2CY1A

Crystal structure of ape1850
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
138
structure length
138
Chain Sequence
ITLEELRYISVFHSITGVTAYRCIVDEENNRLIFLVSEGEAGRAIGRGGRLIKLLREALGKNIEVVEYSSDLERIVKNLFPGVKIESINVRERNGVKQVVIKVSEDDKGAAIGKGGKNVKRARLVLSKLFGVEKVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization of the archaeal transcription termination factor NusA: a significant decrease in twinning under microgravity conditions
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transcription
molecule keywords NusA protein homolog
total genus 43
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2005-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2cy1A02
2ONFA 1N32C 1QWIA 2CXCA 3IEVA 2UXBC 5LMUC 1ML8A 4JI6C 4B3RC 2PT7G 1XNQC 4DR1C 4LF5C 3GKUA 4LF9C 1MKYA 4K0KC 4GKJC 1PA4A 1LQLA 4X64C 4DV7C 1IBMC 2E7GA 2PN2A 4XX2A 4LF8C 1N33C 2DYJA 1N2FA 1I94C 3J81D 4JI5C 1JOSA 4DR5C 4DCUA 1N36C 3R9WA 4JI0C 2F4VC 1VLAA 1UKKA 3AF5A 4JI8C 4LFCC 2CY1A 4JI1C 2E8FA 4DCVA 4DV5C 2UUAC 3IEUA 1IBLC 4DR4C 1FJGC 4YY3C 2KZFA 1WF3A 4LFAC 2VQEC 4DV0C 2HHHC 2UUBC 1HH2P 4LF6C 2VQFC 2E8EA 2D7VA 5BR8C 1HNZC 1IBKC 2E8CA 2ASBA 4JI7C 4LF7C 4NOZA 4B3MC 3T1YC 3EERA 4X66C 2YCBA 4BSZA 4DV4C 1ZB8A 5A2QD 4KHPC 2UXDC 1USPB 2ZM6C 4DV3C 4DR7C 1N34C 4DCTA 3R9XA 2UU9C 4DV2C 4JI2C 2XR1A 2UUCC 1USPA 1HNWC 1NYEA 4DUZC 4B3SC 3AF6A 2ATWA 4X65C 2EGTA 4DR6C 2JMPA 2HJGA 4DUYC 4DR3C 1XNRC 4DV1C 4NXNC 4JV5C 4LFBC 4DV6C 4OX9C 4MTNA 1WH9A 4DR2C 4B3TC 4JI3C 3T1HC 1KKGA 3I07A 1HR0C 1J5EC 2UXCC 1EGAA 5LMNC 4JYAC 4NXMC 3J80D 1HNXC 1L2FA 4YHHC 5FLXD 4JI4C 3CJEA 5IWAC 4GKKC 1XMQC 2BJOA 4MH4A 4X62C 2OPLB 2E5LC 1K0RA 5IT9D 1XMOC 3LUSA 2QL8A 1ZB9A 2OPLA 3JAMD 4AQYC 3OTOC 4DCSA 4LF4C
chains in the Genus database with same CATH superfamily
3A26A 2ONFA 4R1LA 1N32C 2CXCA 4L7IA 3IEVA 5AE2A 5A1IA 5IFIA 5BUSA 4LF9C 4U5YD 2Y4OA 4DV7C 4LF8C 4G37A 3A9UA 1JOSA 4DCUA 1N36C 5T8TA 4I9FA 3UX3A 2F4VC 3NI2A 1V25A 1UKKA 1P7LA 2CY1A 3LAXA 3NYRA 5BSTA 4DR4C 4PUIA 2D28C 4LFAC 5GTDA 3GR0A 1T5HX 4DV0C 1HNZC 2ASBA 4GXRA 4K0BA 1LCIA 3EERA 2V7BA 5A2QD 2UXDC 5AE3A 2UU9C 4JI2C 3IPLA 1USPA 5AE1A 1NYEA 1MDBA 4DUZC 4B3SC 3DAYA 4OYCA 4MTNA 1XHJA 3O2EA 4B3TC 2E0GA 1RY2A 2Z51A 1YJ7A 3T1HC 1HR0C 1J5EC 2UXCC 4D4GA 3UEBA 1HNXC 3CW8X 4YHHC 1PG3A 5BSMA 3CJEA 4FUTA 5IWAC 3TDEA 2P20A 2QVZX 2BJOA 2PROA 4X62C 3CW9A 2AYAA 2QL8A 2MCQA 3JAMD 1PU1A 5JRHA 2BH1X 2P2MA 2UXBC 3PROC 4DR1C 3GKUA 3NPDA 3AY0A 4K0KC 4GKJC 3R44A 4GS5A 2OBVA 3S82A 2PN2A 4XX2A 2DYJA 1N2FA 3J81D 2KDNA 1RG9A 2P2JA 3AF5A 4JI8C 4LFCC 4JI1C 2DHMA 5K85A 4DV5C 4FTFA 3L95X 2UUAC 1MDFA 4FUQA 3K6RA 1AMUA 3GPCA 1FJGC 4YY3C 3LNVA 4WV3A 1WF3A 3UZ0A 4LF6C 1HH2P 3LNOA 2Y27A 2D7VA 1IBKC 4LF7C 3E7WA 4TPSB 3T1YC 2YCBA 3VNQA 4DV4C 1ULTA 2ZM6C 3CQ2A 1XRAA 4PHTA 2D27A 3FCEA 1MXCA 2EGTA 1TH5A 3DLPX 3N54B 5CZXA 1NY8A 1XRBA 4NXNC 4JV5C 4LFBC 4DV6C 5BURA 1WH9A 4RLQA 1KKGA 3B7WA 3G7SA 3KXWA 4ZLPA 2CU6A 1EGAA 4PUHA 3VNRA 4NXMC 2ZZNA 1L2FA 4BC7A 4DG9A 4RMNA 4JI4C 4ODJA 2DPLA 1XMQC 4MH4A 3TUFA 1K0RA 5IT9D 1XMOC 4RM3A 2OPLA 2MM9A 4AQYC 1IB8A 2D1QA 5LMUC 4PROC 4JI6C 4B3RC 2PT7G 1XNQC 2OO4A 4ZJZA 1MKYA 1LQLA 5BSVA 4IZ6A 1IBMC 2E7GA 1I94C 5KEIA 4RVNA 2M5HA 4I9GA 4JI5C 4DR5C 3FCCA 5H9UA 5E7QA 4JM1A 1GPMA 1VLAA 4GXQA 4L2ZA 4EATA 2E8FA 4R0MA 2KZ0A 4DCVA 3GR1A 3IEUA 1IBLC 1V60A 1V26A 2KZFA 5DV9A 2VQEC 2UUBC 3N2QA 5T8SA 2VQFC 1FUGA 2E8CA 4JI7C 4NOZA 4B3MC 2QVYX 4IR7A 4X66C 1MD9A 1ZB8A 4R1MA 2YWCA 2ZZMA 1USPB 4DV3C 1N34C 3DHVA 4DCTA 3R9XA 4HPVA 3C5EA 3ETCA 1HNWC 4KTVA 5KYTA 4D57A 2M5OA 2WP0C 5A1GA 4X65C 4G36A 2JMPA 5ADZA 1M6XA 4DUYC 4DV1C 3TQIA 3CQ1A 3LGXA 5K8FA 1XRCA 4OX9C 3A4IA 1O90A 3PESA 4ISBA 4KTTA 1O9TA 4DR2C 2QW0X 4JI3C 2VZEA 3I07A 1MXBA 5LMNC 5FLXD 3PBKA 4RLFA 4GKKC 5BSWA 1T5DX 4DG8A 3EQ6A 3CQ3A 2E5LC 4BBYA 3LUSA 1ZB9A 1FLOA 4D56A 1O92A 5BSRA 1O93A 2P02A 1QWIA 1ML8A 3A25A 1QM4A 4PUGA 4LF5C 2D1SA 1PA4A 5LCIA 4X64C 1N33C 3IMLA 1P4EC 4PZPA 5KYVA 3R9WA 4JI0C 1MXAA 2MMAB 3ETOA 2NCLA 5BSUA 2YWBA 3E7XA 3I08A 3RG2A 5A19A 3VNSA 4LE5A 2D1TA 2D1RA 1VEHA 2HHHC 1BA3A 2E8EA 5BR8C 3H2TA 3NYQA 4BSZA 4KHPC 4RM2A 3UX2A 2YX1A 4DR7C 4DV2C 3L8CA 2XR1A 2UUCC 3AF6A 2ATWA 1WCJA 2WD9A 4DR6C 4NDNA 1M6XC 2HJGA 2QVXX 4DR3C 1XNRC 1UWDA 2Y4NA 5CZVA 2VSQA 1PG4A 4OXIA 2P2QA 4BCAA 4JYAC 4BC9A 3J80D 4WS9A 3TR3A 1XS3A 4D4IA 4RVOA 1P4EA 4L4QA 3UOWA 2P2BA 2P2FA 3RV2A 2OPLB 5BUQA 4G1IA 3SO4A 3A9VA 2JNVA 3OTOC 4DCSA 4LF4C
chains in the Genus database with same CATH topology
2ONFA 4R1LA 1N32C 2CXCA 4L7IA 3IEVA 5AE2A 5A1IA 5IFIA 5BUSA 4LF9C 4U5YD 2Y4OA 4DV7C 4LF8C 4G37A 3A9UA 1JOSA 4DCUA 3OTOC 1N36C 5T8TA 4I9FA 2F4VC 3NI2A 1V25A 1UKKA 1P7LA 2CY1A 3LAXA 3NYRA 5BSTA 4DR4C 2D28C 4LFAC 5GTDA 3GR0A 1T5HX 4DV0C 1HNZC 2ASBA 4GXRA 4K0BA 1LCIA 3EERA 2V7BA 5A2QD 2UXDC 5AE3A 2UU9C 4JI2C 3IPLA 1USPA 5AE1A 1NYEA 1MDBA 4DUZC 4B3SC 3DAYA 4OYCA 4MTNA 4B3TC 2E0GA 1RY2A 1YJ7A 3T1HC 1HR0C 1J5EC 2UXCC 4D4GA 1HNXC 3CW8X 4YHHC 1PG3A 5BSMA 3CJEA 4FUTA 5IWAC 3TDEA 2P20A 2QVZX 2BJOA 2PROA 4X62C 3CW9A 2AYAA 2QL8A 3JAMD 5JRHA 2BH1X 2P2MA 2UXBC 3PROC 4DR1C 3GKUA 3NPDA 4K0KC 4GKJC 3R44A 4GS5A 2OBVA 3S82A 2PN2A 4XX2A 2DYJA 1N2FA 3J81D 1RG9A 2P2JA 3AF5A 4JI8C 4LFCC 4JI1C 5K85A 4DV5C 4FTFA 3L95X 2UUAC 1MDFA 4FUQA 1AMUA 3GPCA 1FJGC 4YY3C 3LNVA 4WV3A 1WF3A 3UZ0A 4LF6C 1HH2P 2Y27A 2D7VA 1IBKC 4LF7C 3E7WA 4TPSB 3T1YC 2YCBA 3VNQA 4DV4C 1ULTA 2ZM6C 1XRAA 4PHTA 2D27A 3FCEA 1MXCA 2EGTA 3DLPX 3N54B 5CZXA 1XRBA 4NXNC 4JV5C 4LFBC 4DV6C 5BURA 1WH9A 4RLQA 1KKGA 3B7WA 3G7SA 3KXWA 4ZLPA 1EGAA 3VNRA 4NXMC 1L2FA 4BC7A 4DG9A 4RMNA 4JI4C 4ODJA 2DPLA 1XMQC 4MH4A 3TUFA 1K0RA 5IT9D 1XMOC 4RM3A 2OPLA 4AQYC 2D1QA 5LMUC 4PROC 4JI6C 4B3RC 2PT7G 1XNQC 2OO4A 4ZJZA 1MKYA 1LQLA 5BSVA 4IZ6A 1IBMC 2E7GA 1I94C 5KEIA 4RVNA 4I9GA 4JI5C 4DR5C 3FCCA 5H9UA 5E7QA 4JM1A 1GPMA 1VLAA 4GXQA 4L2ZA 4EATA 2E8FA 4R0MA 4DCVA 3GR1A 3IEUA 1IBLC 1V26A 2KZFA 5DV9A 2VQEC 2UUBC 3N2QA 5T8SA 2VQFC 1FUGA 2E8CA 4JI7C 4NOZA 4B3MC 2QVYX 4IR7A 4X66C 1MD9A 1ZB8A 4R1MA 2YWCA 1USPB 4DV3C 1N34C 3DHVA 4DCTA 3R9XA 4HPVA 3C5EA 3ETCA 1HNWC 4KTVA 5KYTA 4D57A 2WP0C 5A1GA 4X65C 4G36A 2JMPA 5ADZA 4DUYC 4DV1C 3TQIA 3LGXA 5K8FA 1XRCA 4OX9C 3A4IA 1O90A 3PESA 4ISBA 4KTTA 1O9TA 4DR2C 2QW0X 4JI3C 2VZEA 3I07A 1MXBA 5LMNC 5FLXD 3PBKA 4RLFA 4GKKC 5BSWA 1T5DX 4DG8A 3EQ6A 2E5LC 4BBYA 3LUSA 1ZB9A 4D56A 1O92A 5BSRA 1O93A 2P02A 1QWIA 1ML8A 1QM4A 2D1SA 1PA4A 4X64C 1N33C 3IMLA 4PZPA 5KYVA 3R9WA 4JI0C 1MXAA 3ETOA 5BSUA 2YWBA 3E7XA 3I08A 3RG2A 5A19A 3VNSA 4LE5A 2D1TA 2D1RA 2HHHC 1BA3A 2E8EA 5BR8C 3H2TA 3NYQA 4BSZA 4KHPC 4RM2A 4DR7C 4DV2C 3L8CA 2XR1A 2UUCC 3AF6A 2ATWA 2WD9A 4DR6C 4NDNA 2HJGA 2QVXX 4DR3C 1XNRC 2Y4NA 5CZVA 2VSQA 1PG4A 4OXIA 2P2QA 4BCAA 4JYAC 4BC9A 3J80D 4WS9A 4D4IA 4RVOA 4L4QA 3UOWA 2P2BA 2P2FA 3RV2A 2OPLB 5BUQA 4G1IA 3SO4A 3A9VA 4LF5C 4DCSA 4LF4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONF A;  1N32 C;  1QWI A;  2CXC A;  3IEV A;  2UXB C;  5LMU C;  1ML8 A;  4JI6 C;  4B3R C;  2PT7 G;  1XNQ C;  4DR1 C;  4LF5 C;  3GKU A;  4LF9 C;  1MKY A;  4K0K C;  4GKJ C;  1PA4 A;  1LQL A;  4X64 C;  4DV7 C;  1IBM C;  2E7G A;  2PN2 A;  4XX2 A;  4LF8 C;  1N33 C;  2DYJ A;  1N2F A;  1I94 C;  3J81 D;  4JI5 C;  1JOS A;  4DR5 C;  4DCU A;  1N36 C;  3R9W A;  4JI0 C;  2F4V C;  1VLA A;  1UKK A;  3AF5 A;  4JI8 C;  4LFC C;  2CY1 A;  4JI1 C;  2E8F A;  4DCV A;  4DV5 C;  2UUA C;  3IEU A;  1IBL C;  4DR4 C;  1FJG C;  4YY3 C;  2KZF A;  1WF3 A;  4LFA C;  2VQE C;  4DV0 C;  2HHH C;  2UUB C;  1HH2 P;  4LF6 C;  2VQF C;  2E8E A;  2D7V A;  5BR8 C;  1HNZ C;  1IBK C;  2E8C A;  2ASB A;  4JI7 C;  4LF7 C;  4NOZ A;  4B3M C;  3T1Y C;  3EER A;  4X66 C;  2YCB A;  4BSZ A;  4DV4 C;  1ZB8 A;  5A2Q D;  4KHP C;  2UXD C;  1USP B;  2ZM6 C;  4DV3 C;  4DR7 C;  1N34 C;  4DCT A;  3R9X A;  2UU9 C;  4DV2 C;  4JI2 C;  2XR1 A;  2UUC C;  1USP A;  1HNW C;  1NYE A;  4DUZ C;  4B3S C;  3AF6 A;  2ATW A;  4X65 C;  2EGT A;  4DR6 C;  2JMP A;  2HJG A;  4DUY C;  4DR3 C;  1XNR C;  4DV1 C;  4NXN C;  4JV5 C;  4LFB C;  4DV6 C;  4OX9 C;  4MTN A;  1WH9 A;  4DR2 C;  4B3T C;  4JI3 C;  3T1H C;  1KKG A;  3I07 A;  1HR0 C;  1J5E C;  2UXC C;  1EGA A;  5LMN C;  4JYA C;  4NXM C;  3J80 D;  1HNX C;  1L2F A;  4YHH C;  5FLX D;  4JI4 C;  3CJE A;  5IWA C;  4GKK C;  1XMQ C;  2BJO A;  4MH4 A;  4X62 C;  2OPL B;  2E5L C;  1K0R A;  5IT9 D;  1XMO C;  3LUS A;  2QL8 A;  1ZB9 A;  2OPL A;  3JAM D;  4AQY C;  3OTO C;  4DCS A;  4LF4 C; 
#chains in the Genus database with same CATH topology
 3A26 A;  2ONF A;  4R1L A;  1N32 C;  2CXC A;  4L7I A;  3IEV A;  5AE2 A;  5A1I A;  5IFI A;  5BUS A;  4LF9 C;  4U5Y D;  2Y4O A;  4DV7 C;  4LF8 C;  4G37 A;  3A9U A;  1JOS A;  4DCU A;  1N36 C;  5T8T A;  4I9F A;  3UX3 A;  2F4V C;  3NI2 A;  1V25 A;  1UKK A;  1P7L A;  2CY1 A;  3LAX A;  3NYR A;  5BST A;  4DR4 C;  4PUI A;  2D28 C;  4LFA C;  5GTD A;  3GR0 A;  1T5H X;  4DV0 C;  1HNZ C;  2ASB A;  4GXR A;  4K0B A;  1LCI A;  3EER A;  2V7B A;  5A2Q D;  2UXD C;  5AE3 A;  2UU9 C;  4JI2 C;  3IPL A;  1USP A;  5AE1 A;  1NYE A;  1MDB A;  4DUZ C;  4B3S C;  3DAY A;  4OYC A;  4MTN A;  1XHJ A;  3O2E A;  4B3T C;  2E0G A;  1RY2 A;  2Z51 A;  1YJ7 A;  3T1H C;  1HR0 C;  1J5E C;  2UXC C;  4D4G A;  3UEB A;  1HNX C;  3CW8 X;  4YHH C;  1PG3 A;  5BSM A;  3CJE A;  4FUT A;  5IWA C;  3TDE A;  2P20 A;  2QVZ X;  2BJO A;  2PRO A;  4X62 C;  3CW9 A;  2AYA A;  2QL8 A;  2MCQ A;  3JAM D;  1PU1 A;  5JRH A;  2BH1 X;  2P2M A;  2UXB C;  3PRO C;  4DR1 C;  3GKU A;  3NPD A;  3AY0 A;  4K0K C;  4GKJ C;  3R44 A;  4GS5 A;  2OBV A;  3S82 A;  2PN2 A;  4XX2 A;  2DYJ A;  1N2F A;  3J81 D;  2KDN A;  1RG9 A;  2P2J A;  3AF5 A;  4JI8 C;  4LFC C;  4JI1 C;  2DHM A;  5K85 A;  4DV5 C;  4FTF A;  3L95 X;  2UUA C;  1MDF A;  4FUQ A;  3K6R A;  1AMU A;  3GPC A;  1FJG C;  4YY3 C;  3LNV A;  4WV3 A;  1WF3 A;  3UZ0 A;  4LF6 C;  1HH2 P;  3LNO A;  2Y27 A;  2D7V A;  1IBK C;  4LF7 C;  3E7W A;  4TPS B;  3T1Y C;  2YCB A;  3VNQ A;  4DV4 C;  1ULT A;  2ZM6 C;  3CQ2 A;  1XRA A;  4PHT A;  2D27 A;  3FCE A;  1MXC A;  2EGT A;  1TH5 A;  3DLP X;  3N54 B;  5CZX A;  1NY8 A;  1XRB A;  4NXN C;  4JV5 C;  4LFB C;  4DV6 C;  5BUR A;  1WH9 A;  4RLQ A;  1KKG A;  3B7W A;  3G7S A;  3KXW A;  4ZLP A;  2CU6 A;  1EGA A;  4PUH A;  3VNR A;  4NXM C;  2ZZN A;  1L2F A;  4BC7 A;  4DG9 A;  4RMN A;  4JI4 C;  4ODJ A;  2DPL A;  1XMQ C;  4MH4 A;  3TUF A;  1K0R A;  5IT9 D;  1XMO C;  4RM3 A;  2OPL A;  2MM9 A;  4AQY C;  1IB8 A;  2D1Q A;  5LMU C;  4PRO C;  4JI6 C;  4B3R C;  2PT7 G;  1XNQ C;  2OO4 A;  4ZJZ A;  1MKY A;  1LQL A;  5BSV A;  4IZ6 A;  1IBM C;  2E7G A;  1I94 C;  5KEI A;  4RVN A;  2M5H A;  4I9G A;  4JI5 C;  4DR5 C;  3FCC A;  5H9U A;  5E7Q A;  4JM1 A;  1GPM A;  1VLA A;  4GXQ A;  4L2Z A;  4EAT A;  2E8F A;  4R0M A;  2KZ0 A;  4DCV A;  3GR1 A;  3IEU A;  1IBL C;  1V60 A;  1V26 A;  2KZF A;  5DV9 A;  2VQE C;  2UUB C;  3N2Q A;  5T8S A;  2VQF C;  1FUG A;  2E8C A;  4JI7 C;  4NOZ A;  4B3M C;  2QVY X;  4IR7 A;  4X66 C;  1MD9 A;  1ZB8 A;  4R1M A;  2YWC A;  2ZZM A;  1USP B;  4DV3 C;  1N34 C;  3DHV A;  4DCT A;  3R9X A;  4HPV A;  3C5E A;  3ETC A;  1HNW C;  4KTV A;  5KYT A;  4D57 A;  2M5O A;  2WP0 C;  5A1G A;  4X65 C;  4G36 A;  2JMP A;  5ADZ A;  1M6X A;  4DUY C;  4DV1 C;  3TQI A;  3CQ1 A;  3LGX A;  5K8F A;  1XRC A;  4OX9 C;  3A4I A;  1O90 A;  3PES A;  4ISB A;  4KTT A;  1O9T A;  4DR2 C;  2QW0 X;  4JI3 C;  2VZE A;  3I07 A;  1MXB A;  5LMN C;  5FLX D;  3PBK A;  4RLF A;  4GKK C;  5BSW A;  1T5D X;  4DG8 A;  3EQ6 A;  3CQ3 A;  2E5L C;  4BBY A;  3LUS A;  1ZB9 A;  1FLO A;  4D56 A;  1O92 A;  5BSR A;  1O93 A;  2P02 A;  1QWI A;  1ML8 A;  3A25 A;  1QM4 A;  4PUG A;  4LF5 C;  2D1S A;  1PA4 A;  5LCI A;  4X64 C;  1N33 C;  3IML A;  1P4E C;  4PZP A;  5KYV A;  3R9W A;  4JI0 C;  1MXA A;  2MMA B;  3ETO A;  2NCL A;  5BSU A;  2YWB A;  3E7X A;  3I08 A;  3RG2 A;  5A19 A;  3VNS A;  4LE5 A;  2D1T A;  2D1R A;  1VEH A;  2HHH C;  1BA3 A;  2E8E A;  5BR8 C;  3H2T A;  3NYQ A;  4BSZ A;  4KHP C;  4RM2 A;  3UX2 A;  2YX1 A;  4DR7 C;  4DV2 C;  3L8C A;  2XR1 A;  2UUC C;  3AF6 A;  2ATW A;  1WCJ A;  2WD9 A;  4DR6 C;  4NDN A;  1M6X C;  2HJG A;  2QVX X;  4DR3 C;  1XNR C;  1UWD A;  2Y4N A;  5CZV A;  2VSQ A;  1PG4 A;  4OXI A;  2P2Q A;  4BCA A;  4JYA C;  4BC9 A;  3J80 D;  4WS9 A;  3TR3 A;  1XS3 A;  4D4I A;  4RVO A;  1P4E A;  4L4Q A;  3UOW A;  2P2B A;  2P2F A;  3RV2 A;  2OPL B;  5BUQ A;  4G1I A;  3SO4 A;  3A9V A;  2JNV A;  3OTO C;  4DCS A;  4LF4 C; 
#chains in the Genus database with same CATH homology
 2ONF A;  4R1L A;  1N32 C;  2CXC A;  4L7I A;  3IEV A;  5AE2 A;  5A1I A;  5IFI A;  5BUS A;  4LF9 C;  4U5Y D;  2Y4O A;  4DV7 C;  4LF8 C;  4G37 A;  3A9U A;  1JOS A;  4DCU A;  3OTO C;  1N36 C;  5T8T A;  4I9F A;  2F4V C;  3NI2 A;  1V25 A;  1UKK A;  1P7L A;  2CY1 A;  3LAX A;  3NYR A;  5BST A;  4DR4 C;  2D28 C;  4LFA C;  5GTD A;  3GR0 A;  1T5H X;  4DV0 C;  1HNZ C;  2ASB A;  4GXR A;  4K0B A;  1LCI A;  3EER A;  2V7B A;  5A2Q D;  2UXD C;  5AE3 A;  2UU9 C;  4JI2 C;  3IPL A;  1USP A;  5AE1 A;  1NYE A;  1MDB A;  4DUZ C;  4B3S C;  3DAY A;  4OYC A;  4MTN A;  4B3T C;  2E0G A;  1RY2 A;  1YJ7 A;  3T1H C;  1HR0 C;  1J5E C;  2UXC C;  4D4G A;  1HNX C;  3CW8 X;  4YHH C;  1PG3 A;  5BSM A;  3CJE A;  4FUT A;  5IWA C;  3TDE A;  2P20 A;  2QVZ X;  2BJO A;  2PRO A;  4X62 C;  3CW9 A;  2AYA A;  2QL8 A;  3JAM D;  5JRH A;  2BH1 X;  2P2M A;  2UXB C;  3PRO C;  4DR1 C;  3GKU A;  3NPD A;  4K0K C;  4GKJ C;  3R44 A;  4GS5 A;  2OBV A;  3S82 A;  2PN2 A;  4XX2 A;  2DYJ A;  1N2F A;  3J81 D;  1RG9 A;  2P2J A;  3AF5 A;  4JI8 C;  4LFC C;  4JI1 C;  5K85 A;  4DV5 C;  4FTF A;  3L95 X;  2UUA C;  1MDF A;  4FUQ A;  1AMU A;  3GPC A;  1FJG C;  4YY3 C;  3LNV A;  4WV3 A;  1WF3 A;  3UZ0 A;  4LF6 C;  1HH2 P;  2Y27 A;  2D7V A;  1IBK C;  4LF7 C;  3E7W A;  4TPS B;  3T1Y C;  2YCB A;  3VNQ A;  4DV4 C;  1ULT A;  2ZM6 C;  1XRA A;  4PHT A;  2D27 A;  3FCE A;  1MXC A;  2EGT A;  3DLP X;  3N54 B;  5CZX A;  1XRB A;  4NXN C;  4JV5 C;  4LFB C;  4DV6 C;  5BUR A;  1WH9 A;  4RLQ A;  1KKG A;  3B7W A;  3G7S A;  3KXW A;  4ZLP A;  1EGA A;  3VNR A;  4NXM C;  1L2F A;  4BC7 A;  4DG9 A;  4RMN A;  4JI4 C;  4ODJ A;  2DPL A;  1XMQ C;  4MH4 A;  3TUF A;  1K0R A;  5IT9 D;  1XMO C;  4RM3 A;  2OPL A;  4AQY C;  2D1Q A;  5LMU C;  4PRO C;  4JI6 C;  4B3R C;  2PT7 G;  1XNQ C;  2OO4 A;  4ZJZ A;  1MKY A;  1LQL A;  5BSV A;  4IZ6 A;  1IBM C;  2E7G A;  1I94 C;  5KEI A;  4RVN A;  4I9G A;  4JI5 C;  4DR5 C;  3FCC A;  5H9U A;  5E7Q A;  4JM1 A;  1GPM A;  1VLA A;  4GXQ A;  4L2Z A;  4EAT A;  2E8F A;  4R0M A;  4DCV A;  3GR1 A;  3IEU A;  1IBL C;  1V26 A;  2KZF A;  5DV9 A;  2VQE C;  2UUB C;  3N2Q A;  5T8S A;  2VQF C;  1FUG A;  2E8C A;  4JI7 C;  4NOZ A;  4B3M C;  2QVY X;  4IR7 A;  4X66 C;  1MD9 A;  1ZB8 A;  4R1M A;  2YWC A;  1USP B;  4DV3 C;  1N34 C;  3DHV A;  4DCT A;  3R9X A;  4HPV A;  3C5E A;  3ETC A;  1HNW C;  4KTV A;  5KYT A;  4D57 A;  2WP0 C;  5A1G A;  4X65 C;  4G36 A;  2JMP A;  5ADZ A;  4DUY C;  4DV1 C;  3TQI A;  3LGX A;  5K8F A;  1XRC A;  4OX9 C;  3A4I A;  1O90 A;  3PES A;  4ISB A;  4KTT A;  1O9T A;  4DR2 C;  2QW0 X;  4JI3 C;  2VZE A;  3I07 A;  1MXB A;  5LMN C;  5FLX D;  3PBK A;  4RLF A;  4GKK C;  5BSW A;  1T5D X;  4DG8 A;  3EQ6 A;  2E5L C;  4BBY A;  3LUS A;  1ZB9 A;  4D56 A;  1O92 A;  5BSR A;  1O93 A;  2P02 A;  1QWI A;  1ML8 A;  1QM4 A;  2D1S A;  1PA4 A;  4X64 C;  1N33 C;  3IML A;  4PZP A;  5KYV A;  3R9W A;  4JI0 C;  1MXA A;  3ETO A;  5BSU A;  2YWB A;  3E7X A;  3I08 A;  3RG2 A;  5A19 A;  3VNS A;  4LE5 A;  2D1T A;  2D1R A;  2HHH C;  1BA3 A;  2E8E A;  5BR8 C;  3H2T A;  3NYQ A;  4BSZ A;  4KHP C;  4RM2 A;  4DR7 C;  4DV2 C;  3L8C A;  2XR1 A;  2UUC C;  3AF6 A;  2ATW A;  2WD9 A;  4DR6 C;  4NDN A;  2HJG A;  2QVX X;  4DR3 C;  1XNR C;  2Y4N A;  5CZV A;  2VSQ A;  1PG4 A;  4OXI A;  2P2Q A;  4BCA A;  4JYA C;  4BC9 A;  3J80 D;  4WS9 A;  4D4I A;  4RVO A;  4L4Q A;  3UOW A;  2P2B A;  2P2F A;  3RV2 A;  2OPL B;  5BUQ A;  4G1I A;  3SO4 A;  3A9V A;  4LF5 C;  4DCS A;  4LF4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...