2CY1A

Crystal structure of ape1850
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVKRARLVLSKLFGVEKVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NusA protein homolog
publication title Crystallization of the archaeal transcription termination factor NusA: a significant decrease in twinning under microgravity conditions
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transcription
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A02
2ASBA 1IBKC 4JYAC 2E5LC 4JI5C 1K0RA 1WF3A 3EERA 2UUCC 2ATWA 2D7VA 2E8CA 4K0KC 4JI4C 2UU9C 1N36C 4GKJC 1FJGC 2HJGA 4NXMC 1ZB9A 4LF9C 4LFAC 3CJEA 4LFCC 2CY1A 2ONFA 2XR1A 4DR1C 3JAMD 4DR3C 2ZM6C 3LUSA 1UKKA 4DV4C 4JI1C 2UXDC 4MTNA 4NXNC 4GKKC 1XNRC 4JI6C 4XX2A 4OX9C 4X65C 4KHPC 4DV7C 4DCUA 1USPA 4DV6C 1J5EC 1HNXC 2KZFA 4DV0C 2BJOA 4DR4C 1N2FA 4LF4C 2EGTA 4DCTA 5A2QD 1L2FA 2PN2A 4X64C 1WH9A 4MH4A 2UUBC 1QWIA 1XMOC 4DCVA 4DV2C 2UUAC 1VLAA 1HH2P 4LF6C 4DUZC 3AF5A 3OTOC 4JI0C 1XMQC 1HNWC 4NOZA 4DCSA 1USPB 4LF7C 4B3SC 1IBMC 1N32C 4DR7C 1NYEA 1PA4A 3R9XA 2VQEC 4DR2C 2UXCC 2OPLA 2E8EA 4JI3C 4DV1C 2HHHC 4LF8C 3J80D 4JI2C 4DR6C 3I07A 5BR8C 4B3MC 1I94C 5LMUC 4DV3C 4YY3C 2QL8A 1EGAA 1MKYA 1ML8A 1N34C 5IWAC 1HNZC 4B3TC 5LMNC 2VQFC 2UXBC 2YCBA 2F4VC 1N33C 3T1HC 3IEUA 4DR5C 3IEVA 3R9WA 4JI7C 2PT7G 4X62C 3T1YC 1HR0C 1KKGA 1XNQC 3AF6A 5FLXD 4BSZA 4DUYC 4JI8C 4JV5C 4X66C 4DV5C 2E7GA 1ZB8A 2OPLB 2CXCA 4AQYC 2DYJA 2E8FA 5IT9D 4YHHC 1LQLA 4LFBC 3GKUA 1IBLC 1JOSA 4LF5C 3J81D 4B3RC 2JMPA
chains in the Genus database with same CATH superfamily
1IBKC 2E5LC 2ATWA 2UUCC 2D7VA 5GTDA 1XHJA 1ULTA 1T5HX 5H9UA 3L95X 5KYTA 3TUFA 3LGXA 1AMUA 4LFCC 2P2JA 2CY1A 2MM9A 2XR1A 3JAMD 3K6RA 2P20A 5AE2A 1UKKA 3IPLA 4DV4C 2P2QA 4BC7A 3A9VA 4XX2A 2Y4OA 5BURA 2P2BA 1M6XA 4DV0C 3A25A 3RV2A 5BUSA 1L2FA 3TR3A 2YX1A 2UUBC 3GR0A 1V60A 2P02A 5LCIA 1VLAA 4DUZC 2Y27A 4PHTA 2NCLA 3DAYA 1XMQC 4KTVA 4NOZA 3L8CA 1USPB 4LF7C 4B3SC 1P4EA 1PG3A 1UWDA 4RLFA 5BSWA 4BC9A 2VQEC 2HHHC 2E8EA 4JI3C 5ADZA 3G7SA 4I9GA 2QVXX 4I9FA 5LMUC 2QW0X 1ML8A 4GXQA 1WCJA 4U5YD 5LMNC 3O2EA 2VQFC 2JNVA 3GR1A 1BA3A 1KKGA 3T1YC 4D4IA 3ETOA 5JRHA 4BSZA 2ZZNA 2VZEA 3N54B 4R1LA 5BSTA 5A19A 4BCAA 3B7WA 2PROA 3NI2A 3GPCA 4WS9A 3EERA 3AY0A 4JI4C 2UU9C 5K85A 4L2ZA 1FJGC 1ZB9A 4PUGA 4DR1C 2D1QA 4NDNA 1MDFA 3LUSA 2KDNA 4MTNA 4NXNC 4PROC 2UXDC 1XNRC 3RG2A 2D1RA 2QVZX 3UX3A 4PZPA 4DV6C 1XRBA 1XS3A 3VNQA 3LAXA 2KZFA 3S82A 4G36A 1N2FA 4LF4C 2EGTA 4DCTA 1WH9A 4GS5A 1MXCA 4DV2C 4RVOA 2UUAC 2V7BA 1HH2P 2MMAB 4LF6C 1O93A 1M6XC 2D27A 2D1SA 3OTOC 1YJ7A 2Y4NA 1MD9A 4JI0C 2Z51A 4RLQA 4ODJA 3ETCA 3IMLA 3KXWA 4FUTA 1PA4A 3R9XA 4DR2C 3LNOA 2M5OA 2OPLA 1TH5A 4FTFA 1VEHA 4DR6C 1P4EC 2CU6A 4B3MC 4YY3C 1MKYA 4PUHA 1N34C 5IWAC 5CZXA 1O9TA 1MXBA 1HNZC 4B3TC 2AYAA 2YCBA 1QM4A 3IEUA 4GXRA 3R9WA 1NY8A 3PROC 3N2QA 3VNRA 4JI7C 3UEBA 1LCIA 5IFIA 1ZB8A 2E8FA 4YHHC 4LFBC 3GKUA 2P2FA 1IBLC 1JOSA 3NYRA 3TQIA 5KYVA 2D1TA 2ASBA 4JYAC 4BBYA 2QVYX 5BUQA 4JI5C 1WF3A 1GPMA 2E8CA 4K0KC 2VSQA 2HJGA 4NXMC 4LF9C 4LFAC 3CJEA 4PUIA 3E7WA 2ONFA 4DR3C 5AE3A 5BSUA 4GKKC 3DHVA 3VNSA 1V25A 4OX9C 4RM2A 1XRAA 4KHPC 3R44A 2E0GA 2BJOA 2YWCA 3LNVA 2M5HA 4X64C 4MH4A 3E7XA 4G1IA 1QWIA 2D28C 4D4GA 2WP0C 1PU1A 4D57A 4RMNA 1HNWC 3CQ3A 4IZ6A 3H2TA 1XRCA 3CQ2A 4DR7C 2OBVA 1NYEA 4IR7A 4EATA 1P7LA 4G37A 2UXCC 5AE1A 4DV1C 4LF8C 3J80D 1O92A 5BR8C 4DG8A 3SO4A 1RG9A 1MDBA 1PG4A 4DV3C 1T5DX 3EQ6A 2UXBC 4TPSB 4DR5C 1O90A 4X62C 1HR0C 5DV9A 5FLXD 3FCCA 4JV5C 4DV5C 2E7GA 2OPLB 4AQYC 2BH1X 5IT9D 4HPVA 5BSRA 4LF5C 4B3RC 2DHMA 3NYQA 2JMPA 3A26A 5T8TA 1K0RA 4WV3A 1N36C 4GKJC 2ZZMA 3DLPX 4OXIA 3A4IA 2P2MA 5T8SA 2ZM6C 3CW8X 1IB8A 4RM3A 4JI1C 5BSVA 4D56A 4JI6C 5A1IA 4X65C 5CZVA 4DV7C 3NPDA 2YWBA 1USPA 2KZ0A 4K0BA 4DCUA 4ZLPA 3UOWA 2DPLA 1J5EC 1HNXC 5E7QA 3PESA 4DR4C 3A9UA 5A2QD 2PN2A 4L7IA 4R0MA 4JM1A 4R1MA 1XMOC 4DCVA 4ZJZA 4ISBA 4RVNA 3AF5A 3TDEA 3C5EA 4FUQA 4DCSA 2OO4A 4L4QA 1IBMC 1N32C 2MCQA 4OYCA 3FCEA 3CQ1A 5K8FA 3PBKA 3CW9A 4JI2C 3I07A 1V26A 1RY2A 4DG9A 1I94C 1EGAA 2QL8A 3UX2A 5BSMA 1MXAA 1FUGA 2F4VC 3I08A 1N33C 3T1HC 3IEVA 2PT7G 1XNQC 5A1GA 3AF6A 4DUYC 4KTTA 1FLOA 4JI8C 4X66C 2CXCA 2DYJA 1LQLA 3UZ0A 2WD9A 4LE5A 3J81D 5KEIA
chains in the Genus database with same CATH topology
1IBKC 2E5LC 2ATWA 2UUCC 2D7VA 5GTDA 1ULTA 1T5HX 5H9UA 3L95X 5KYTA 3TUFA 3LGXA 1AMUA 4LFCC 2P2JA 2CY1A 2XR1A 3JAMD 2P20A 5AE2A 1UKKA 3IPLA 4DV4C 2P2QA 4BC7A 3A9VA 4XX2A 2Y4OA 5BURA 2P2BA 4DV0C 3RV2A 5BUSA 1L2FA 2UUBC 3GR0A 2P02A 1VLAA 4DUZC 2Y27A 4PHTA 3DAYA 1XMQC 4KTVA 4NOZA 3L8CA 1USPB 4LF7C 4B3SC 1PG3A 4RLFA 5BSWA 4BC9A 2VQEC 2HHHC 2E8EA 4JI3C 5ADZA 3G7SA 4I9GA 2QVXX 4I9FA 5LMUC 2QW0X 1ML8A 4GXQA 4U5YD 5LMNC 2VQFC 3GR1A 1BA3A 1KKGA 3T1YC 4D4IA 3ETOA 5JRHA 4BSZA 2VZEA 3N54B 4R1LA 5BSTA 5A19A 4BCAA 3B7WA 2PROA 3NI2A 3GPCA 4WS9A 3EERA 4JI4C 2UU9C 5K85A 4L2ZA 1FJGC 1ZB9A 4DR1C 2D1QA 4NDNA 1MDFA 3LUSA 2UXDC 4MTNA 4NXNC 4PROC 1XNRC 3RG2A 2D1RA 2QVZX 4PZPA 4DV6C 1XRBA 3VNQA 3LAXA 2KZFA 3S82A 4G36A 1N2FA 4LF4C 2EGTA 4DCTA 1WH9A 4GS5A 1MXCA 4DV2C 4RVOA 2UUAC 2V7BA 1HH2P 4LF6C 1O93A 2D27A 2D1SA 3OTOC 1YJ7A 2Y4NA 1MD9A 4JI0C 4RLQA 4ODJA 3ETCA 3IMLA 3KXWA 4FUTA 1PA4A 3R9XA 4DR2C 2OPLA 4FTFA 4DR6C 4B3MC 4YY3C 1MKYA 1N34C 5IWAC 5CZXA 1O9TA 1MXBA 1HNZC 4B3TC 2AYAA 2YCBA 1QM4A 3IEUA 4GXRA 3R9WA 3PROC 3N2QA 3VNRA 4JI7C 1LCIA 5IFIA 1ZB8A 2E8FA 4YHHC 4LFBC 3GKUA 2P2FA 1IBLC 1JOSA 3NYRA 3TQIA 5KYVA 2D1TA 2ASBA 4JYAC 4BBYA 2QVYX 5BUQA 4JI5C 1WF3A 1GPMA 2E8CA 4K0KC 2VSQA 2HJGA 4NXMC 4LF9C 4LFAC 3CJEA 3E7WA 2ONFA 4DR3C 5AE3A 5BSUA 4GKKC 3DHVA 3VNSA 1V25A 4OX9C 4RM2A 1XRAA 4KHPC 3R44A 2E0GA 2BJOA 2YWCA 3LNVA 4X64C 4MH4A 3E7XA 4G1IA 1QWIA 2D28C 4D4GA 2WP0C 4D57A 4RMNA 1HNWC 4IZ6A 3H2TA 1XRCA 4DR7C 2OBVA 1NYEA 4IR7A 4EATA 1P7LA 4G37A 2UXCC 5AE1A 4DV1C 4LF8C 3J80D 1O92A 5BR8C 4DG8A 3SO4A 1RG9A 1MDBA 1PG4A 4DV3C 1T5DX 3EQ6A 2UXBC 4TPSB 4DR5C 1O90A 4X62C 1HR0C 5DV9A 5FLXD 3FCCA 4JV5C 4DV5C 2E7GA 2OPLB 4AQYC 2BH1X 5IT9D 4HPVA 5BSRA 4LF5C 4B3RC 3NYQA 2JMPA 5T8TA 1K0RA 4WV3A 1N36C 4GKJC 3DLPX 4OXIA 3A4IA 2P2MA 5T8SA 2ZM6C 3CW8X 4RM3A 4JI1C 5BSVA 4D56A 4JI6C 5A1IA 4X65C 5CZVA 4DV7C 3NPDA 2YWBA 1USPA 4K0BA 4DCUA 4ZLPA 3UOWA 2DPLA 1J5EC 1HNXC 5E7QA 3PESA 4DR4C 3A9UA 5A2QD 2PN2A 4L7IA 4R0MA 4JM1A 4R1MA 1XMOC 4DCVA 4ZJZA 4ISBA 4RVNA 3AF5A 3TDEA 3C5EA 4FUQA 4DCSA 2OO4A 4L4QA 1IBMC 1N32C 4OYCA 3FCEA 5K8FA 3PBKA 3CW9A 4JI2C 3I07A 1V26A 1RY2A 4DG9A 1I94C 1EGAA 2QL8A 5BSMA 1MXAA 1FUGA 2F4VC 3I08A 1N33C 3T1HC 3IEVA 2PT7G 1XNQC 5A1GA 3AF6A 4DUYC 4KTTA 4JI8C 4X66C 2CXCA 2DYJA 1LQLA 3UZ0A 2WD9A 4LE5A 3J81D 5KEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ASB A;  1IBK C;  4JYA C;  2E5L C;  4JI5 C;  1K0R A;  1WF3 A;  3EER A;  2UUC C;  2ATW A;  2D7V A;  2E8C A;  4K0K C;  4JI4 C;  2UU9 C;  1N36 C;  4GKJ C;  1FJG C;  2HJG A;  4NXM C;  1ZB9 A;  4LF9 C;  4LFA C;  3CJE A;  4LFC C;  2CY1 A;  2ONF A;  2XR1 A;  4DR1 C;  3JAM D;  4DR3 C;  2ZM6 C;  3LUS A;  1UKK A;  4DV4 C;  4JI1 C;  2UXD C;  4MTN A;  4NXN C;  4GKK C;  1XNR C;  4JI6 C;  4XX2 A;  4OX9 C;  4X65 C;  4KHP C;  4DV7 C;  4DCU A;  1USP A;  4DV6 C;  1J5E C;  1HNX C;  2KZF A;  4DV0 C;  2BJO A;  4DR4 C;  1N2F A;  4LF4 C;  2EGT A;  4DCT A;  5A2Q D;  1L2F A;  2PN2 A;  4X64 C;  1WH9 A;  4MH4 A;  2UUB C;  1QWI A;  1XMO C;  4DCV A;  4DV2 C;  2UUA C;  1VLA A;  1HH2 P;  4LF6 C;  4DUZ C;  3AF5 A;  3OTO C;  4JI0 C;  1XMQ C;  1HNW C;  4NOZ A;  4DCS A;  1USP B;  4LF7 C;  4B3S C;  1IBM C;  1N32 C;  4DR7 C;  1NYE A;  1PA4 A;  3R9X A;  2VQE C;  4DR2 C;  2UXC C;  2OPL A;  2E8E A;  4JI3 C;  4DV1 C;  2HHH C;  4LF8 C;  3J80 D;  4JI2 C;  4DR6 C;  3I07 A;  5BR8 C;  4B3M C;  1I94 C;  5LMU C;  4DV3 C;  4YY3 C;  2QL8 A;  1EGA A;  1MKY A;  1ML8 A;  1N34 C;  5IWA C;  1HNZ C;  4B3T C;  5LMN C;  2VQF C;  2UXB C;  2YCB A;  2F4V C;  1N33 C;  3T1H C;  3IEU A;  4DR5 C;  3IEV A;  3R9W A;  4JI7 C;  2PT7 G;  4X62 C;  3T1Y C;  1HR0 C;  1KKG A;  1XNQ C;  3AF6 A;  5FLX D;  4BSZ A;  4DUY C;  4JI8 C;  4JV5 C;  4X66 C;  4DV5 C;  2E7G A;  1ZB8 A;  2OPL B;  2CXC A;  4AQY C;  2DYJ A;  2E8F A;  5IT9 D;  4YHH C;  1LQL A;  4LFB C;  3GKU A;  1IBL C;  1JOS A;  4LF5 C;  3J81 D;  4B3R C;  2JMP A; 
#chains in the Genus database with same CATH topology
 1IBK C;  2E5L C;  2ATW A;  2UUC C;  2D7V A;  5GTD A;  1XHJ A;  1ULT A;  1T5H X;  5H9U A;  3L95 X;  5KYT A;  3TUF A;  3LGX A;  1AMU A;  4LFC C;  2P2J A;  2CY1 A;  2MM9 A;  2XR1 A;  3JAM D;  3K6R A;  2P20 A;  5AE2 A;  1UKK A;  3IPL A;  4DV4 C;  2P2Q A;  4BC7 A;  3A9V A;  4XX2 A;  2Y4O A;  5BUR A;  2P2B A;  1M6X A;  4DV0 C;  3A25 A;  3RV2 A;  5BUS A;  1L2F A;  3TR3 A;  2YX1 A;  2UUB C;  3GR0 A;  1V60 A;  2P02 A;  5LCI A;  1VLA A;  4DUZ C;  2Y27 A;  4PHT A;  2NCL A;  3DAY A;  1XMQ C;  4KTV A;  4NOZ A;  3L8C A;  1USP B;  4LF7 C;  4B3S C;  1P4E A;  1PG3 A;  1UWD A;  4RLF A;  5BSW A;  4BC9 A;  2VQE C;  2HHH C;  2E8E A;  4JI3 C;  5ADZ A;  3G7S A;  4I9G A;  2QVX X;  4I9F A;  5LMU C;  2QW0 X;  1ML8 A;  4GXQ A;  1WCJ A;  4U5Y D;  5LMN C;  3O2E A;  2VQF C;  2JNV A;  3GR1 A;  1BA3 A;  1KKG A;  3T1Y C;  4D4I A;  3ETO A;  5JRH A;  4BSZ A;  2ZZN A;  2VZE A;  3N54 B;  4R1L A;  5BST A;  5A19 A;  4BCA A;  3B7W A;  2PRO A;  3NI2 A;  3GPC A;  4WS9 A;  3EER A;  3AY0 A;  4JI4 C;  2UU9 C;  5K85 A;  4L2Z A;  1FJG C;  1ZB9 A;  4PUG A;  4DR1 C;  2D1Q A;  4NDN A;  1MDF A;  3LUS A;  2KDN A;  4MTN A;  4NXN C;  4PRO C;  2UXD C;  1XNR C;  3RG2 A;  2D1R A;  2QVZ X;  3UX3 A;  4PZP A;  4DV6 C;  1XRB A;  1XS3 A;  3VNQ A;  3LAX A;  2KZF A;  3S82 A;  4G36 A;  1N2F A;  4LF4 C;  2EGT A;  4DCT A;  1WH9 A;  4GS5 A;  1MXC A;  4DV2 C;  4RVO A;  2UUA C;  2V7B A;  1HH2 P;  2MMA B;  4LF6 C;  1O93 A;  1M6X C;  2D27 A;  2D1S A;  3OTO C;  1YJ7 A;  2Y4N A;  1MD9 A;  4JI0 C;  2Z51 A;  4RLQ A;  4ODJ A;  3ETC A;  3IML A;  3KXW A;  4FUT A;  1PA4 A;  3R9X A;  4DR2 C;  3LNO A;  2M5O A;  2OPL A;  1TH5 A;  4FTF A;  1VEH A;  4DR6 C;  1P4E C;  2CU6 A;  4B3M C;  4YY3 C;  1MKY A;  4PUH A;  1N34 C;  5IWA C;  5CZX A;  1O9T A;  1MXB A;  1HNZ C;  4B3T C;  2AYA A;  2YCB A;  1QM4 A;  3IEU A;  4GXR A;  3R9W A;  1NY8 A;  3PRO C;  3N2Q A;  3VNR A;  4JI7 C;  3UEB A;  1LCI A;  5IFI A;  1ZB8 A;  2E8F A;  4YHH C;  4LFB C;  3GKU A;  2P2F A;  1IBL C;  1JOS A;  3NYR A;  3TQI A;  5KYV A;  2D1T A;  2ASB A;  4JYA C;  4BBY A;  2QVY X;  5BUQ A;  4JI5 C;  1WF3 A;  1GPM A;  2E8C A;  4K0K C;  2VSQ A;  2HJG A;  4NXM C;  4LF9 C;  4LFA C;  3CJE A;  4PUI A;  3E7W A;  2ONF A;  4DR3 C;  5AE3 A;  5BSU A;  4GKK C;  3DHV A;  3VNS A;  1V25 A;  4OX9 C;  4RM2 A;  1XRA A;  4KHP C;  3R44 A;  2E0G A;  2BJO A;  2YWC A;  3LNV A;  2M5H A;  4X64 C;  4MH4 A;  3E7X A;  4G1I A;  1QWI A;  2D28 C;  4D4G A;  2WP0 C;  1PU1 A;  4D57 A;  4RMN A;  1HNW C;  3CQ3 A;  4IZ6 A;  3H2T A;  1XRC A;  3CQ2 A;  4DR7 C;  2OBV A;  1NYE A;  4IR7 A;  4EAT A;  1P7L A;  4G37 A;  2UXC C;  5AE1 A;  4DV1 C;  4LF8 C;  3J80 D;  1O92 A;  5BR8 C;  4DG8 A;  3SO4 A;  1RG9 A;  1MDB A;  1PG4 A;  4DV3 C;  1T5D X;  3EQ6 A;  2UXB C;  4TPS B;  4DR5 C;  1O90 A;  4X62 C;  1HR0 C;  5DV9 A;  5FLX D;  3FCC A;  4JV5 C;  4DV5 C;  2E7G A;  2OPL B;  4AQY C;  2BH1 X;  5IT9 D;  4HPV A;  5BSR A;  4LF5 C;  4B3R C;  2DHM A;  3NYQ A;  2JMP A;  3A26 A;  5T8T A;  1K0R A;  4WV3 A;  1N36 C;  4GKJ C;  2ZZM A;  3DLP X;  4OXI A;  3A4I A;  2P2M A;  5T8S A;  2ZM6 C;  3CW8 X;  1IB8 A;  4RM3 A;  4JI1 C;  5BSV A;  4D56 A;  4JI6 C;  5A1I A;  4X65 C;  5CZV A;  4DV7 C;  3NPD A;  2YWB A;  1USP A;  2KZ0 A;  4K0B A;  4DCU A;  4ZLP A;  3UOW A;  2DPL A;  1J5E C;  1HNX C;  5E7Q A;  3PES A;  4DR4 C;  3A9U A;  5A2Q D;  2PN2 A;  4L7I A;  4R0M A;  4JM1 A;  4R1M A;  1XMO C;  4DCV A;  4ZJZ A;  4ISB A;  4RVN A;  3AF5 A;  3TDE A;  3C5E A;  4FUQ A;  4DCS A;  2OO4 A;  4L4Q A;  1IBM C;  1N32 C;  2MCQ A;  4OYC A;  3FCE A;  3CQ1 A;  5K8F A;  3PBK A;  3CW9 A;  4JI2 C;  3I07 A;  1V26 A;  1RY2 A;  4DG9 A;  1I94 C;  1EGA A;  2QL8 A;  3UX2 A;  5BSM A;  1MXA A;  1FUG A;  2F4V C;  3I08 A;  1N33 C;  3T1H C;  3IEV A;  2PT7 G;  1XNQ C;  5A1G A;  3AF6 A;  4DUY C;  4KTT A;  1FLO A;  4JI8 C;  4X66 C;  2CXC A;  2DYJ A;  1LQL A;  3UZ0 A;  2WD9 A;  4LE5 A;  3J81 D;  5KEI A; 
#chains in the Genus database with same CATH homology
 1IBK C;  2E5L C;  2ATW A;  2UUC C;  2D7V A;  5GTD A;  1ULT A;  1T5H X;  5H9U A;  3L95 X;  5KYT A;  3TUF A;  3LGX A;  1AMU A;  4LFC C;  2P2J A;  2CY1 A;  2XR1 A;  3JAM D;  2P20 A;  5AE2 A;  1UKK A;  3IPL A;  4DV4 C;  2P2Q A;  4BC7 A;  3A9V A;  4XX2 A;  2Y4O A;  5BUR A;  2P2B A;  4DV0 C;  3RV2 A;  5BUS A;  1L2F A;  2UUB C;  3GR0 A;  2P02 A;  1VLA A;  4DUZ C;  2Y27 A;  4PHT A;  3DAY A;  1XMQ C;  4KTV A;  4NOZ A;  3L8C A;  1USP B;  4LF7 C;  4B3S C;  1PG3 A;  4RLF A;  5BSW A;  4BC9 A;  2VQE C;  2HHH C;  2E8E A;  4JI3 C;  5ADZ A;  3G7S A;  4I9G A;  2QVX X;  4I9F A;  5LMU C;  2QW0 X;  1ML8 A;  4GXQ A;  4U5Y D;  5LMN C;  2VQF C;  3GR1 A;  1BA3 A;  1KKG A;  3T1Y C;  4D4I A;  3ETO A;  5JRH A;  4BSZ A;  2VZE A;  3N54 B;  4R1L A;  5BST A;  5A19 A;  4BCA A;  3B7W A;  2PRO A;  3NI2 A;  3GPC A;  4WS9 A;  3EER A;  4JI4 C;  2UU9 C;  5K85 A;  4L2Z A;  1FJG C;  1ZB9 A;  4DR1 C;  2D1Q A;  4NDN A;  1MDF A;  3LUS A;  2UXD C;  4MTN A;  4NXN C;  4PRO C;  1XNR C;  3RG2 A;  2D1R A;  2QVZ X;  4PZP A;  4DV6 C;  1XRB A;  3VNQ A;  3LAX A;  2KZF A;  3S82 A;  4G36 A;  1N2F A;  4LF4 C;  2EGT A;  4DCT A;  1WH9 A;  4GS5 A;  1MXC A;  4DV2 C;  4RVO A;  2UUA C;  2V7B A;  1HH2 P;  4LF6 C;  1O93 A;  2D27 A;  2D1S A;  3OTO C;  1YJ7 A;  2Y4N A;  1MD9 A;  4JI0 C;  4RLQ A;  4ODJ A;  3ETC A;  3IML A;  3KXW A;  4FUT A;  1PA4 A;  3R9X A;  4DR2 C;  2OPL A;  4FTF A;  4DR6 C;  4B3M C;  4YY3 C;  1MKY A;  1N34 C;  5IWA C;  5CZX A;  1O9T A;  1MXB A;  1HNZ C;  4B3T C;  2AYA A;  2YCB A;  1QM4 A;  3IEU A;  4GXR A;  3R9W A;  3PRO C;  3N2Q A;  3VNR A;  4JI7 C;  1LCI A;  5IFI A;  1ZB8 A;  2E8F A;  4YHH C;  4LFB C;  3GKU A;  2P2F A;  1IBL C;  1JOS A;  3NYR A;  3TQI A;  5KYV A;  2D1T A;  2ASB A;  4JYA C;  4BBY A;  2QVY X;  5BUQ A;  4JI5 C;  1WF3 A;  1GPM A;  2E8C A;  4K0K C;  2VSQ A;  2HJG A;  4NXM C;  4LF9 C;  4LFA C;  3CJE A;  3E7W A;  2ONF A;  4DR3 C;  5AE3 A;  5BSU A;  4GKK C;  3DHV A;  3VNS A;  1V25 A;  4OX9 C;  4RM2 A;  1XRA A;  4KHP C;  3R44 A;  2E0G A;  2BJO A;  2YWC A;  3LNV A;  4X64 C;  4MH4 A;  3E7X A;  4G1I A;  1QWI A;  2D28 C;  4D4G A;  2WP0 C;  4D57 A;  4RMN A;  1HNW C;  4IZ6 A;  3H2T A;  1XRC A;  4DR7 C;  2OBV A;  1NYE A;  4IR7 A;  4EAT A;  1P7L A;  4G37 A;  2UXC C;  5AE1 A;  4DV1 C;  4LF8 C;  3J80 D;  1O92 A;  5BR8 C;  4DG8 A;  3SO4 A;  1RG9 A;  1MDB A;  1PG4 A;  4DV3 C;  1T5D X;  3EQ6 A;  2UXB C;  4TPS B;  4DR5 C;  1O90 A;  4X62 C;  1HR0 C;  5DV9 A;  5FLX D;  3FCC A;  4JV5 C;  4DV5 C;  2E7G A;  2OPL B;  4AQY C;  2BH1 X;  5IT9 D;  4HPV A;  5BSR A;  4LF5 C;  4B3R C;  3NYQ A;  2JMP A;  5T8T A;  1K0R A;  4WV3 A;  1N36 C;  4GKJ C;  3DLP X;  4OXI A;  3A4I A;  2P2M A;  5T8S A;  2ZM6 C;  3CW8 X;  4RM3 A;  4JI1 C;  5BSV A;  4D56 A;  4JI6 C;  5A1I A;  4X65 C;  5CZV A;  4DV7 C;  3NPD A;  2YWB A;  1USP A;  4K0B A;  4DCU A;  4ZLP A;  3UOW A;  2DPL A;  1J5E C;  1HNX C;  5E7Q A;  3PES A;  4DR4 C;  3A9U A;  5A2Q D;  2PN2 A;  4L7I A;  4R0M A;  4JM1 A;  4R1M A;  1XMO C;  4DCV A;  4ZJZ A;  4ISB A;  4RVN A;  3AF5 A;  3TDE A;  3C5E A;  4FUQ A;  4DCS A;  2OO4 A;  4L4Q A;  1IBM C;  1N32 C;  4OYC A;  3FCE A;  5K8F A;  3PBK A;  3CW9 A;  4JI2 C;  3I07 A;  1V26 A;  1RY2 A;  4DG9 A;  1I94 C;  1EGA A;  2QL8 A;  5BSM A;  1MXA A;  1FUG A;  2F4V C;  3I08 A;  1N33 C;  3T1H C;  3IEV A;  2PT7 G;  1XNQ C;  5A1G A;  3AF6 A;  4DUY C;  4KTT A;  4JI8 C;  4X66 C;  2CXC A;  2DYJ A;  1LQL A;  3UZ0 A;  2WD9 A;  4LE5 A;  3J81 D;  5KEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...