2CY1A

Crystal structure of ape1850
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVKRARLVLSKLFGVEKVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NusA protein homolog
publication title Crystallization of the archaeal transcription termination factor NusA: a significant decrease in twinning under microgravity conditions
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A02
2PT7G 2QL8A 2F4VC 1EGAA 1L2FA 3AF5A 4X65C 2UU9C 2UXDC 2HJGA 1JOSA 4NOZA 4JI1C 1HNZC 3OTOC 4X64C 4YHHC 1J5EC 5IWAC 2ATWA 1HNWC 4DR2C 4DUYC 4NXNC 1QWIA 2PN2A 1VLAA 1HH2P 1ZB8A 2EGTA 1FJGC 4XX2A 4DV5C 2OPLB 4YY3C 4GKKC 1N33C 3AF6A 1HNXC 2UXBC 1IBLC 4LF9C 3LUSA 2ZM6C 2DYJA 4MTNA 2E8FA 4DR7C 4K0KC 3CJEA 5BR8C 2VQFC 5LMNC 3GKUA 4JYAC 1USPB 1N32C 2YCBA 5IT9D 4GKJC 4DCVA 2UUBC 1K0RA 2E8CA 1IBKC 4LFAC 4DUZC 4DR3C 4AQYC 2UUAC 4JI6C 1IBMC 4B3RC 4LF8C 4JI7C 4DR4C 4OX9C 3IEVA 2BJOA 3EERA 1XMOC 1ML8A 4DR6C 1XNQC 4B3SC 4KHPC 4JV5C 1NYEA 2XR1A 5A2QD 3T1HC 4JI5C 3R9WA 1N34C 3T1YC 4B3TC 4LFCC 3J80D 2UUCC 4JI0C 4BSZA 4DV2C 4DV3C 4B3MC 2E7GA 4LF4C 4MH4A 2E8EA 2CXCA 4JI3C 4DCSA 4LF7C 4LFBC 5FLXD 5LMUC 3J81D 2CY1A 1XMQC 1LQLA 2OPLA 1XNRC 2JMPA 4JI8C 2VQEC 4DCUA 4JI2C 4LF5C 4DR5C 4DV4C 2D7VA 1N2FA 1N36C 3IEUA 2E5LC 2HHHC 1WF3A 4DV7C 1WH9A 1HR0C 4JI4C 2UXCC 1PA4A 2ONFA 4X62C 1UKKA 1ZB9A 1MKYA 4DV0C 2ASBA 1USPA 3JAMD 4DV6C 4DCTA 4DR1C 4DV1C 1KKGA 2KZFA 1I94C 3R9XA 4LF6C 3I07A 4NXMC 4X66C
chains in the Genus database with same CATH superfamily
2F4VC 4X65C 1P7LA 5BSVA 2UU9C 3AY0A 3NI2A 5AE2A 5BURA 4X64C 4BC7A 1J5EC 3UZ0A 1XS3A 3TDEA 2MMAB 1HNWC 4DR2C 1HH2P 1ZB8A 1P4EA 3DLPX 5K8FA 4PUIA 2MCQA 1PU1A 4RM3A 4YY3C 2YX1A 1UWDA 3EQ6A 1IBLC 3IMLA 2WP0C 4MTNA 2NCLA 1O90A 1V26A 1O93A 2JNVA 4PHTA 4TPSB 5BR8C 3GKUA 2UUBC 4D4IA 3A25A 1IBMC 4B3RC 3CW8X 4D4GA 1PG4A 2D1QA 4RMNA 3E7WA 3S82A 2PROA 3IEVA 2ZZMA 2P02A 2D27A 3VNRA 4DR6C 2D1RA 3CQ2A 1XRBA 4B3SC 4KHPC 3NPDA 1NYEA 3VNQA 3R9WA 4DV2C 1AMUA 4JI3C 5IFIA 3B7WA 4LFBC 5BSWA 5LMUC 1MXAA 1LQLA 2OPLA 3K6RA 4JI8C 2VQEC 4DCUA 5JRHA 4DR5C 4DV4C 4K0BA 3IPLA 2BH1X 2QVYX 4BCAA 2P2JA 1PA4A 4X62C 1PG3A 1MKYA 2ASBA 4DV6C 1I94C 4ZJZA 2OBVA 1RG9A 4IZ6A 2PT7G 4G1IA 1L2FA 4FUTA 3LNVA 2HJGA 1JOSA 1O92A 5A1GA 3GR1A 3L95X 4GS5A 4U5YD 1QWIA 2PN2A 2ZZNA 1FJGC 2P2QA 3A26A 2WD9A 3CW9A 1N33C 3I08A 4LF9C 4GXQA 3FCCA 2ZM6C 1T5DX 2DYJA 4PROC 3PESA 4DG8A 4PZPA 3CQ3A 2E8FA 3NYQA 3PROC 3CQ1A 5LCIA 2VQFC 4RVNA 5LMNC 3N54B 1USPB 1GPMA 4ODJA 4DCVA 3VNSA 5CZVA 4AQYC 3N2QA 4JI6C 3UEBA 4JI7C 3GPCA 2KDNA 2BJOA 3EERA 5BUQA 4L2ZA 3NYRA 3O2EA 2XR1A 3A9VA 2M5OA 3LAXA 1N34C 4LFCC 3J80D 4BSZA 4DV3C 4B3MC 2E7GA 4OYCA 4LF4C 2E8EA 3UX2A 4FUQA 2YWCA 3UOWA 5FLXD 4PUGA 3DHVA 2DHMA 2CY1A 2CU6A 3J81D 1XNRC 2JMPA 5A19A 1WCJA 4BC9A 4LF5C 5DV9A 1N2FA 4DV7C 1HR0C 4FTFA 4JI4C 2ONFA 1ULTA 1UKKA 3GR0A 4G37A 3TUFA 4DV0C 2D28C 4DCTA 1XRAA 1LCIA 4R1LA 1V60A 2Y4NA 3KXWA 4NXMC 3C5EA 3E7XA 3PBKA 4KTTA 2MM9A 4KTVA 2QL8A 1MD9A 4JI1C 1HNZC 3OTOC 4BBYA 4L4QA 5KYTA 3UX3A 3TQIA 4YHHC 5K85A 3ETOA 5IWAC 4HPVA 4DUYC 4NXNC 1FUGA 4XX2A 2OPLB 2Z51A 1TH5A 4GKKC 3AF6A 2UXBC 2VSQA 5AE1A 4DR7C 4I9FA 4K0KC 3CJEA 2P2BA 5A1IA 4GXRA 2YCBA 5IT9D 4GKJC 2QVZX 1K0RA 2E8CA 4DUZC 2UUAC 2VZEA 4RLFA 3SO4A 3R44A 1XMOC 5T8TA 2QVXX 4JV5C 1M6XC 4JI5C 3T1YC 4B3TC 3G7SA 5BSUA 5KYVA 4ZLPA 4LF7C 1NY8A 5BSRA 4D57A 2D1SA 4WV3A 5BSTA 5KEIA 2D7VA 3DAYA 5T8SA 1MXBA 3FCEA 1N36C 3A4IA 3IEUA 2E5LC 2UXCC 5GTDA 1YJ7A 4DR1C 1KKGA 2KZFA 3H2TA 4JM1A 3LGXA 2P2FA 1P4EC 4R1MA 1EGAA 3AF5A 2UXDC 4NOZA 4RLQA 5H9UA 1MDFA 3L8CA 2ATWA 5BSMA 1VLAA 4LE5A 2EGTA 1MDBA 4DV5C 2P20A 1IB8A 1RY2A 1O9TA 2M5HA 2QW0X 1HNXC 4PUHA 5BUSA 5E7QA 3LUSA 4OXIA 4L7IA 3ETCA 2Y27A 4RVOA 4JYAC 1N32C 1VEHA 4DG9A 1IBKC 4LFAC 4RM2A 4NDNA 1XHJA 4DR3C 3TR3A 5CZXA 2DPLA 4LF8C 4R0MA 1V25A 4DR4C 4WS9A 5AE3A 4OX9C 4ISBA 5ADZA 2AYAA 1XRCA 2E0GA 1ML8A 2Y4OA 4G36A 1XNQC 1QM4A 4IR7A 3T1HC 5A2QD 3LNOA 2UUCC 4JI0C 3RG2A 2V7BA 4MH4A 4I9GA 2CXCA 2P2MA 4DCSA 1XMQC 4D56A 4EATA 1T5HX 1M6XA 4JI2C 3A9UA 3RV2A 1FLOA 1BA3A 2HHHC 1WF3A 1WH9A 2D1TA 1ZB9A 2KZ0A 1MXCA 1USPA 3JAMD 4DV1C 2OO4A 3R9XA 2YWBA 4LF6C 3I07A 4X66C
chains in the Genus database with same CATH topology
2F4VC 4X65C 1P7LA 5BSVA 2UU9C 3NI2A 5AE2A 5BURA 4X64C 4BC7A 1J5EC 3UZ0A 3TDEA 1HNWC 4DR2C 1HH2P 1ZB8A 3DLPX 5K8FA 4RM3A 4YY3C 3EQ6A 1IBLC 3IMLA 2WP0C 4MTNA 1O90A 1V26A 1O93A 4PHTA 4TPSB 5BR8C 3GKUA 2UUBC 4D4IA 1IBMC 4B3RC 3CW8X 4D4GA 1PG4A 2D1QA 4RMNA 3E7WA 3S82A 2PROA 3IEVA 2P02A 2D27A 3VNRA 4DR6C 2D1RA 1XRBA 4B3SC 4KHPC 3NPDA 1NYEA 3VNQA 3R9WA 4DV2C 1AMUA 4JI3C 5IFIA 3B7WA 4LFBC 5BSWA 5LMUC 1MXAA 1LQLA 2OPLA 4JI8C 2VQEC 4DCUA 5JRHA 4DR5C 4DV4C 4K0BA 3IPLA 2BH1X 2QVYX 4BCAA 2P2JA 1PA4A 4X62C 1PG3A 1MKYA 2ASBA 4DV6C 1I94C 4ZJZA 2OBVA 1RG9A 4IZ6A 2PT7G 4G1IA 1L2FA 4FUTA 3LNVA 2HJGA 1JOSA 1O92A 5A1GA 3GR1A 3L95X 4GS5A 4U5YD 1QWIA 2PN2A 1FJGC 2P2QA 2WD9A 3CW9A 1N33C 3I08A 4LF9C 4GXQA 3FCCA 2ZM6C 1T5DX 2DYJA 4PROC 3PESA 4DG8A 4PZPA 2E8FA 3NYQA 3PROC 2VQFC 4RVNA 5LMNC 3N54B 1USPB 1GPMA 4ODJA 4DCVA 3VNSA 5CZVA 4AQYC 3N2QA 4JI6C 4JI7C 3GPCA 2BJOA 3EERA 5BUQA 4L2ZA 3NYRA 2XR1A 3A9VA 3LAXA 1N34C 4LFCC 3J80D 4BSZA 4DV3C 4B3MC 2E7GA 4OYCA 4LF4C 2E8EA 4FUQA 2YWCA 3UOWA 5FLXD 3DHVA 2CY1A 3J81D 1XNRC 2JMPA 5A19A 4BC9A 4LF5C 5DV9A 1N2FA 4DV7C 1HR0C 4FTFA 4JI4C 2ONFA 1ULTA 1UKKA 3GR0A 4G37A 3TUFA 4DV0C 2D28C 4DCTA 1XRAA 1LCIA 4R1LA 2Y4NA 3KXWA 4NXMC 3C5EA 3E7XA 3PBKA 4KTTA 4KTVA 2QL8A 1MD9A 4JI1C 1HNZC 3OTOC 4BBYA 4L4QA 5KYTA 3TQIA 4YHHC 5K85A 3ETOA 5IWAC 4HPVA 4DUYC 4NXNC 1FUGA 4XX2A 2OPLB 4GKKC 3AF6A 2UXBC 2VSQA 5AE1A 4DR7C 4I9FA 4K0KC 3CJEA 2P2BA 5A1IA 4GXRA 2YCBA 5IT9D 4GKJC 2QVZX 1K0RA 2E8CA 4DUZC 2UUAC 2VZEA 4RLFA 3SO4A 3R44A 1XMOC 5T8TA 2QVXX 4JV5C 4JI5C 3T1YC 4B3TC 3G7SA 5BSUA 5KYVA 4ZLPA 4LF7C 5BSRA 4D57A 2D1SA 4WV3A 5BSTA 5KEIA 2D7VA 3DAYA 5T8SA 1MXBA 3FCEA 1N36C 3A4IA 3IEUA 2E5LC 2UXCC 5GTDA 1YJ7A 4DR1C 1KKGA 2KZFA 3H2TA 4JM1A 3LGXA 2P2FA 4R1MA 1EGAA 3AF5A 2UXDC 4NOZA 4RLQA 5H9UA 1MDFA 3L8CA 2ATWA 5BSMA 1VLAA 4LE5A 2EGTA 1MDBA 4DV5C 2P20A 1RY2A 1O9TA 2QW0X 1HNXC 5BUSA 5E7QA 3LUSA 4OXIA 4L7IA 3ETCA 2Y27A 4RVOA 4JYAC 1N32C 4DG9A 1IBKC 4LFAC 4RM2A 4NDNA 4DR3C 5CZXA 2DPLA 4LF8C 4R0MA 1V25A 4DR4C 4WS9A 5AE3A 4OX9C 4ISBA 5ADZA 2AYAA 1XRCA 2E0GA 1ML8A 2Y4OA 4G36A 1XNQC 1QM4A 4IR7A 3T1HC 5A2QD 2UUCC 4JI0C 3RG2A 2V7BA 4MH4A 4I9GA 2CXCA 2P2MA 4DCSA 1XMQC 4D56A 4EATA 1T5HX 4JI2C 3A9UA 3RV2A 1BA3A 2HHHC 1WF3A 1WH9A 2D1TA 1ZB9A 1MXCA 1USPA 3JAMD 4DV1C 2OO4A 3R9XA 2YWBA 4LF6C 3I07A 4X66C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PT7 G;  2QL8 A;  2F4V C;  1EGA A;  1L2F A;  3AF5 A;  4X65 C;  2UU9 C;  2UXD C;  2HJG A;  1JOS A;  4NOZ A;  4JI1 C;  1HNZ C;  3OTO C;  4X64 C;  4YHH C;  1J5E C;  5IWA C;  2ATW A;  1HNW C;  4DR2 C;  4DUY C;  4NXN C;  1QWI A;  2PN2 A;  1VLA A;  1HH2 P;  1ZB8 A;  2EGT A;  1FJG C;  4XX2 A;  4DV5 C;  2OPL B;  4YY3 C;  4GKK C;  1N33 C;  3AF6 A;  1HNX C;  2UXB C;  1IBL C;  4LF9 C;  3LUS A;  2ZM6 C;  2DYJ A;  4MTN A;  2E8F A;  4DR7 C;  4K0K C;  3CJE A;  5BR8 C;  2VQF C;  5LMN C;  3GKU A;  4JYA C;  1USP B;  1N32 C;  2YCB A;  5IT9 D;  4GKJ C;  4DCV A;  2UUB C;  1K0R A;  2E8C A;  1IBK C;  4LFA C;  4DUZ C;  4DR3 C;  4AQY C;  2UUA C;  4JI6 C;  1IBM C;  4B3R C;  4LF8 C;  4JI7 C;  4DR4 C;  4OX9 C;  3IEV A;  2BJO A;  3EER A;  1XMO C;  1ML8 A;  4DR6 C;  1XNQ C;  4B3S C;  4KHP C;  4JV5 C;  1NYE A;  2XR1 A;  5A2Q D;  3T1H C;  4JI5 C;  3R9W A;  1N34 C;  3T1Y C;  4B3T C;  4LFC C;  3J80 D;  2UUC C;  4JI0 C;  4BSZ A;  4DV2 C;  4DV3 C;  4B3M C;  2E7G A;  4LF4 C;  4MH4 A;  2E8E A;  2CXC A;  4JI3 C;  4DCS A;  4LF7 C;  4LFB C;  5FLX D;  5LMU C;  3J81 D;  2CY1 A;  1XMQ C;  1LQL A;  2OPL A;  1XNR C;  2JMP A;  4JI8 C;  2VQE C;  4DCU A;  4JI2 C;  4LF5 C;  4DR5 C;  4DV4 C;  2D7V A;  1N2F A;  1N36 C;  3IEU A;  2E5L C;  2HHH C;  1WF3 A;  4DV7 C;  1WH9 A;  1HR0 C;  4JI4 C;  2UXC C;  1PA4 A;  2ONF A;  4X62 C;  1UKK A;  1ZB9 A;  1MKY A;  4DV0 C;  2ASB A;  1USP A;  3JAM D;  4DV6 C;  4DCT A;  4DR1 C;  4DV1 C;  1KKG A;  2KZF A;  1I94 C;  3R9X A;  4LF6 C;  3I07 A;  4NXM C;  4X66 C; 
#chains in the Genus database with same CATH topology
 2F4V C;  4X65 C;  1P7L A;  5BSV A;  2UU9 C;  3AY0 A;  3NI2 A;  5AE2 A;  5BUR A;  4X64 C;  4BC7 A;  1J5E C;  3UZ0 A;  1XS3 A;  3TDE A;  2MMA B;  1HNW C;  4DR2 C;  1HH2 P;  1ZB8 A;  1P4E A;  3DLP X;  5K8F A;  4PUI A;  2MCQ A;  1PU1 A;  4RM3 A;  4YY3 C;  2YX1 A;  1UWD A;  3EQ6 A;  1IBL C;  3IML A;  2WP0 C;  4MTN A;  2NCL A;  1O90 A;  1V26 A;  1O93 A;  2JNV A;  4PHT A;  4TPS B;  5BR8 C;  3GKU A;  2UUB C;  4D4I A;  3A25 A;  1IBM C;  4B3R C;  3CW8 X;  4D4G A;  1PG4 A;  2D1Q A;  4RMN A;  3E7W A;  3S82 A;  2PRO A;  3IEV A;  2ZZM A;  2P02 A;  2D27 A;  3VNR A;  4DR6 C;  2D1R A;  3CQ2 A;  1XRB A;  4B3S C;  4KHP C;  3NPD A;  1NYE A;  3VNQ A;  3R9W A;  4DV2 C;  1AMU A;  4JI3 C;  5IFI A;  3B7W A;  4LFB C;  5BSW A;  5LMU C;  1MXA A;  1LQL A;  2OPL A;  3K6R A;  4JI8 C;  2VQE C;  4DCU A;  5JRH A;  4DR5 C;  4DV4 C;  4K0B A;  3IPL A;  2BH1 X;  2QVY X;  4BCA A;  2P2J A;  1PA4 A;  4X62 C;  1PG3 A;  1MKY A;  2ASB A;  4DV6 C;  1I94 C;  4ZJZ A;  2OBV A;  1RG9 A;  4IZ6 A;  2PT7 G;  4G1I A;  1L2F A;  4FUT A;  3LNV A;  2HJG A;  1JOS A;  1O92 A;  5A1G A;  3GR1 A;  3L95 X;  4GS5 A;  4U5Y D;  1QWI A;  2PN2 A;  2ZZN A;  1FJG C;  2P2Q A;  3A26 A;  2WD9 A;  3CW9 A;  1N33 C;  3I08 A;  4LF9 C;  4GXQ A;  3FCC A;  2ZM6 C;  1T5D X;  2DYJ A;  4PRO C;  3PES A;  4DG8 A;  4PZP A;  3CQ3 A;  2E8F A;  3NYQ A;  3PRO C;  3CQ1 A;  5LCI A;  2VQF C;  4RVN A;  5LMN C;  3N54 B;  1USP B;  1GPM A;  4ODJ A;  4DCV A;  3VNS A;  5CZV A;  4AQY C;  3N2Q A;  4JI6 C;  3UEB A;  4JI7 C;  3GPC A;  2KDN A;  2BJO A;  3EER A;  5BUQ A;  4L2Z A;  3NYR A;  3O2E A;  2XR1 A;  3A9V A;  2M5O A;  3LAX A;  1N34 C;  4LFC C;  3J80 D;  4BSZ A;  4DV3 C;  4B3M C;  2E7G A;  4OYC A;  4LF4 C;  2E8E A;  3UX2 A;  4FUQ A;  2YWC A;  3UOW A;  5FLX D;  4PUG A;  3DHV A;  2DHM A;  2CY1 A;  2CU6 A;  3J81 D;  1XNR C;  2JMP A;  5A19 A;  1WCJ A;  4BC9 A;  4LF5 C;  5DV9 A;  1N2F A;  4DV7 C;  1HR0 C;  4FTF A;  4JI4 C;  2ONF A;  1ULT A;  1UKK A;  3GR0 A;  4G37 A;  3TUF A;  4DV0 C;  2D28 C;  4DCT A;  1XRA A;  1LCI A;  4R1L A;  1V60 A;  2Y4N A;  3KXW A;  4NXM C;  3C5E A;  3E7X A;  3PBK A;  4KTT A;  2MM9 A;  4KTV A;  2QL8 A;  1MD9 A;  4JI1 C;  1HNZ C;  3OTO C;  4BBY A;  4L4Q A;  5KYT A;  3UX3 A;  3TQI A;  4YHH C;  5K85 A;  3ETO A;  5IWA C;  4HPV A;  4DUY C;  4NXN C;  1FUG A;  4XX2 A;  2OPL B;  2Z51 A;  1TH5 A;  4GKK C;  3AF6 A;  2UXB C;  2VSQ A;  5AE1 A;  4DR7 C;  4I9F A;  4K0K C;  3CJE A;  2P2B A;  5A1I A;  4GXR A;  2YCB A;  5IT9 D;  4GKJ C;  2QVZ X;  1K0R A;  2E8C A;  4DUZ C;  2UUA C;  2VZE A;  4RLF A;  3SO4 A;  3R44 A;  1XMO C;  5T8T A;  2QVX X;  4JV5 C;  1M6X C;  4JI5 C;  3T1Y C;  4B3T C;  3G7S A;  5BSU A;  5KYV A;  4ZLP A;  4LF7 C;  1NY8 A;  5BSR A;  4D57 A;  2D1S A;  4WV3 A;  5BST A;  5KEI A;  2D7V A;  3DAY A;  5T8S A;  1MXB A;  3FCE A;  1N36 C;  3A4I A;  3IEU A;  2E5L C;  2UXC C;  5GTD A;  1YJ7 A;  4DR1 C;  1KKG A;  2KZF A;  3H2T A;  4JM1 A;  3LGX A;  2P2F A;  1P4E C;  4R1M A;  1EGA A;  3AF5 A;  2UXD C;  4NOZ A;  4RLQ A;  5H9U A;  1MDF A;  3L8C A;  2ATW A;  5BSM A;  1VLA A;  4LE5 A;  2EGT A;  1MDB A;  4DV5 C;  2P20 A;  1IB8 A;  1RY2 A;  1O9T A;  2M5H A;  2QW0 X;  1HNX C;  4PUH A;  5BUS A;  5E7Q A;  3LUS A;  4OXI A;  4L7I A;  3ETC A;  2Y27 A;  4RVO A;  4JYA C;  1N32 C;  1VEH A;  4DG9 A;  1IBK C;  4LFA C;  4RM2 A;  4NDN A;  1XHJ A;  4DR3 C;  3TR3 A;  5CZX A;  2DPL A;  4LF8 C;  4R0M A;  1V25 A;  4DR4 C;  4WS9 A;  5AE3 A;  4OX9 C;  4ISB A;  5ADZ A;  2AYA A;  1XRC A;  2E0G A;  1ML8 A;  2Y4O A;  4G36 A;  1XNQ C;  1QM4 A;  4IR7 A;  3T1H C;  5A2Q D;  3LNO A;  2UUC C;  4JI0 C;  3RG2 A;  2V7B A;  4MH4 A;  4I9G A;  2CXC A;  2P2M A;  4DCS A;  1XMQ C;  4D56 A;  4EAT A;  1T5H X;  1M6X A;  4JI2 C;  3A9U A;  3RV2 A;  1FLO A;  1BA3 A;  2HHH C;  1WF3 A;  1WH9 A;  2D1T A;  1ZB9 A;  2KZ0 A;  1MXC A;  1USP A;  3JAM D;  4DV1 C;  2OO4 A;  3R9X A;  2YWB A;  4LF6 C;  3I07 A;  4X66 C; 
#chains in the Genus database with same CATH homology
 2F4V C;  4X65 C;  1P7L A;  5BSV A;  2UU9 C;  3NI2 A;  5AE2 A;  5BUR A;  4X64 C;  4BC7 A;  1J5E C;  3UZ0 A;  3TDE A;  1HNW C;  4DR2 C;  1HH2 P;  1ZB8 A;  3DLP X;  5K8F A;  4RM3 A;  4YY3 C;  3EQ6 A;  1IBL C;  3IML A;  2WP0 C;  4MTN A;  1O90 A;  1V26 A;  1O93 A;  4PHT A;  4TPS B;  5BR8 C;  3GKU A;  2UUB C;  4D4I A;  1IBM C;  4B3R C;  3CW8 X;  4D4G A;  1PG4 A;  2D1Q A;  4RMN A;  3E7W A;  3S82 A;  2PRO A;  3IEV A;  2P02 A;  2D27 A;  3VNR A;  4DR6 C;  2D1R A;  1XRB A;  4B3S C;  4KHP C;  3NPD A;  1NYE A;  3VNQ A;  3R9W A;  4DV2 C;  1AMU A;  4JI3 C;  5IFI A;  3B7W A;  4LFB C;  5BSW A;  5LMU C;  1MXA A;  1LQL A;  2OPL A;  4JI8 C;  2VQE C;  4DCU A;  5JRH A;  4DR5 C;  4DV4 C;  4K0B A;  3IPL A;  2BH1 X;  2QVY X;  4BCA A;  2P2J A;  1PA4 A;  4X62 C;  1PG3 A;  1MKY A;  2ASB A;  4DV6 C;  1I94 C;  4ZJZ A;  2OBV A;  1RG9 A;  4IZ6 A;  2PT7 G;  4G1I A;  1L2F A;  4FUT A;  3LNV A;  2HJG A;  1JOS A;  1O92 A;  5A1G A;  3GR1 A;  3L95 X;  4GS5 A;  4U5Y D;  1QWI A;  2PN2 A;  1FJG C;  2P2Q A;  2WD9 A;  3CW9 A;  1N33 C;  3I08 A;  4LF9 C;  4GXQ A;  3FCC A;  2ZM6 C;  1T5D X;  2DYJ A;  4PRO C;  3PES A;  4DG8 A;  4PZP A;  2E8F A;  3NYQ A;  3PRO C;  2VQF C;  4RVN A;  5LMN C;  3N54 B;  1USP B;  1GPM A;  4ODJ A;  4DCV A;  3VNS A;  5CZV A;  4AQY C;  3N2Q A;  4JI6 C;  4JI7 C;  3GPC A;  2BJO A;  3EER A;  5BUQ A;  4L2Z A;  3NYR A;  2XR1 A;  3A9V A;  3LAX A;  1N34 C;  4LFC C;  3J80 D;  4BSZ A;  4DV3 C;  4B3M C;  2E7G A;  4OYC A;  4LF4 C;  2E8E A;  4FUQ A;  2YWC A;  3UOW A;  5FLX D;  3DHV A;  2CY1 A;  3J81 D;  1XNR C;  2JMP A;  5A19 A;  4BC9 A;  4LF5 C;  5DV9 A;  1N2F A;  4DV7 C;  1HR0 C;  4FTF A;  4JI4 C;  2ONF A;  1ULT A;  1UKK A;  3GR0 A;  4G37 A;  3TUF A;  4DV0 C;  2D28 C;  4DCT A;  1XRA A;  1LCI A;  4R1L A;  2Y4N A;  3KXW A;  4NXM C;  3C5E A;  3E7X A;  3PBK A;  4KTT A;  4KTV A;  2QL8 A;  1MD9 A;  4JI1 C;  1HNZ C;  3OTO C;  4BBY A;  4L4Q A;  5KYT A;  3TQI A;  4YHH C;  5K85 A;  3ETO A;  5IWA C;  4HPV A;  4DUY C;  4NXN C;  1FUG A;  4XX2 A;  2OPL B;  4GKK C;  3AF6 A;  2UXB C;  2VSQ A;  5AE1 A;  4DR7 C;  4I9F A;  4K0K C;  3CJE A;  2P2B A;  5A1I A;  4GXR A;  2YCB A;  5IT9 D;  4GKJ C;  2QVZ X;  1K0R A;  2E8C A;  4DUZ C;  2UUA C;  2VZE A;  4RLF A;  3SO4 A;  3R44 A;  1XMO C;  5T8T A;  2QVX X;  4JV5 C;  4JI5 C;  3T1Y C;  4B3T C;  3G7S A;  5BSU A;  5KYV A;  4ZLP A;  4LF7 C;  5BSR A;  4D57 A;  2D1S A;  4WV3 A;  5BST A;  5KEI A;  2D7V A;  3DAY A;  5T8S A;  1MXB A;  3FCE A;  1N36 C;  3A4I A;  3IEU A;  2E5L C;  2UXC C;  5GTD A;  1YJ7 A;  4DR1 C;  1KKG A;  2KZF A;  3H2T A;  4JM1 A;  3LGX A;  2P2F A;  4R1M A;  1EGA A;  3AF5 A;  2UXD C;  4NOZ A;  4RLQ A;  5H9U A;  1MDF A;  3L8C A;  2ATW A;  5BSM A;  1VLA A;  4LE5 A;  2EGT A;  1MDB A;  4DV5 C;  2P20 A;  1RY2 A;  1O9T A;  2QW0 X;  1HNX C;  5BUS A;  5E7Q A;  3LUS A;  4OXI A;  4L7I A;  3ETC A;  2Y27 A;  4RVO A;  4JYA C;  1N32 C;  4DG9 A;  1IBK C;  4LFA C;  4RM2 A;  4NDN A;  4DR3 C;  5CZX A;  2DPL A;  4LF8 C;  4R0M A;  1V25 A;  4DR4 C;  4WS9 A;  5AE3 A;  4OX9 C;  4ISB A;  5ADZ A;  2AYA A;  1XRC A;  2E0G A;  1ML8 A;  2Y4O A;  4G36 A;  1XNQ C;  1QM4 A;  4IR7 A;  3T1H C;  5A2Q D;  2UUC C;  4JI0 C;  3RG2 A;  2V7B A;  4MH4 A;  4I9G A;  2CXC A;  2P2M A;  4DCS A;  1XMQ C;  4D56 A;  4EAT A;  1T5H X;  4JI2 C;  3A9U A;  3RV2 A;  1BA3 A;  2HHH C;  1WF3 A;  1WH9 A;  2D1T A;  1ZB9 A;  1MXC A;  1USP A;  3JAM D;  4DV1 C;  2OO4 A;  3R9X A;  2YWB A;  4LF6 C;  3I07 A;  4X66 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...