2CY1A

Crystal structure of ape1850
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVKRARLVLSKLFGVEKVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of the archaeal transcription termination factor NusA: a significant decrease in twinning under microgravity conditions
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transcription
molecule keywords NusA protein homolog
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A02
4JI0C 1JOSA 1N34C 4DCUA 1K0RA 4JI7C 1UKKA 4NOZA 4JYAC 2OPLA 1N36C 3R9WA 4JI5C 1XMOC 1HH2P 2ASBA 2VQFC 4X65C 4K0KC 1N2FA 1USPB 3IEUA 1IBLC 2BJOA 3T1HC 3T1YC 1ZB8A 2UXBC 1MKYA 3AF5A 1XNQC 4B3RC 2QL8A 3AF6A 4OX9C 4DV3C 4GKKC 4DUZC 4DV0C 5FLXD 4DV6C 4LF6C 2ZM6C 1HNZC 4JI1C 4B3SC 1LQLA 3CJEA 4B3TC 2UXCC 1IBMC 1USPA 1HNXC 5A2QD 1VLAA 4LF7C 1I94C 2E5LC 3I07A 4X62C 1NYEA 2E8CA 5IWAC 2CXCA 3J81D 4LF8C 5LMNC 2UUBC 1N33C 4MTNA 2VQEC 2UUAC 3JAMD 5IT9D 2OPLB 2PT7G 4X66C 1IBKC 4DR7C 5LMUC 3J80D 4JI4C 1FJGC 1XNRC 4LFAC 4LFCC 3R9XA 4DR1C 1WH9A 1XMQC 2UXDC 3EERA 4LF5C 4YY3C 1J5EC 2D7VA 4DV5C 2HJGA 2UU9C 2UUCC 1WF3A 4DCVA 5BR8C 4DV4C 4DR2C 1QWIA 2EGTA 3GKUA 2E7GA 4GKJC 2CY1A 2E8EA 4XX2A 1ML8A 2ONFA 4LF4C 4DCSA 1PA4A 4LFBC 4JV5C 1L2FA 4JI3C 4DV7C 4KHPC 1HR0C 2F4VC 4DV2C 4DUYC 4DV1C 3IEVA 2KZFA 1HNWC 4JI6C 2YCBA 4X64C 4BSZA 4DCTA 1N32C 4DR3C 3OTOC 4JI8C 2E8FA 2DYJA 4DR6C 4MH4A 4LF9C 2XR1A 2ATWA 4YHHC 2JMPA 4B3MC 1ZB9A 4AQYC 4NXMC 2HHHC 4DR4C 1KKGA 4JI2C 3LUSA 4DR5C 4NXNC 2PN2A 1EGAA
chains in the Genus database with same CATH superfamily
3UOWA 3UZ0A 3NYQA 4JI7C 1UKKA 3RG2A 3K6RA 3FCEA 4ODJA 1PG3A 4RVOA 1PG4A 2QW0X 4L7IA 2VQFC 2P2BA 4GXRA 3T1YC 2AYAA 4JM1A 4BCAA 2UXBC 4WV3A 3VNQA 4OX9C 4GKKC 1MDBA 2ZZMA 4PUIA 1MDFA 2ZM6C 1HNZC 1WCJA 1IBMC 1USPA 1HNXC 4FUQA 5KEIA 1O9TA 2P2JA 3GPCA 5CZXA 5A19A 3L95X 2CXCA 2WD9A 4LF8C 2UUAC 2M5HA 1IBKC 4DR7C 3J80D 4L4QA 1M6XA 2KDNA 3CW9A 3R9XA 4DR1C 1WH9A 4RVNA 3PESA 4YY3C 4LF5C 4RM3A 2D1RA 2D7VA 2UU9C 3A9UA 1WF3A 4D56A 2YWBA 1QWIA 2E8EA 5BSVA 2ONFA 3UX2A 2Y4OA 3G7SA 1L2FA 4DV7C 1GPMA 4DV2C 4DUYC 3RV2A 1MXBA 3A9VA 4JI6C 3OTOC 1RY2A 1T5DX 1XRBA 1MD9A 1MXCA 4LF9C 4YHHC 2Y4NA 4B3MC 1V26A 1ZB9A 4AQYC 4DR4C 1KKGA 4NXNC 2PN2A 5BSWA 4NDNA 4LF4C 1JOSA 1NY8A 2MM9A 1O92A 3GR0A 1XMOC 5IFIA 1HH2P 5K85A 3N2QA 4X65C 2P2MA 1N2FA 2D27A 3TR3A 4GS5A 2MCQA 4R1MA 3AF5A 1XNQC 1BA3A 4TPSB 4DV3C 5AE2A 3B7WA 4JI1C 3CQ3A 4B3TC 1AMUA 2Z51A 2E5LC 3N54B 2P02A 4X62C 3CQ2A 2E8CA 4U5YD 2CU6A 2MMAB 3C5EA 2UUBC 1V60A 1N33C 4G1IA 1FLOA 4IR7A 4ISBA 4X66C 3H2TA 4JI4C 3LAXA 4LFAC 1YJ7A 1XMQC 3EERA 4D4GA 1J5EC 4DV5C 3I08A 2UUCC 4DCVA 5CZVA 4FUTA 5BR8C 2E0GA 3TUFA 2PROA 2E7GA 4I9FA 1ML8A 4RM2A 3TDEA 4LE5A 5T8TA 5BSTA 4KHPC 3S82A 2VZEA 1O90A 1FUGA 5A1GA 2KZFA 3DHVA 1HNWC 4L2ZA 4X64C 3A25A 4DCTA 1RG9A 5AE1A 4JI8C 3PROC 5JRHA 2QVYX 2P2QA 1VEHA 3PBKA 2ZZNA 3LUSA 3CQ1A 1TH5A 4JI0C 4KTTA 3R44A 1N34C 1K0RA 5AE3A 3LGXA 1N36C 4D57A 4JI5C 2D1TA 3L8CA 1LCIA 2BJOA 1MKYA 1XRAA 4B3RC 3AF6A 3GR1A 3E7XA 3ETCA 5ADZA 4DUZC 4DV0C 1UWDA 3FCCA 4ZLPA 5FLXD 5DV9A 2VSQA 1P4EC 4B3SC 1LQLA 2YX1A 5A2QD 4HPVA 4IZ6A 3I07A 2D1SA 4DG8A 2QVXX 5LMNC 3VNRA 1M6XC 3AY0A 4R1LA 2VQEC 3JAMD 5IT9D 4RMNA 2DHMA 2PT7G 1PU1A 1ULTA 5LMUC 3ETOA 1XHJA 3DAYA 3UX3A 2P20A 4LFCC 4BC7A 3UEBA 4G36A 4DR2C 4DV4C 4RLFA 4PROC 4GKJC 1MXAA 5LCIA 2KZ0A 3E7WA 5T8SA 4JV5C 4JI3C 2NCLA 4R0MA 3A4IA 4DV1C 2YCBA 4BSZA 3IPLA 5BUSA 5BSUA 5KYTA 4DR3C 1N32C 4PUGA 2D28C 4DR6C 4MH4A 2ATWA 4RLQA 2JMPA 4G37A 4OXIA 4NXMC 1XS3A 4PUHA 3LNVA 4DR5C 3VNSA 5A1IA 1EGAA 4BC9A 5BUQA 4DCUA 4NOZA 4JYAC 2OPLA 3R9WA 2ASBA 4K0KC 1USPB 3IEUA 1IB8A 1IBLC 3T1HC 2Y27A 5E7QA 1ZB8A 4D4IA 2QL8A 3IMLA 4WS9A 5GTDA 4DV6C 5K8FA 4LF6C 5H9UA 3CJEA 3NPDA 2UXCC 3O2EA 5KYVA 1VLAA 4LF7C 1I94C 1XRCA 4DG9A 1NYEA 2QVZX 3LNOA 4ZJZA 5IWAC 3J81D 1P4EA 1QM4A 3A26A 2WP0C 4MTNA 4OYCA 3NYRA 2OPLB 3SO4A 3NI2A 1T5HX 1FJGC 1XNRC 4EATA 5BSMA 3DLPX 2UXDC 2JNVA 2HJGA 1O93A 4GXQA 2EGTA 3GKUA 2CY1A 4XX2A 4I9GA 2YWCA 2OBVA 4DCSA 4BBYA 1PA4A 4LFBC 2P2FA 2OO4A 1HR0C 2F4VC 2V7BA 3CW8X 3IEVA 2BH1X 4FTFA 2DPLA 2M5OA 5BURA 1P7LA 1V25A 4PZPA 5BSRA 3KXWA 2E8FA 2DYJA 4PHTA 2XR1A 3EQ6A 2D1QA 2HHHC 4JI2C 4KTVA 3TQIA 4K0BA
chains in the Genus database with same CATH topology
3UOWA 3UZ0A 3NYQA 4JI7C 1UKKA 3RG2A 3FCEA 4ODJA 1PG3A 4RVOA 1PG4A 2QW0X 4L7IA 2VQFC 2P2BA 4GXRA 3T1YC 2AYAA 4JM1A 4BCAA 2UXBC 4WV3A 3VNQA 4OX9C 4GKKC 1MDBA 1MDFA 2ZM6C 1HNZC 1IBMC 1USPA 1HNXC 4FUQA 5KEIA 1O9TA 2P2JA 3GPCA 5CZXA 5A19A 3L95X 2CXCA 2WD9A 4LF8C 2UUAC 1IBKC 4DR7C 3J80D 4L4QA 3CW9A 3R9XA 4DR1C 1WH9A 4RVNA 3PESA 4YY3C 4LF5C 4RM3A 2D1RA 2D7VA 2UU9C 3A9UA 1WF3A 4D56A 2YWBA 1QWIA 2E8EA 5BSVA 2ONFA 2Y4OA 3G7SA 1L2FA 4DV7C 1GPMA 4DV2C 4DUYC 3RV2A 1MXBA 3A9VA 4JI6C 3OTOC 1RY2A 1T5DX 1XRBA 1MD9A 1MXCA 4LF9C 4YHHC 2Y4NA 4B3MC 1V26A 1ZB9A 4AQYC 4DR4C 1KKGA 4NXNC 2PN2A 5BSWA 4NDNA 4LF4C 1JOSA 1O92A 3GR0A 1XMOC 5IFIA 1HH2P 5K85A 3N2QA 4X65C 2P2MA 1N2FA 2D27A 4GS5A 4R1MA 3AF5A 1XNQC 1BA3A 4TPSB 4DV3C 5AE2A 3B7WA 4JI1C 4B3TC 1AMUA 2E5LC 3N54B 2P02A 4X62C 2E8CA 4U5YD 3C5EA 2UUBC 1N33C 4G1IA 4IR7A 4ISBA 4X66C 3H2TA 4JI4C 3LAXA 4LFAC 1YJ7A 1XMQC 3EERA 4D4GA 1J5EC 4DV5C 2UUCC 3I08A 4DCVA 5CZVA 4FUTA 5BR8C 2E0GA 3TUFA 2PROA 2E7GA 4I9FA 1ML8A 4RM2A 3TDEA 4LE5A 5T8TA 5BSTA 4KHPC 3S82A 2VZEA 1O90A 1FUGA 5A1GA 2KZFA 3DHVA 1HNWC 4L2ZA 4X64C 4DCTA 1RG9A 5AE1A 4JI8C 3PROC 5JRHA 2QVYX 2P2QA 3PBKA 3LUSA 4JI0C 4KTTA 3R44A 1N34C 1K0RA 5AE3A 3LGXA 1N36C 4D57A 4JI5C 2D1TA 3L8CA 1LCIA 2BJOA 1MKYA 1XRAA 4B3RC 3AF6A 3GR1A 3E7XA 3ETCA 5ADZA 4DUZC 4DV0C 3FCCA 4ZLPA 5FLXD 5DV9A 2VSQA 4B3SC 1LQLA 5A2QD 4HPVA 4IZ6A 3I07A 2D1SA 4DG8A 2QVXX 5LMNC 3VNRA 4R1LA 2VQEC 3JAMD 5IT9D 4RMNA 2PT7G 1ULTA 5LMUC 3ETOA 3DAYA 2P20A 4LFCC 4BC7A 4G36A 4DR2C 4DV4C 4RLFA 4PROC 4GKJC 1MXAA 3E7WA 5T8SA 4JV5C 4JI3C 4R0MA 3A4IA 4DV1C 2YCBA 4BSZA 3IPLA 5BUSA 5BSUA 5KYTA 4DR3C 1N32C 2D28C 4DR6C 4MH4A 2ATWA 4RLQA 2JMPA 4G37A 4OXIA 4NXMC 3LNVA 4DR5C 3VNSA 5A1IA 1EGAA 4BC9A 5BUQA 4DCUA 4NOZA 4JYAC 2OPLA 3R9WA 2ASBA 4K0KC 1USPB 3IEUA 1IBLC 3T1HC 2Y27A 5E7QA 1ZB8A 4D4IA 2QL8A 3IMLA 4WS9A 5GTDA 4DV6C 5K8FA 4LF6C 5H9UA 3CJEA 3NPDA 2UXCC 5KYVA 1VLAA 4LF7C 1I94C 1XRCA 4DG9A 1NYEA 2QVZX 4ZJZA 5IWAC 3J81D 1QM4A 2WP0C 4MTNA 4OYCA 3NYRA 2OPLB 3SO4A 3NI2A 1T5HX 1FJGC 1XNRC 4EATA 5BSMA 3DLPX 2UXDC 2HJGA 1O93A 4GXQA 2EGTA 3GKUA 2CY1A 4XX2A 4I9GA 2YWCA 2OBVA 4DCSA 4BBYA 1PA4A 4LFBC 2P2FA 2OO4A 1HR0C 2F4VC 2V7BA 3CW8X 3IEVA 2BH1X 4FTFA 2DPLA 5BURA 1P7LA 1V25A 4PZPA 5BSRA 3KXWA 2E8FA 2DYJA 4PHTA 2XR1A 3EQ6A 2D1QA 2HHHC 4JI2C 4KTVA 3TQIA 4K0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 C;  1JOS A;  1N34 C;  4DCU A;  1K0R A;  4JI7 C;  1UKK A;  4NOZ A;  4JYA C;  2OPL A;  1N36 C;  3R9W A;  4JI5 C;  1XMO C;  1HH2 P;  2ASB A;  2VQF C;  4X65 C;  4K0K C;  1N2F A;  1USP B;  3IEU A;  1IBL C;  2BJO A;  3T1H C;  3T1Y C;  1ZB8 A;  2UXB C;  1MKY A;  3AF5 A;  1XNQ C;  4B3R C;  2QL8 A;  3AF6 A;  4OX9 C;  4DV3 C;  4GKK C;  4DUZ C;  4DV0 C;  5FLX D;  4DV6 C;  4LF6 C;  2ZM6 C;  1HNZ C;  4JI1 C;  4B3S C;  1LQL A;  3CJE A;  4B3T C;  2UXC C;  1IBM C;  1USP A;  1HNX C;  5A2Q D;  1VLA A;  4LF7 C;  1I94 C;  2E5L C;  3I07 A;  4X62 C;  1NYE A;  2E8C A;  5IWA C;  2CXC A;  3J81 D;  4LF8 C;  5LMN C;  2UUB C;  1N33 C;  4MTN A;  2VQE C;  2UUA C;  3JAM D;  5IT9 D;  2OPL B;  2PT7 G;  4X66 C;  1IBK C;  4DR7 C;  5LMU C;  3J80 D;  4JI4 C;  1FJG C;  1XNR C;  4LFA C;  4LFC C;  3R9X A;  4DR1 C;  1WH9 A;  1XMQ C;  2UXD C;  3EER A;  4LF5 C;  4YY3 C;  1J5E C;  2D7V A;  4DV5 C;  2HJG A;  2UU9 C;  2UUC C;  1WF3 A;  4DCV A;  5BR8 C;  4DV4 C;  4DR2 C;  1QWI A;  2EGT A;  3GKU A;  2E7G A;  4GKJ C;  2CY1 A;  2E8E A;  4XX2 A;  1ML8 A;  2ONF A;  4LF4 C;  4DCS A;  1PA4 A;  4LFB C;  4JV5 C;  1L2F A;  4JI3 C;  4DV7 C;  4KHP C;  1HR0 C;  2F4V C;  4DV2 C;  4DUY C;  4DV1 C;  3IEV A;  2KZF A;  1HNW C;  4JI6 C;  2YCB A;  4X64 C;  4BSZ A;  4DCT A;  1N32 C;  4DR3 C;  3OTO C;  4JI8 C;  2E8F A;  2DYJ A;  4DR6 C;  4MH4 A;  4LF9 C;  2XR1 A;  2ATW A;  4YHH C;  2JMP A;  4B3M C;  1ZB9 A;  4AQY C;  4NXM C;  2HHH C;  4DR4 C;  1KKG A;  4JI2 C;  3LUS A;  4DR5 C;  4NXN C;  2PN2 A;  1EGA A; 
#chains in the Genus database with same CATH topology
 3UOW A;  3UZ0 A;  3NYQ A;  4JI7 C;  1UKK A;  3RG2 A;  3K6R A;  3FCE A;  4ODJ A;  1PG3 A;  4RVO A;  1PG4 A;  2QW0 X;  4L7I A;  2VQF C;  2P2B A;  4GXR A;  3T1Y C;  2AYA A;  4JM1 A;  4BCA A;  2UXB C;  4WV3 A;  3VNQ A;  4OX9 C;  4GKK C;  1MDB A;  2ZZM A;  4PUI A;  1MDF A;  2ZM6 C;  1HNZ C;  1WCJ A;  1IBM C;  1USP A;  1HNX C;  4FUQ A;  5KEI A;  1O9T A;  2P2J A;  3GPC A;  5CZX A;  5A19 A;  3L95 X;  2CXC A;  2WD9 A;  4LF8 C;  2UUA C;  2M5H A;  1IBK C;  4DR7 C;  3J80 D;  4L4Q A;  1M6X A;  2KDN A;  3CW9 A;  3R9X A;  4DR1 C;  1WH9 A;  4RVN A;  3PES A;  4YY3 C;  4LF5 C;  4RM3 A;  2D1R A;  2D7V A;  2UU9 C;  3A9U A;  1WF3 A;  4D56 A;  2YWB A;  1QWI A;  2E8E A;  5BSV A;  2ONF A;  3UX2 A;  2Y4O A;  3G7S A;  1L2F A;  4DV7 C;  1GPM A;  4DV2 C;  4DUY C;  3RV2 A;  1MXB A;  3A9V A;  4JI6 C;  3OTO C;  1RY2 A;  1T5D X;  1XRB A;  1MD9 A;  1MXC A;  4LF9 C;  4YHH C;  2Y4N A;  4B3M C;  1V26 A;  1ZB9 A;  4AQY C;  4DR4 C;  1KKG A;  4NXN C;  2PN2 A;  5BSW A;  4NDN A;  4LF4 C;  1JOS A;  1NY8 A;  2MM9 A;  1O92 A;  3GR0 A;  1XMO C;  5IFI A;  1HH2 P;  5K85 A;  3N2Q A;  4X65 C;  2P2M A;  1N2F A;  2D27 A;  3TR3 A;  4GS5 A;  2MCQ A;  4R1M A;  3AF5 A;  1XNQ C;  1BA3 A;  4TPS B;  4DV3 C;  5AE2 A;  3B7W A;  4JI1 C;  3CQ3 A;  4B3T C;  1AMU A;  2Z51 A;  2E5L C;  3N54 B;  2P02 A;  4X62 C;  3CQ2 A;  2E8C A;  4U5Y D;  2CU6 A;  2MMA B;  3C5E A;  2UUB C;  1V60 A;  1N33 C;  4G1I A;  1FLO A;  4IR7 A;  4ISB A;  4X66 C;  3H2T A;  4JI4 C;  3LAX A;  4LFA C;  1YJ7 A;  1XMQ C;  3EER A;  4D4G A;  1J5E C;  4DV5 C;  3I08 A;  2UUC C;  4DCV A;  5CZV A;  4FUT A;  5BR8 C;  2E0G A;  3TUF A;  2PRO A;  2E7G A;  4I9F A;  1ML8 A;  4RM2 A;  3TDE A;  4LE5 A;  5T8T A;  5BST A;  4KHP C;  3S82 A;  2VZE A;  1O90 A;  1FUG A;  5A1G A;  2KZF A;  3DHV A;  1HNW C;  4L2Z A;  4X64 C;  3A25 A;  4DCT A;  1RG9 A;  5AE1 A;  4JI8 C;  3PRO C;  5JRH A;  2QVY X;  2P2Q A;  1VEH A;  3PBK A;  2ZZN A;  3LUS A;  3CQ1 A;  1TH5 A;  4JI0 C;  4KTT A;  3R44 A;  1N34 C;  1K0R A;  5AE3 A;  3LGX A;  1N36 C;  4D57 A;  4JI5 C;  2D1T A;  3L8C A;  1LCI A;  2BJO A;  1MKY A;  1XRA A;  4B3R C;  3AF6 A;  3GR1 A;  3E7X A;  3ETC A;  5ADZ A;  4DUZ C;  4DV0 C;  1UWD A;  3FCC A;  4ZLP A;  5FLX D;  5DV9 A;  2VSQ A;  1P4E C;  4B3S C;  1LQL A;  2YX1 A;  5A2Q D;  4HPV A;  4IZ6 A;  3I07 A;  2D1S A;  4DG8 A;  2QVX X;  5LMN C;  3VNR A;  1M6X C;  3AY0 A;  4R1L A;  2VQE C;  3JAM D;  5IT9 D;  4RMN A;  2DHM A;  2PT7 G;  1PU1 A;  1ULT A;  5LMU C;  3ETO A;  1XHJ A;  3DAY A;  3UX3 A;  2P20 A;  4LFC C;  4BC7 A;  3UEB A;  4G36 A;  4DR2 C;  4DV4 C;  4RLF A;  4PRO C;  4GKJ C;  1MXA A;  5LCI A;  2KZ0 A;  3E7W A;  5T8S A;  4JV5 C;  4JI3 C;  2NCL A;  4R0M A;  3A4I A;  4DV1 C;  2YCB A;  4BSZ A;  3IPL A;  5BUS A;  5BSU A;  5KYT A;  4DR3 C;  1N32 C;  4PUG A;  2D28 C;  4DR6 C;  4MH4 A;  2ATW A;  4RLQ A;  2JMP A;  4G37 A;  4OXI A;  4NXM C;  1XS3 A;  4PUH A;  3LNV A;  4DR5 C;  3VNS A;  5A1I A;  1EGA A;  4BC9 A;  5BUQ A;  4DCU A;  4NOZ A;  4JYA C;  2OPL A;  3R9W A;  2ASB A;  4K0K C;  1USP B;  3IEU A;  1IB8 A;  1IBL C;  3T1H C;  2Y27 A;  5E7Q A;  1ZB8 A;  4D4I A;  2QL8 A;  3IML A;  4WS9 A;  5GTD A;  4DV6 C;  5K8F A;  4LF6 C;  5H9U A;  3CJE A;  3NPD A;  2UXC C;  3O2E A;  5KYV A;  1VLA A;  4LF7 C;  1I94 C;  1XRC A;  4DG9 A;  1NYE A;  2QVZ X;  3LNO A;  4ZJZ A;  5IWA C;  3J81 D;  1P4E A;  1QM4 A;  3A26 A;  2WP0 C;  4MTN A;  4OYC A;  3NYR A;  2OPL B;  3SO4 A;  3NI2 A;  1T5H X;  1FJG C;  1XNR C;  4EAT A;  5BSM A;  3DLP X;  2UXD C;  2JNV A;  2HJG A;  1O93 A;  4GXQ A;  2EGT A;  3GKU A;  2CY1 A;  4XX2 A;  4I9G A;  2YWC A;  2OBV A;  4DCS A;  4BBY A;  1PA4 A;  4LFB C;  2P2F A;  2OO4 A;  1HR0 C;  2F4V C;  2V7B A;  3CW8 X;  3IEV A;  2BH1 X;  4FTF A;  2DPL A;  2M5O A;  5BUR A;  1P7L A;  1V25 A;  4PZP A;  5BSR A;  3KXW A;  2E8F A;  2DYJ A;  4PHT A;  2XR1 A;  3EQ6 A;  2D1Q A;  2HHH C;  4JI2 C;  4KTV A;  3TQI A;  4K0B A; 
#chains in the Genus database with same CATH homology
 3UOW A;  3UZ0 A;  3NYQ A;  4JI7 C;  1UKK A;  3RG2 A;  3FCE A;  4ODJ A;  1PG3 A;  4RVO A;  1PG4 A;  2QW0 X;  4L7I A;  2VQF C;  2P2B A;  4GXR A;  3T1Y C;  2AYA A;  4JM1 A;  4BCA A;  2UXB C;  4WV3 A;  3VNQ A;  4OX9 C;  4GKK C;  1MDB A;  1MDF A;  2ZM6 C;  1HNZ C;  1IBM C;  1USP A;  1HNX C;  4FUQ A;  5KEI A;  1O9T A;  2P2J A;  3GPC A;  5CZX A;  5A19 A;  3L95 X;  2CXC A;  2WD9 A;  4LF8 C;  2UUA C;  1IBK C;  4DR7 C;  3J80 D;  4L4Q A;  3CW9 A;  3R9X A;  4DR1 C;  1WH9 A;  4RVN A;  3PES A;  4YY3 C;  4LF5 C;  4RM3 A;  2D1R A;  2D7V A;  2UU9 C;  3A9U A;  1WF3 A;  4D56 A;  2YWB A;  1QWI A;  2E8E A;  5BSV A;  2ONF A;  2Y4O A;  3G7S A;  1L2F A;  4DV7 C;  1GPM A;  4DV2 C;  4DUY C;  3RV2 A;  1MXB A;  3A9V A;  4JI6 C;  3OTO C;  1RY2 A;  1T5D X;  1XRB A;  1MD9 A;  1MXC A;  4LF9 C;  4YHH C;  2Y4N A;  4B3M C;  1V26 A;  1ZB9 A;  4AQY C;  4DR4 C;  1KKG A;  4NXN C;  2PN2 A;  5BSW A;  4NDN A;  4LF4 C;  1JOS A;  1O92 A;  3GR0 A;  1XMO C;  5IFI A;  1HH2 P;  5K85 A;  3N2Q A;  4X65 C;  2P2M A;  1N2F A;  2D27 A;  4GS5 A;  4R1M A;  3AF5 A;  1XNQ C;  1BA3 A;  4TPS B;  4DV3 C;  5AE2 A;  3B7W A;  4JI1 C;  4B3T C;  1AMU A;  2E5L C;  3N54 B;  2P02 A;  4X62 C;  2E8C A;  4U5Y D;  3C5E A;  2UUB C;  1N33 C;  4G1I A;  4IR7 A;  4ISB A;  4X66 C;  3H2T A;  4JI4 C;  3LAX A;  4LFA C;  1YJ7 A;  1XMQ C;  3EER A;  4D4G A;  1J5E C;  4DV5 C;  2UUC C;  3I08 A;  4DCV A;  5CZV A;  4FUT A;  5BR8 C;  2E0G A;  3TUF A;  2PRO A;  2E7G A;  4I9F A;  1ML8 A;  4RM2 A;  3TDE A;  4LE5 A;  5T8T A;  5BST A;  4KHP C;  3S82 A;  2VZE A;  1O90 A;  1FUG A;  5A1G A;  2KZF A;  3DHV A;  1HNW C;  4L2Z A;  4X64 C;  4DCT A;  1RG9 A;  5AE1 A;  4JI8 C;  3PRO C;  5JRH A;  2QVY X;  2P2Q A;  3PBK A;  3LUS A;  4JI0 C;  4KTT A;  3R44 A;  1N34 C;  1K0R A;  5AE3 A;  3LGX A;  1N36 C;  4D57 A;  4JI5 C;  2D1T A;  3L8C A;  1LCI A;  2BJO A;  1MKY A;  1XRA A;  4B3R C;  3AF6 A;  3GR1 A;  3E7X A;  3ETC A;  5ADZ A;  4DUZ C;  4DV0 C;  3FCC A;  4ZLP A;  5FLX D;  5DV9 A;  2VSQ A;  4B3S C;  1LQL A;  5A2Q D;  4HPV A;  4IZ6 A;  3I07 A;  2D1S A;  4DG8 A;  2QVX X;  5LMN C;  3VNR A;  4R1L A;  2VQE C;  3JAM D;  5IT9 D;  4RMN A;  2PT7 G;  1ULT A;  5LMU C;  3ETO A;  3DAY A;  2P20 A;  4LFC C;  4BC7 A;  4G36 A;  4DR2 C;  4DV4 C;  4RLF A;  4PRO C;  4GKJ C;  1MXA A;  3E7W A;  5T8S A;  4JV5 C;  4JI3 C;  4R0M A;  3A4I A;  4DV1 C;  2YCB A;  4BSZ A;  3IPL A;  5BUS A;  5BSU A;  5KYT A;  4DR3 C;  1N32 C;  2D28 C;  4DR6 C;  4MH4 A;  2ATW A;  4RLQ A;  2JMP A;  4G37 A;  4OXI A;  4NXM C;  3LNV A;  4DR5 C;  3VNS A;  5A1I A;  1EGA A;  4BC9 A;  5BUQ A;  4DCU A;  4NOZ A;  4JYA C;  2OPL A;  3R9W A;  2ASB A;  4K0K C;  1USP B;  3IEU A;  1IBL C;  3T1H C;  2Y27 A;  5E7Q A;  1ZB8 A;  4D4I A;  2QL8 A;  3IML A;  4WS9 A;  5GTD A;  4DV6 C;  5K8F A;  4LF6 C;  5H9U A;  3CJE A;  3NPD A;  2UXC C;  5KYV A;  1VLA A;  4LF7 C;  1I94 C;  1XRC A;  4DG9 A;  1NYE A;  2QVZ X;  4ZJZ A;  5IWA C;  3J81 D;  1QM4 A;  2WP0 C;  4MTN A;  4OYC A;  3NYR A;  2OPL B;  3SO4 A;  3NI2 A;  1T5H X;  1FJG C;  1XNR C;  4EAT A;  5BSM A;  3DLP X;  2UXD C;  2HJG A;  1O93 A;  4GXQ A;  2EGT A;  3GKU A;  2CY1 A;  4XX2 A;  4I9G A;  2YWC A;  2OBV A;  4DCS A;  4BBY A;  1PA4 A;  4LFB C;  2P2F A;  2OO4 A;  1HR0 C;  2F4V C;  2V7B A;  3CW8 X;  3IEV A;  2BH1 X;  4FTF A;  2DPL A;  5BUR A;  1P7L A;  1V25 A;  4PZP A;  5BSR A;  3KXW A;  2E8F A;  2DYJ A;  4PHT A;  2XR1 A;  3EQ6 A;  2D1Q A;  2HHH C;  4JI2 C;  4KTV A;  3TQI A;  4K0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...