  5AE2 A;  1LQL A;  5BSR A;  2D1Q A;  5AE3 A;  2Y4N A;  3T1Y C;  4JV5 C;  3TUF A;  4LFC C;  1HNZ C;  3J80 D;  1XMQ C;  4LF8 C;  3R9X A;  4AQY C;  1FJG C;  3CJE A;  5A1G A;  3DHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...