1VLAA

Crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
144
structure length
144
Chain Sequence
HHHHHHMQARWIGNMMFHVRTDSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVIDQMKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEKYCSVSAILKCSSKVTYEIVYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroperoxide resistance protein OsmC
publication title Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 34
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vlaA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1vlaA02
2B63I 2R93I 4DV7C 4NXNC 4A3FI 3ESWA 2QL8A 3J81D 1I50I 4DCTA 4DV4C 2E2HI 4LFBC 2BJOA 3GTPI 1TWFI 3M4OI 1X3ZA 2DE6A 4NBEA 4JI5C 1PFTA 2YCBA 4X66C 4NBFA 4LFAC 1ML8A 4OX9C 4JI4C 4B3RC 4A3BI 4DR5C 1N2FA 2EGTA 1TWCI 1HR0C 4BBRI 4X62C 4JI6C 5LMNC 4LF7C 3I4NI 3U50C 1XMOC 4JYAC 1HNXC 3VMGA 1ZB9A 3FKII 2HHHC 3R9WA 1TWGI 2PT7G 2JMPA 4MH4A 1TFIA 4K0KC 3GTQI 1QYPA 2DYJA 4A3CI 3HOYI 1N36C 2E8CA 4DR2C 2CXCA 1I94C 4A3GI 3PO3I 3S15I 3HOUI 1N33C 5IT9D 2F4MA 4QTUA 3GTMI 4A3II 1TWHI 5C3EI 1USPA 4XX2A 1I6HI 4LF4C 1HNWC 1IBKC 2RBLA 4B3TC 4DR6C 2UUAC 1WF3A 4A3JI 3VMHA 2E8FA 4GKKC 2E2II 3HOXI 5C4XI 1NYEA 2E8EA 4QTTA 2CY1A 2VQFC 2K5RA 2R92I 4DV1C 4B3SC 2VQEC 1K0RA 4A3MI 2HF1A 4DV5C 4LFCC 1LQLA 4AQYC 3K7AI 2F4OA 1J5EC 1RO4A 2JA5I 4NBAA 1XNQC 1DL6A 5IP7I 1IBLC 1RLYA 4BXXI 4YHHC 4NOZA 2NVXI 3RZOI 5CM2M 2E5LC 4KHPC 2OPLA 2UXCC 4NBGA 2KPIA 4LF9C 4DV3C 1IBMC 3R9XA 3T1HC 2UXBC 4BY7I 3M3YI 1L2FA 4NBHA 5IWAC 1USPB 4Y52I 4DR3C 2E2JI 2ATWA 2NVTI 3CJEA 2R7ZI 3PO2I 4DR4C 4JV5C 1N34C 4JI8C 4A3LI 4X65C 2F4VC 4Y7NI 2VUMI 1PA4A 3Q87A 3S1NI 3HOVI 2DE7A 2UUCC 3GTLI 3D6WA 3S1MI 3GTKI 3GTGI 2AKLA 1L1OC 1UKKA 4JI2C 2DE5A 2ONFA 3JAMD 5LMUC 3RZDI 3HOWI 4BBSI 2UU9C 3H3VJ 4BY1I 4LF6C 3I4MI 5BR8C 4NBCA 2OPLB 2JA7I 3S1QI 4DUYC 5FLMI 3GCFA 4DUZC 3S14I 4BSZA 4A93I 3EERA 3J80D 4GKJC 1XNRC 1K83I 1Y1VS 2J6AA 5C4JI 3S2DI 4DV0C 2XR1A 3S17I 4NXMC 2JA6I 1YUAA 1X3WA 3GTJI 1I3QI 2PK7A 5FLXD 4NBDA 3VMIA 1HNZC 3LUSA 4NB8A 4DR1C 4B3MC 3AF6A 3OTOC 2JA8I 4DR7C 4YY3C 2KZFA 3HOZI 2E7GA 5C44I 3S1RI 1MKYA 4LF8C 2ASBA 1N32C 3S16I 4DCUA 2JR6A 1HH2P 3H0GI 3GTOI 1R9TI 1KKGA 3VB9A 1NUIA 4DCSA 1WCMI 2NVYI 3GKUA 4NBBA 2NVQI 4X6AI 2HJGA 4JI1C 4MTNA 2PN2A 4X64C 4NB9A 1FJGC 1TWAI 2JS4A 2P3YA 1JOSA 4DCVA 5A2QD 1EGAA 2YU9I 2JNYA 3AF5A 1SFOI 3PO3S 4JI0C 3GKQA 4DV6C 2UXDC 2D7VA 1VLAA 1Y1WI 3GTMS 3CQZI 1QWIA 4A3EI 3T1YC 4LF5C 4DV2C 3IEVA 4JI3C 1WW9A 2ZM6C 3IEUA 1Y1VI 4JI7C 1WH9A 3S2HI 1ZB8A 5IP9I 4A3KI 4A3DI 1XMQC 2UUBC 3I07A
chains in the Genus database with same CATH superfamily
2W03A 2B63I 2R93I 4NDNA 1V26A 3B7WA 4DV7C 4NXNC 3H2TA 3F3FC 4A3FI 3ESWA 5FLXb 2QL8A 4PROC 1S7MA 3J81D 1I50I 4DCTA 2R6MA 4DV4C 2E2HI 2QRCB 1JJ2Y 1RO2A 3CCS1 1Q822 3CPWY 4LFBC 2BJOA 1S72Z 3GTPI 3CPWZ 4NFRA 1TWFI 5T67A 3M4OI 4OXIA 1X3ZA 2DE6A 4MXUA 2M48A 4NBEA 2PROA 4MD8A 3UEBA 4JI5C 5LL6f 1PFTA 3GR1A 4E2YA 2P2MA 2PM9A 4E30A 2V45A 1VQL1 3CC4Z 2YCBA 2LFUA 3MZKB 3C5EA 1V60A 4X66C 4NBFA 4LFAC 3UX2A 1ML8A 4OX9C 1QVFZ 2E7ZA 2E0GA 4ZLPA 1Y8CA 4JI4C 3G6E1 2P2QA 4BC7A 4B3RC 4A3BI 3CCV1 3FCCA 4DR5C 1N2FA 2EGTA 2RPRA 3S82A 2M5OA 4PZPA 1TWCI 1HR0C 4BBRI 1YJ7A 5BUSA 3CCJ1 4X62C 1YJN1 4JI6C 5LMNC 4LF7C 1Z01A 3I4NI 1WZNA 3U50C 4I9GA 3CXCZ 3RV2A 1AA6A 2O4HA 3HKZA 1PG3A 1YI2Z 2D1RA 1XMOC 4JYAC 1PU1A 2Q51A 1HNXC 1IB8A 3VMGA 2CU6A 2M5HA 4G37A 4YHHC 4EWCA 2VPZA 2Y0SA 3PBKA 2V8JA 3G4S1 1YUKA 1ZB9A 3FKII 3KIHA 5A2Qf 2HHHC 2M6NA 3R9WA 2QEX1 1VQ91 5K85A 1TWGI 2NAPA 2IZ4A 1Q821 3UOWA 2QRDB 5A19A 3CW8X 4E33A 1VQ71 2PT7G 2JMPA 4MH4A 5KYTA 1TFIA 4E2WA 3CCUZ 4K0KC 5AE2A 2PMZA 3GTQI 1QYPA 1Q862 3QWUA 3TE5B 1YIJZ 4A3CI 2DYJA 3HOYI 5E7QA 1K732 1N36C 4RVOA 2VPXA 3CCSZ 1M1K2 4IZ6A 3ETCA 1QF8A 2E8CA 4DR2C 3NFZA 3JAMb 5D1OA 1YIT1 2CXCA 5LCIA 1I94C 4A3GI 1VQN1 4E32A 3VTNA 4L7IA 2V8IA 3PO3I 3S15I 4HPVA 3HOUI 2QR1B 4RLQA 4TPSB 1N33C 1VQM1 4D56A 2YWBA 2VPYA 5IT9D 3IR7A 4GS5A 2F4MA 4QTUA 3GTMI 4A3II 1TWHI 5C3EI 1NJI2 1USPA 4RMNA 4XX2A 1ZH1A 1I6HI 1YHQ1 4LF4C 1RO0A 2V7BA 1HNWC 1IBKC 3G6EZ 3TQIA 3CCVZ 2RBLA 4B3TC 3L8CA 4DR6C 5IFIA 2UUAC 3CCJZ 4A3JI 1YJNZ 1WF3A 3J80b 3VMHA 2E8FA 4GKKC 2E2II 1VQP1 3HOXI 3N54B 5C4XI 5H9UA 2GTIA 1FDOA 4MRIA 1NYEA 1MD9A 2D28C 2E8EA 2VSQA 1Q861 4RV9A 3CCE1 2LEXA 3A4IA 4RVHA 4QTTA 2CY1A 3J81f 3G4SZ 2VQFC 4G1IA 2K5RA 2QW0X 1RY2A 1TH5A 2AYDA 1P4EA 1P9NA 1VQ9Z 2R92I 4ZJZA 1Q7Y1 3NYRA 1KRLA 5KEIA 1M1K1 3SO4A 2JIOA 1VQ7Z 4DV1C 2YADA 2D1QA 2QVYX 4B3SC 2VQEC 1K0RA 2JIQA 4A3MI 2HF1A 4DV5C 4LFCC 3IF8A 1LQLA 1O9TA 4HGYA 1BA3A 4AQYC 4ODJA 4OYCA 4NXMC 3K7AI 2OOXB 2WB1A 2F4OA 3LNOA 1J5EC 1RO4A 2JA5I 3PROC 1NJI1 4NBAA 2GTHA 1DL6A 1XNQC 1O90A 5IP7I 4ISBA 1YITZ 3IMLA 1RQFA 3J7A4 1VQNZ 1O92A 3VNSA 1IBLC 1RLYA 4BXXI 3E7XA 4NOZA 4DGLA 2Y27A 2NVXI 1VQ51 3RZOI 3EQ6A 5CM2M 2E5LC 4KHPC 1VQMZ 4D57A 2OPLA 2UXCC 2LIYA 1VQ41 4FUTA 3UZ0A 4NBGA 1QVFY 5JRHA 2KPIA 5D1OB 3G711 2ZZMA 1PG4A 4NH1C 1YHQZ 1K9M2 3I561 2OBVA 4LF9C 4BBYA 4DV3C 4DG8A 1IBMC 3R9XA 1MXBA 3D9XA 3T1HC 2UXBC 1VEHA 3NH8A 1QM4A 4BY7I 1WJ2A 3CXCY 3CQ2A 3M3YI 2P02A 1L2FA 4NBHA 3VNQA 3P5JB 4DG9A 4FTFA 5IWAC 1USPB 4Y52I 3BG0B 4R1LA 4DR3C 2RT9A 2KDNA 1SIWA 2QREB 2E2JI 3RG2A 1M6XA 2ATWA 2NVTI 3CJEA 2R7ZI 3NYQA 4PUHA 3CCEZ 3PO2I 1FUGA 4K0BA 4RVGA 5DV9A 4DR4C 3ETOA 1XS3A 1P4EC 3I08A 3A26A 4JV5C 1RG9A 1N34C 4JI8C 3IX0A 4A3LI 4X65C 2ZZNA 2F4VC 4MONA 4Y7NI 3LAXA 2IZ3A 2VUMI 3CCR1 3NI2A 1PA4A 5BURA 1FLOA 3AY0A 3Q87A 3S1NI 3CMA1 3NDIA 5CZXA 1YJW1 1Q7Y2 5A2Qb 3PESA 4R0MA 3CC71 2DE7A 3HOVI 3DHVA 1P7LA 5IT9f 2O53A 1Q812 2P28A 2UUCC 4CL1A 1VQ81 3GTLI 3D6WA 4HGZA 1K9M1 5D1PA 1MDBA 5CZVA 3TR3A 3S1MI 2JMOA 3CC21 3GTKI 3VNRA 3GTGI 3L95X 2AKLA 2VUGA 1VQLZ 3GPCA 2E9HA 1VQ5Z 4MD9A 1L1OC 1UKKA 3IPLA 4GXQA 1MXCA 5A1GA 2DE5A 4JI2C 1QXFA 2ONFA 5AE1A 3JAMD 5LMUC 1VQ4Z 4WV3A 3RZDI 3G71Z 3HOWI 3CW9A 2Z51A 1T5HX 2KZ0A 4BBSI 5KYVA 2UU9C 3H3VJ 4BY1I 1W2BZ 3I56Z 1KQSY 4LF6C 4TNUA 1Z03A 4AYBA 1KQSZ 3LNVA 3O2EA 3FCEA 3I4MI 5BR8C 4NBCA 2OPLB 2JA7I 3S1QI 4DUYC 1T5DX 2VPWA 2I3CA 2YX1A 1QVGY 4G36A 1XRAA 4KTVA 2V8KA 1QVGZ 5FLMI 1WIIA 5A1IA 4DK1A 1KC82 3GCFA 3CCQ1 4DUZC 3S14I 4BSZA 4A93I 2JNVA 3EERA 3J80D 4GKJC 1XNRC 2IV2X 2QEXZ 2BH1X 2JIMA 3CQ3A 2OOYB 2P2FA 4KTTA 1K83I 4U5YD 3OW2Y 1Q811 1Y1VS 4D4GA 4PUGA 3OW2Z 1VQ61 1ULTA 2J6AA 3CCM1 3CCRZ 2D1TA 5C4JI 4LE5A 3S2DI 4DV0C 2P2JA 2XR1A 2Q4ZA 2RIQA 5BSVA 3CMAZ 3EEDA 1YJ91 3S17I 5T8SA 2JA6I 1YUAA 1X3WA 5AN9F 3J81b 4GXRA 1GPMA 3GTJI 1I3QI 2PK7A 3CC7Z 1Z02A 3E7WA 4JM1A 5FLXD 4NBDA 3VMIA 1HNZC 1VQ8Z 2QLVB 3LUSA 3CC2Z 4NB8A 3CQ1A 1YIJ1 1K8A2 4RVNA 2NCLA 4DR1C 4B3MC 3G7SA 4E2ZA 3AF6A 2OTL1 2JA8I 3OTOC 5T6BA 4DR7C 4YY3C 2KZFA 4D4IA 4S1TA 3TDEA 3HOZI 4EATA 1JJ2Z 3NH4A 4PUIA 2ZAEB 2MMAB 2E7GA 5C44I 3S1RI 1RNIA 1KC81 1MKYA 4LF8C 1N8R2 3I551 1JWHC 4L4QA 2ASBA 1N32C 3F3PC 5ADZA 1AMUA 5BUQA 2GU2A 1WCJA 2P20A 3S16I 4DCUA 4RM3A 4WS9A 1LCIA 2JR6A 1HH2P 4RM2A 1VQPZ 5BSUA 3H0GI 5BSWA 1KD11 1VQO1 2OO4A 3GTOI 2DPLA 1R9TI 3CCQZ 5BSTA 2QA41 3CD61 3IFUA 5BSMA 5BSRA 1KKGA 2H85A 3VB9A 1NUIA 4DCSA 4PHTA 1WCMI 1XHJA 4RS4A 2NVYI 3GKUA 4IR7A 4E31A 4NBBA 1VQ6Z 3CCMZ 4E2XA 3CCL1 2NVQI 4X6AI 2HJGA 2OZKA 1K8A1 1VQK1 3NH5A 3CME1 1FDIA 1MXAA 2K3RA 2VF1A 3T4NB 4JI1C 3K6RA 1YJ9Z 2OTJ1 3JAMf 4MTNA 2PN2A 4X64C 2JUBA 4NB9A 1FJGC 4MD7A 1TWAI 2MM9A 2WP0C 2JS4A 2G2KA 2P2BA 3N2QA 1N8R1 1NY8A 2P3YA 3A25A 3BG1B 1JOSA 3NDJA 2Y4NA 4DCVA 5A2QD 2MCQA 4L2ZA 3DAYA 1M902 3FQMA 2OTLZ 4BCAA 1S721 2QVXX 4R1MA 2QKDA 2WAQA 1Q16A 1EGAA 4HH4A 2YU9I 2JNYA 1UWDA 3MONA 1W2BY 5IT9b 3AF5A 2HU9A 1SFOI 4RVFA 4DQYB 3PO3S 3I55Z 2VZEA 4JI0C 1O93A 5AE3A 3GKQA 3CC41 1MDFA 4DV6C 2UXDC 2D7VA 3J80f 3LGXA 4I9FA 3KIFA 1VLAA 1Y1WI 2QVZX 3GTMS 3CQZI 2YWCA 5GTDA 1M6XC 1QWIA 3TDHB 4A3EI 1VQOZ 2DHMA 2RHBA 3T1YC 4LF5C 3DLPX 3KXWA 3A9VA 4DV2C 3IEVA 4RVDA 2JIPA 4JI3C 3TUFA 1WW9A 4FUQA 2QA4Z 3CD6Z 3NPDA 3GR0A 3FQQA 1XRCA 2AYAA 2ZM6C 5T8TA 2D1SA 3IEUA 1NP6A 1YI21 2KI7B 1KD12 1Y1VI 4JI7C 5T64A 1WH9A 2WD9A 5FLXf 3S2HI 1X0TA 3R44A 1ZB8A 2V3VA 5IP9I 4A3KI 4RLFA 3CCLZ 4A3DI 5K8FA 1XMQC 2UUBC 2Y4OA 4BC9A 2D27A 1XRBA 1VQKZ 1M901 1V25A 3I07A 1YJWZ 2JIRA 2W04A 3CMEZ 1K731 3UX3A 3MZLB 3D2LA 2OTJZ 3A9UA 3CCU1
chains in the Genus database with same CATH topology
2W03A 2B63I 2R93I 4NDNA 1V26A 3B7WA 4DV7C 4NXNC 3H2TA 3F3FC 4A3FI 3ESWA 5FLXb 2QL8A 4PROC 1S7MA 3J81D 1I50I 4DCTA 2R6MA 4DV4C 2E2HI 2QRCB 1JJ2Y 1RO2A 3CCS1 1Q822 3CPWY 4LFBC 2BJOA 1S72Z 3GTPI 3CPWZ 4NFRA 1TWFI 5T67A 3M4OI 4OXIA 1X3ZA 2DE6A 4MXUA 2M48A 4NBEA 2PROA 4MD8A 4JI5C 5LL6f 1PFTA 3GR1A 4E2YA 2P2MA 2PM9A 4E30A 1VQL1 3CC4Z 2YCBA 2LFUA 3MZKB 3C5EA 4X66C 4NBFA 4LFAC 1ML8A 4OX9C 1QVFZ 2E0GA 4ZLPA 4JI4C 3G6E1 2P2QA 4BC7A 4B3RC 4A3BI 3CCV1 3FCCA 4DR5C 1N2FA 2EGTA 2RPRA 3S82A 4PZPA 1TWCI 1HR0C 4BBRI 1YJ7A 5BUSA 3CCJ1 4X62C 1YJN1 4JI6C 5LMNC 4LF7C 1Z01A 3I4NI 3U50C 4I9GA 3CXCZ 3RV2A 2O4HA 3HKZA 1PG3A 1YI2Z 2D1RA 1XMOC 4JYAC 2Q51A 1HNXC 3VMGA 4YHHC 4G37A 4EWCA 2Y0SA 3PBKA 2V8JA 3G4S1 1YUKA 1ZB9A 3FKII 3KIHA 5A2Qf 2HHHC 2M6NA 3R9WA 2QEX1 1VQ91 5K85A 1TWGI 2IZ4A 1Q821 3UOWA 2QRDB 5A19A 3CW8X 4E33A 1VQ71 2PT7G 2JMPA 4MH4A 5KYTA 1TFIA 4E2WA 3CCUZ 4K0KC 5AE2A 2PMZA 3GTQI 1QYPA 1Q862 3QWUA 3TE5B 1YIJZ 4A3CI 2DYJA 3HOYI 5E7QA 1K732 1N36C 4RVOA 3CCSZ 1M1K2 4IZ6A 3ETCA 1QF8A 2E8CA 4DR2C 3NFZA 3JAMb 5D1OA 1YIT1 2CXCA 1I94C 4A3GI 1VQN1 4E32A 3VTNA 4L7IA 2V8IA 3PO3I 3S15I 4HPVA 3HOUI 2QR1B 4RLQA 4TPSB 1N33C 1VQM1 4D56A 2YWBA 5IT9D 4GS5A 2F4MA 4QTUA 3GTMI 4A3II 1TWHI 5C3EI 1NJI2 1USPA 4RMNA 4XX2A 1ZH1A 1I6HI 1YHQ1 4LF4C 1RO0A 2V7BA 1HNWC 1IBKC 3G6EZ 3TQIA 3CCVZ 2RBLA 4B3TC 4DR6C 5IFIA 2UUAC 3CCJZ 4A3JI 1YJNZ 1WF3A 3J80b 3VMHA 2E8FA 4GKKC 2E2II 1VQP1 3HOXI 3N54B 5C4XI 5H9UA 2GTIA 4MRIA 1NYEA 1MD9A 2D28C 2E8EA 2VSQA 1Q861 4RV9A 3CCE1 3A4IA 4RVHA 4QTTA 2CY1A 3J81f 3G4SZ 2VQFC 4G1IA 2K5RA 2QW0X 1RY2A 1P9NA 1VQ9Z 2R92I 4ZJZA 1Q7Y1 3NYRA 1KRLA 5KEIA 1M1K1 3SO4A 1VQ7Z 4DV1C 2YADA 2D1QA 2QVYX 4B3SC 2VQEC 1K0RA 4A3MI 2HF1A 4DV5C 4LFCC 3IF8A 1LQLA 1O9TA 4HGYA 1BA3A 4AQYC 4ODJA 4OYCA 4NXMC 3K7AI 2OOXB 2WB1A 2F4OA 1J5EC 1RO4A 2JA5I 3PROC 1NJI1 4NBAA 2GTHA 1DL6A 1XNQC 1O90A 5IP7I 4ISBA 1YITZ 3IMLA 1RQFA 3J7A4 1VQNZ 1O92A 3VNSA 1IBLC 1RLYA 4BXXI 3E7XA 4NOZA 4DGLA 2Y27A 2NVXI 1VQ51 3RZOI 3EQ6A 5CM2M 2E5LC 4KHPC 1VQMZ 4D57A 2OPLA 2UXCC 2LIYA 1VQ41 4FUTA 3UZ0A 4NBGA 1QVFY 5JRHA 2KPIA 5D1OB 3G711 1PG4A 4NH1C 1YHQZ 1K9M2 3I561 2OBVA 4LF9C 4BBYA 4DV3C 4DG8A 1IBMC 3R9XA 1MXBA 3D9XA 3T1HC 2UXBC 3NH8A 1QM4A 4BY7I 3CXCY 3M3YI 2P02A 1L2FA 4NBHA 3VNQA 3P5JB 4DG9A 4FTFA 5IWAC 1USPB 4Y52I 3BG0B 4R1LA 4DR3C 2RT9A 2QREB 2E2JI 3RG2A 2ATWA 2NVTI 3CJEA 2R7ZI 3NYQA 3CCEZ 3PO2I 1FUGA 4K0BA 4RVGA 5DV9A 4DR4C 3ETOA 3I08A 4JV5C 1RG9A 1N34C 4JI8C 3IX0A 4A3LI 4X65C 2F4VC 4MONA 4Y7NI 3LAXA 2IZ3A 2VUMI 3CCR1 3NI2A 1PA4A 5BURA 3Q87A 3S1NI 3CMA1 3NDIA 5CZXA 1YJW1 1Q7Y2 5A2Qb 3PESA 4R0MA 3CC71 2DE7A 3HOVI 3DHVA 1P7LA 5IT9f 2O53A 1Q812 2P28A 2UUCC 4CL1A 1VQ81 3GTLI 3D6WA 4HGZA 1K9M1 5D1PA 1MDBA 5CZVA 3S1MI 2JMOA 3CC21 3GTKI 3VNRA 3GTGI 3L95X 2AKLA 2VUGA 1VQLZ 3GPCA 2E9HA 1VQ5Z 4MD9A 1L1OC 1UKKA 3IPLA 4GXQA 1MXCA 5A1GA 2DE5A 4JI2C 2ONFA 5AE1A 3JAMD 5LMUC 1VQ4Z 4WV3A 3RZDI 3G71Z 3HOWI 3CW9A 1T5HX 4BBSI 5KYVA 2UU9C 3H3VJ 4BY1I 1W2BZ 3I56Z 1KQSY 4LF6C 4TNUA 1Z03A 4AYBA 1KQSZ 3LNVA 3FCEA 3I4MI 5BR8C 4NBCA 2OPLB 2JA7I 3S1QI 4DUYC 1T5DX 2I3CA 1QVGY 4G36A 1XRAA 4KTVA 2V8KA 1QVGZ 5FLMI 1WIIA 5A1IA 4DK1A 1KC82 3GCFA 3CCQ1 4DUZC 3S14I 4BSZA 4A93I 3EERA 3J80D 4GKJC 1XNRC 2QEXZ 2BH1X 2OOYB 2P2FA 4KTTA 1K83I 4U5YD 3OW2Y 1Q811 1Y1VS 4D4GA 3OW2Z 1VQ61 1ULTA 2J6AA 3CCM1 3CCRZ 2D1TA 5C4JI 4LE5A 3S2DI 4DV0C 2P2JA 2XR1A 2Q4ZA 2RIQA 5BSVA 3CMAZ 3EEDA 1YJ91 3S17I 5T8SA 2JA6I 1YUAA 1X3WA 5AN9F 3J81b 4GXRA 1GPMA 3GTJI 1I3QI 2PK7A 3CC7Z 1Z02A 3E7WA 4JM1A 5FLXD 4NBDA 3VMIA 1HNZC 1VQ8Z 2QLVB 3LUSA 3CC2Z 4NB8A 1YIJ1 1K8A2 4RVNA 4DR1C 4B3MC 3G7SA 4E2ZA 3AF6A 2OTL1 2JA8I 3OTOC 5T6BA 4DR7C 4YY3C 2KZFA 4D4IA 4S1TA 3TDEA 3HOZI 4EATA 1JJ2Z 3NH4A 2ZAEB 2E7GA 5C44I 3S1RI 1RNIA 1KC81 1MKYA 4LF8C 1N8R2 3I551 1JWHC 4L4QA 2ASBA 1N32C 3F3PC 5ADZA 1AMUA 5BUQA 2GU2A 2P20A 3S16I 4DCUA 4RM3A 4WS9A 1LCIA 2JR6A 1HH2P 4RM2A 1VQPZ 5BSUA 3H0GI 5BSWA 1KD11 1VQO1 2OO4A 3GTOI 2DPLA 1R9TI 3CCQZ 5BSTA 2QA41 3CD61 3IFUA 5BSMA 5BSRA 1KKGA 2H85A 3VB9A 1NUIA 4DCSA 4PHTA 1WCMI 4RS4A 2NVYI 3GKUA 4IR7A 4E31A 4NBBA 1VQ6Z 3CCMZ 4E2XA 3CCL1 2NVQI 4X6AI 2HJGA 2OZKA 1K8A1 1VQK1 3NH5A 3CME1 1MXAA 2K3RA 2VF1A 3T4NB 4JI1C 1YJ9Z 2OTJ1 3JAMf 4MTNA 2PN2A 4X64C 2JUBA 4NB9A 1FJGC 4MD7A 1TWAI 2WP0C 3N2QA 2JS4A 2G2KA 2P2BA 1N8R1 2P3YA 3BG1B 1JOSA 3NDJA 2Y4NA 4DCVA 5A2QD 4L2ZA 3DAYA 1M902 3FQMA 2OTLZ 4BCAA 1S721 2QVXX 4R1MA 2QKDA 2WAQA 1EGAA 4HH4A 2YU9I 2JNYA 3MONA 1W2BY 5IT9b 3AF5A 2HU9A 1SFOI 4RVFA 4DQYB 3PO3S 3I55Z 2VZEA 4JI0C 1O93A 5AE3A 3GKQA 3CC41 1MDFA 4DV6C 2UXDC 2D7VA 3J80f 3LGXA 4I9FA 3KIFA 1VLAA 1Y1WI 2QVZX 3GTMS 3CQZI 2YWCA 5GTDA 1QWIA 1VQOZ 3TDHB 4A3EI 2RHBA 3T1YC 4LF5C 3DLPX 3KXWA 3A9VA 4DV2C 3IEVA 4RVDA 4JI3C 3TUFA 1WW9A 4FUQA 2QA4Z 3CD6Z 3NPDA 3GR0A 3FQQA 1XRCA 2AYAA 2ZM6C 5T8TA 2D1SA 3IEUA 1NP6A 1YI21 2KI7B 1KD12 1Y1VI 4JI7C 5T64A 1WH9A 2WD9A 5FLXf 3S2HI 1X0TA 3R44A 1ZB8A 5IP9I 4A3KI 4RLFA 3CCLZ 4A3DI 5K8FA 1XMQC 2UUBC 2Y4OA 4BC9A 2D27A 1XRBA 1VQKZ 1M901 1V25A 3I07A 1YJWZ 2W04A 3CMEZ 1K731 3MZLB 3L8CA 2OTJZ 3A9UA 3CCU1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B63 I;  2R93 I;  4DV7 C;  4NXN C;  4A3F I;  3ESW A;  2QL8 A;  3J81 D;  1I50 I;  4DCT A;  4DV4 C;  2E2H I;  4LFB C;  2BJO A;  3GTP I;  1TWF I;  3M4O I;  1X3Z A;  2DE6 A;  4NBE A;  4JI5 C;  1PFT A;  2YCB A;  4X66 C;  4NBF A;  4LFA C;  1ML8 A;  4OX9 C;  4JI4 C;  4B3R C;  4A3B I;  4DR5 C;  1N2F A;  2EGT A;  1TWC I;  1HR0 C;  4BBR I;  4X62 C;  4JI6 C;  5LMN C;  4LF7 C;  3I4N I;  3U50 C;  1XMO C;  4JYA C;  1HNX C;  3VMG A;  1ZB9 A;  3FKI I;  2HHH C;  3R9W A;  1TWG I;  2PT7 G;  2JMP A;  4MH4 A;  1TFI A;  4K0K C;  3GTQ I;  1QYP A;  2DYJ A;  4A3C I;  3HOY I;  1N36 C;  2E8C A;  4DR2 C;  2CXC A;  1I94 C;  4A3G I;  3PO3 I;  3S15 I;  3HOU I;  1N33 C;  5IT9 D;  2F4M A;  4QTU A;  3GTM I;  4A3I I;  1TWH I;  5C3E I;  1USP A;  4XX2 A;  1I6H I;  4LF4 C;  1HNW C;  1IBK C;  2RBL A;  4B3T C;  4DR6 C;  2UUA C;  1WF3 A;  4A3J I;  3VMH A;  2E8F A;  4GKK C;  2E2I I;  3HOX I;  5C4X I;  1NYE A;  2E8E A;  4QTT A;  2CY1 A;  2VQF C;  2K5R A;  2R92 I;  4DV1 C;  4B3S C;  2VQE C;  1K0R A;  4A3M I;  2HF1 A;  4DV5 C;  4LFC C;  1LQL A;  4AQY C;  3K7A I;  2F4O A;  1J5E C;  1RO4 A;  2JA5 I;  4NBA A;  1XNQ C;  1DL6 A;  5IP7 I;  1IBL C;  1RLY A;  4BXX I;  4YHH C;  4NOZ A;  2NVX I;  3RZO I;  5CM2 M;  2E5L C;  4KHP C;  2OPL A;  2UXC C;  4NBG A;  2KPI A;  4LF9 C;  4DV3 C;  1IBM C;  3R9X A;  3T1H C;  2UXB C;  4BY7 I;  3M3Y I;  1L2F A;  4NBH A;  5IWA C;  1USP B;  4Y52 I;  4DR3 C;  2E2J I;  2ATW A;  2NVT I;  3CJE A;  2R7Z I;  3PO2 I;  4DR4 C;  4JV5 C;  1N34 C;  4JI8 C;  4A3L I;  4X65 C;  2F4V C;  4Y7N I;  2VUM I;  1PA4 A;  3Q87 A;  3S1N I;  3HOV I;  2DE7 A;  2UUC C;  3GTL I;  3D6W A;  3S1M I;  3GTK I;  3GTG I;  2AKL A;  1L1O C;  1UKK A;  4JI2 C;  2DE5 A;  2ONF A;  3JAM D;  5LMU C;  3RZD I;  3HOW I;  4BBS I;  2UU9 C;  3H3V J;  4BY1 I;  4LF6 C;  3I4M I;  5BR8 C;  4NBC A;  2OPL B;  2JA7 I;  3S1Q I;  4DUY C;  5FLM I;  3GCF A;  4DUZ C;  3S14 I;  4BSZ A;  4A93 I;  3EER A;  3J80 D;  4GKJ C;  1XNR C;  1K83 I;  1Y1V S;  2J6A A;  5C4J I;  3S2D I;  4DV0 C;  2XR1 A;  3S17 I;  4NXM C;  2JA6 I;  1YUA A;  1X3W A;  3GTJ I;  1I3Q I;  2PK7 A;  5FLX D;  4NBD A;  3VMI A;  1HNZ C;  3LUS A;  4NB8 A;  4DR1 C;  4B3M C;  3AF6 A;  3OTO C;  2JA8 I;  4DR7 C;  4YY3 C;  2KZF A;  3HOZ I;  2E7G A;  5C44 I;  3S1R I;  1MKY A;  4LF8 C;  2ASB A;  1N32 C;  3S16 I;  4DCU A;  2JR6 A;  1HH2 P;  3H0G I;  3GTO I;  1R9T I;  1KKG A;  3VB9 A;  1NUI A;  4DCS A;  1WCM I;  2NVY I;  3GKU A;  4NBB A;  2NVQ I;  4X6A I;  2HJG A;  4JI1 C;  4MTN A;  2PN2 A;  4X64 C;  4NB9 A;  1FJG C;  1TWA I;  2JS4 A;  2P3Y A;  1JOS A;  4DCV A;  5A2Q D;  1EGA A;  2YU9 I;  2JNY A;  3AF5 A;  1SFO I;  3PO3 S;  4JI0 C;  3GKQ A;  4DV6 C;  2UXD C;  2D7V A;  1VLA A;  1Y1W I;  3GTM S;  3CQZ I;  1QWI A;  4A3E I;  3T1Y C;  4LF5 C;  4DV2 C;  3IEV A;  4JI3 C;  1WW9 A;  2ZM6 C;  3IEU A;  1Y1V I;  4JI7 C;  1WH9 A;  3S2H I;  1ZB8 A;  5IP9 I;  4A3K I;  4A3D I;  1XMQ C;  2UUB C;  3I07 A; 
#chains in the Genus database with same CATH topology
 2W03 A;  2B63 I;  2R93 I;  4NDN A;  1V26 A;  3B7W A;  4DV7 C;  4NXN C;  3H2T A;  3F3F C;  4A3F I;  3ESW A;  5FLX b;  2QL8 A;  4PRO C;  1S7M A;  3J81 D;  1I50 I;  4DCT A;  2R6M A;  4DV4 C;  2E2H I;  2QRC B;  1JJ2 Y;  1RO2 A;  3CCS 1;  1Q82 2;  3CPW Y;  4LFB C;  2BJO A;  1S72 Z;  3GTP I;  3CPW Z;  4NFR A;  1TWF I;  5T67 A;  3M4O I;  4OXI A;  1X3Z A;  2DE6 A;  4MXU A;  2M48 A;  4NBE A;  2PRO A;  4MD8 A;  3UEB A;  4JI5 C;  5LL6 f;  1PFT A;  3GR1 A;  4E2Y A;  2P2M A;  2PM9 A;  4E30 A;  2V45 A;  1VQL 1;  3CC4 Z;  2YCB A;  2LFU A;  3MZK B;  3C5E A;  1V60 A;  4X66 C;  4NBF A;  4LFA C;  3UX2 A;  1ML8 A;  4OX9 C;  1QVF Z;  2E7Z A;  2E0G A;  4ZLP A;  1Y8C A;  4JI4 C;  3G6E 1;  2P2Q A;  4BC7 A;  4B3R C;  4A3B I;  3CCV 1;  3FCC A;  4DR5 C;  1N2F A;  2EGT A;  2RPR A;  3S82 A;  2M5O A;  4PZP A;  1TWC I;  1HR0 C;  4BBR I;  1YJ7 A;  5BUS A;  3CCJ 1;  4X62 C;  1YJN 1;  4JI6 C;  5LMN C;  4LF7 C;  1Z01 A;  3I4N I;  1WZN A;  3U50 C;  4I9G A;  3CXC Z;  3RV2 A;  1AA6 A;  2O4H A;  3HKZ A;  1PG3 A;  1YI2 Z;  2D1R A;  1XMO C;  4JYA C;  1PU1 A;  2Q51 A;  1HNX C;  1IB8 A;  3VMG A;  2CU6 A;  2M5H A;  4G37 A;  4YHH C;  4EWC A;  2VPZ A;  2Y0S A;  3PBK A;  2V8J A;  3G4S 1;  1YUK A;  1ZB9 A;  3FKI I;  3KIH A;  5A2Q f;  2HHH C;  2M6N A;  3R9W A;  2QEX 1;  1VQ9 1;  5K85 A;  1TWG I;  2NAP A;  2IZ4 A;  1Q82 1;  3UOW A;  2QRD B;  5A19 A;  3CW8 X;  4E33 A;  1VQ7 1;  2PT7 G;  2JMP A;  4MH4 A;  5KYT A;  1TFI A;  4E2W A;  3CCU Z;  4K0K C;  5AE2 A;  2PMZ A;  3GTQ I;  1QYP A;  1Q86 2;  3QWU A;  3TE5 B;  1YIJ Z;  4A3C I;  2DYJ A;  3HOY I;  5E7Q A;  1K73 2;  1N36 C;  4RVO A;  2VPX A;  3CCS Z;  1M1K 2;  4IZ6 A;  3ETC A;  1QF8 A;  2E8C A;  4DR2 C;  3NFZ A;  3JAM b;  5D1O A;  1YIT 1;  2CXC A;  5LCI A;  1I94 C;  4A3G I;  1VQN 1;  4E32 A;  3VTN A;  4L7I A;  2V8I A;  3PO3 I;  3S15 I;  4HPV A;  3HOU I;  2QR1 B;  4RLQ A;  4TPS B;  1N33 C;  1VQM 1;  4D56 A;  2YWB A;  2VPY A;  5IT9 D;  3IR7 A;  4GS5 A;  2F4M A;  4QTU A;  3GTM I;  4A3I I;  1TWH I;  5C3E I;  1NJI 2;  1USP A;  4RMN A;  4XX2 A;  1ZH1 A;  1I6H I;  1YHQ 1;  4LF4 C;  1RO0 A;  2V7B A;  1HNW C;  1IBK C;  3G6E Z;  3TQI A;  3CCV Z;  2RBL A;  4B3T C;  3L8C A;  4DR6 C;  5IFI A;  2UUA C;  3CCJ Z;  4A3J I;  1YJN Z;  1WF3 A;  3J80 b;  3VMH A;  2E8F A;  4GKK C;  2E2I I;  1VQP 1;  3HOX I;  3N54 B;  5C4X I;  5H9U A;  2GTI A;  1FDO A;  4MRI A;  1NYE A;  1MD9 A;  2D28 C;  2E8E A;  2VSQ A;  1Q86 1;  4RV9 A;  3CCE 1;  2LEX A;  3A4I A;  4RVH A;  4QTT A;  2CY1 A;  3J81 f;  3G4S Z;  2VQF C;  4G1I A;  2K5R A;  2QW0 X;  1RY2 A;  1TH5 A;  2AYD A;  1P4E A;  1P9N A;  1VQ9 Z;  2R92 I;  4ZJZ A;  1Q7Y 1;  3NYR A;  1KRL A;  5KEI A;  1M1K 1;  3SO4 A;  2JIO A;  1VQ7 Z;  4DV1 C;  2YAD A;  2D1Q A;  2QVY X;  4B3S C;  2VQE C;  1K0R A;  2JIQ A;  4A3M I;  2HF1 A;  4DV5 C;  4LFC C;  3IF8 A;  1LQL A;  1O9T A;  4HGY A;  1BA3 A;  4AQY C;  4ODJ A;  4OYC A;  4NXM C;  3K7A I;  2OOX B;  2WB1 A;  2F4O A;  3LNO A;  1J5E C;  1RO4 A;  2JA5 I;  3PRO C;  1NJI 1;  4NBA A;  2GTH A;  1DL6 A;  1XNQ C;  1O90 A;  5IP7 I;  4ISB A;  1YIT Z;  3IML A;  1RQF A;  3J7A 4;  1VQN Z;  1O92 A;  3VNS A;  1IBL C;  1RLY A;  4BXX I;  3E7X A;  4NOZ A;  4DGL A;  2Y27 A;  2NVX I;  1VQ5 1;  3RZO I;  3EQ6 A;  5CM2 M;  2E5L C;  4KHP C;  1VQM Z;  4D57 A;  2OPL A;  2UXC C;  2LIY A;  1VQ4 1;  4FUT A;  3UZ0 A;  4NBG A;  1QVF Y;  5JRH A;  2KPI A;  5D1O B;  3G71 1;  2ZZM A;  1PG4 A;  4NH1 C;  1YHQ Z;  1K9M 2;  3I56 1;  2OBV A;  4LF9 C;  4BBY A;  4DV3 C;  4DG8 A;  1IBM C;  3R9X A;  1MXB A;  3D9X A;  3T1H C;  2UXB C;  1VEH A;  3NH8 A;  1QM4 A;  4BY7 I;  1WJ2 A;  3CXC Y;  3CQ2 A;  3M3Y I;  2P02 A;  1L2F A;  4NBH A;  3VNQ A;  3P5J B;  4DG9 A;  4FTF A;  5IWA C;  1USP B;  4Y52 I;  3BG0 B;  4R1L A;  4DR3 C;  2RT9 A;  2KDN A;  1SIW A;  2QRE B;  2E2J I;  3RG2 A;  1M6X A;  2ATW A;  2NVT I;  3CJE A;  2R7Z I;  3NYQ A;  4PUH A;  3CCE Z;  3PO2 I;  1FUG A;  4K0B A;  4RVG A;  5DV9 A;  4DR4 C;  3ETO A;  1XS3 A;  1P4E C;  3I08 A;  3A26 A;  4JV5 C;  1RG9 A;  1N34 C;  4JI8 C;  3IX0 A;  4A3L I;  4X65 C;  2ZZN A;  2F4V C;  4MON A;  4Y7N I;  3LAX A;  2IZ3 A;  2VUM I;  3CCR 1;  3NI2 A;  1PA4 A;  5BUR A;  1FLO A;  3AY0 A;  3Q87 A;  3S1N I;  3CMA 1;  3NDI A;  5CZX A;  1YJW 1;  1Q7Y 2;  5A2Q b;  3PES A;  4R0M A;  3CC7 1;  2DE7 A;  3HOV I;  3DHV A;  1P7L A;  5IT9 f;  2O53 A;  1Q81 2;  2P28 A;  2UUC C;  4CL1 A;  1VQ8 1;  3GTL I;  3D6W A;  4HGZ A;  1K9M 1;  5D1P A;  1MDB A;  5CZV A;  3TR3 A;  3S1M I;  2JMO A;  3CC2 1;  3GTK I;  3VNR A;  3GTG I;  3L95 X;  2AKL A;  2VUG A;  1VQL Z;  3GPC A;  2E9H A;  1VQ5 Z;  4MD9 A;  1L1O C;  1UKK A;  3IPL A;  4GXQ A;  1MXC A;  5A1G A;  2DE5 A;  4JI2 C;  1QXF A;  2ONF A;  5AE1 A;  3JAM D;  5LMU C;  1VQ4 Z;  4WV3 A;  3RZD I;  3G71 Z;  3HOW I;  3CW9 A;  2Z51 A;  1T5H X;  2KZ0 A;  4BBS I;  5KYV A;  2UU9 C;  3H3V J;  4BY1 I;  1W2B Z;  3I56 Z;  1KQS Y;  4LF6 C;  4TNU A;  1Z03 A;  4AYB A;  1KQS Z;  3LNV A;  3O2E A;  3FCE A;  3I4M I;  5BR8 C;  4NBC A;  2OPL B;  2JA7 I;  3S1Q I;  4DUY C;  1T5D X;  2VPW A;  2I3C A;  2YX1 A;  1QVG Y;  4G36 A;  1XRA A;  4KTV A;  2V8K A;  1QVG Z;  5FLM I;  1WII A;  5A1I A;  4DK1 A;  1KC8 2;  3GCF A;  3CCQ 1;  4DUZ C;  3S14 I;  4BSZ A;  4A93 I;  2JNV A;  3EER A;  3J80 D;  4GKJ C;  1XNR C;  2IV2 X;  2QEX Z;  2BH1 X;  2JIM A;  3CQ3 A;  2OOY B;  2P2F A;  4KTT A;  1K83 I;  4U5Y D;  3OW2 Y;  1Q81 1;  1Y1V S;  4D4G A;  4PUG A;  3OW2 Z;  1VQ6 1;  1ULT A;  2J6A A;  3CCM 1;  3CCR Z;  2D1T A;  5C4J I;  4LE5 A;  3S2D I;  4DV0 C;  2P2J A;  2XR1 A;  2Q4Z A;  2RIQ A;  5BSV A;  3CMA Z;  3EED A;  1YJ9 1;  3S17 I;  5T8S A;  2JA6 I;  1YUA A;  1X3W A;  5AN9 F;  3J81 b;  4GXR A;  1GPM A;  3GTJ I;  1I3Q I;  2PK7 A;  3CC7 Z;  1Z02 A;  3E7W A;  4JM1 A;  5FLX D;  4NBD A;  3VMI A;  1HNZ C;  1VQ8 Z;  2QLV B;  3LUS A;  3CC2 Z;  4NB8 A;  3CQ1 A;  1YIJ 1;  1K8A 2;  4RVN A;  2NCL A;  4DR1 C;  4B3M C;  3G7S A;  4E2Z A;  3AF6 A;  2OTL 1;  2JA8 I;  3OTO C;  5T6B A;  4DR7 C;  4YY3 C;  2KZF A;  4D4I A;  4S1T A;  3TDE A;  3HOZ I;  4EAT A;  1JJ2 Z;  3NH4 A;  4PUI A;  2ZAE B;  2MMA B;  2E7G A;  5C44 I;  3S1R I;  1RNI A;  1KC8 1;  1MKY A;  4LF8 C;  1N8R 2;  3I55 1;  1JWH C;  4L4Q A;  2ASB A;  1N32 C;  3F3P C;  5ADZ A;  1AMU A;  5BUQ A;  2GU2 A;  1WCJ A;  2P20 A;  3S16 I;  4DCU A;  4RM3 A;  4WS9 A;  1LCI A;  2JR6 A;  1HH2 P;  4RM2 A;  1VQP Z;  5BSU A;  3H0G I;  5BSW A;  1KD1 1;  1VQO 1;  2OO4 A;  3GTO I;  2DPL A;  1R9T I;  3CCQ Z;  5BST A;  2QA4 1;  3CD6 1;  3IFU A;  5BSM A;  5BSR A;  1KKG A;  2H85 A;  3VB9 A;  1NUI A;  4DCS A;  4PHT A;  1WCM I;  1XHJ A;  4RS4 A;  2NVY I;  3GKU A;  4IR7 A;  4E31 A;  4NBB A;  1VQ6 Z;  3CCM Z;  4E2X A;  3CCL 1;  2NVQ I;  4X6A I;  2HJG A;  2OZK A;  1K8A 1;  1VQK 1;  3NH5 A;  3CME 1;  1FDI A;  1MXA A;  2K3R A;  2VF1 A;  3T4N B;  4JI1 C;  3K6R A;  1YJ9 Z;  2OTJ 1;  3JAM f;  4MTN A;  2PN2 A;  4X64 C;  2JUB A;  4NB9 A;  1FJG C;  4MD7 A;  1TWA I;  2MM9 A;  2WP0 C;  2JS4 A;  2G2K A;  2P2B A;  3N2Q A;  1N8R 1;  1NY8 A;  2P3Y A;  3A25 A;  3BG1 B;  1JOS A;  3NDJ A;  2Y4N A;  4DCV A;  5A2Q D;  2MCQ A;  4L2Z A;  3DAY A;  1M90 2;  3FQM A;  2OTL Z;  4BCA A;  1S72 1;  2QVX X;  4R1M A;  2QKD A;  2WAQ A;  1Q16 A;  1EGA A;  4HH4 A;  2YU9 I;  2JNY A;  1UWD A;  3MON A;  1W2B Y;  5IT9 b;  3AF5 A;  2HU9 A;  1SFO I;  4RVF A;  4DQY B;  3PO3 S;  3I55 Z;  2VZE A;  4JI0 C;  1O93 A;  5AE3 A;  3GKQ A;  3CC4 1;  1MDF A;  4DV6 C;  2UXD C;  2D7V A;  3J80 f;  3LGX A;  4I9F A;  3KIF A;  1VLA A;  1Y1W I;  2QVZ X;  3GTM S;  3CQZ I;  2YWC A;  5GTD A;  1M6X C;  1QWI A;  3TDH B;  4A3E I;  1VQO Z;  2DHM A;  2RHB A;  3T1Y C;  4LF5 C;  3DLP X;  3KXW A;  3A9V A;  4DV2 C;  3IEV A;  4RVD A;  2JIP A;  4JI3 C;  3TUF A;  1WW9 A;  4FUQ A;  2QA4 Z;  3CD6 Z;  3NPD A;  3GR0 A;  3FQQ A;  1XRC A;  2AYA A;  2ZM6 C;  5T8T A;  2D1S A;  3IEU A;  1NP6 A;  1YI2 1;  2KI7 B;  1KD1 2;  1Y1V I;  4JI7 C;  5T64 A;  1WH9 A;  2WD9 A;  5FLX f;  3S2H I;  1X0T A;  3R44 A;  1ZB8 A;  2V3V A;  5IP9 I;  4A3K I;  4RLF A;  3CCL Z;  4A3D I;  5K8F A;  1XMQ C;  2UUB C;  2Y4O A;  4BC9 A;  2D27 A;  1XRB A;  1VQK Z;  1M90 1;  1V25 A;  3I07 A;  1YJW Z;  2JIR A;  2W04 A;  3CME Z;  1K73 1;  3UX3 A;  3MZL B;  3D2L A;  2OTJ Z;  3A9U A;  3CCU 1; 
#chains in the Genus database with same CATH homology
 2W03 A;  2B63 I;  2R93 I;  4NDN A;  1V26 A;  3B7W A;  4DV7 C;  4NXN C;  3H2T A;  3F3F C;  4A3F I;  3ESW A;  5FLX b;  2QL8 A;  4PRO C;  1S7M A;  3J81 D;  1I50 I;  4DCT A;  2R6M A;  4DV4 C;  2E2H I;  2QRC B;  1JJ2 Y;  1RO2 A;  3CCS 1;  1Q82 2;  3CPW Y;  4LFB C;  2BJO A;  1S72 Z;  3GTP I;  3CPW Z;  4NFR A;  1TWF I;  5T67 A;  3M4O I;  4OXI A;  1X3Z A;  2DE6 A;  4MXU A;  2M48 A;  4NBE A;  2PRO A;  4MD8 A;  4JI5 C;  5LL6 f;  1PFT A;  3GR1 A;  4E2Y A;  2P2M A;  2PM9 A;  4E30 A;  1VQL 1;  3CC4 Z;  2YCB A;  2LFU A;  3MZK B;  3C5E A;  4X66 C;  4NBF A;  4LFA C;  1ML8 A;  4OX9 C;  1QVF Z;  2E0G A;  4ZLP A;  4JI4 C;  3G6E 1;  2P2Q A;  4BC7 A;  4B3R C;  4A3B I;  3CCV 1;  3FCC A;  4DR5 C;  1N2F A;  2EGT A;  2RPR A;  3S82 A;  4PZP A;  1TWC I;  1HR0 C;  4BBR I;  1YJ7 A;  5BUS A;  3CCJ 1;  4X62 C;  1YJN 1;  4JI6 C;  5LMN C;  4LF7 C;  1Z01 A;  3I4N I;  3U50 C;  4I9G A;  3CXC Z;  3RV2 A;  2O4H A;  3HKZ A;  1PG3 A;  1YI2 Z;  2D1R A;  1XMO C;  4JYA C;  2Q51 A;  1HNX C;  3VMG A;  4YHH C;  4G37 A;  4EWC A;  2Y0S A;  3PBK A;  2V8J A;  3G4S 1;  1YUK A;  1ZB9 A;  3FKI I;  3KIH A;  5A2Q f;  2HHH C;  2M6N A;  3R9W A;  2QEX 1;  1VQ9 1;  5K85 A;  1TWG I;  2IZ4 A;  1Q82 1;  3UOW A;  2QRD B;  5A19 A;  3CW8 X;  4E33 A;  1VQ7 1;  2PT7 G;  2JMP A;  4MH4 A;  5KYT A;  1TFI A;  4E2W A;  3CCU Z;  4K0K C;  5AE2 A;  2PMZ A;  3GTQ I;  1QYP A;  1Q86 2;  3QWU A;  3TE5 B;  1YIJ Z;  4A3C I;  2DYJ A;  3HOY I;  5E7Q A;  1K73 2;  1N36 C;  4RVO A;  3CCS Z;  1M1K 2;  4IZ6 A;  3ETC A;  1QF8 A;  2E8C A;  4DR2 C;  3NFZ A;  3JAM b;  5D1O A;  1YIT 1;  2CXC A;  1I94 C;  4A3G I;  1VQN 1;  4E32 A;  3VTN A;  4L7I A;  2V8I A;  3PO3 I;  3S15 I;  4HPV A;  3HOU I;  2QR1 B;  4RLQ A;  4TPS B;  1N33 C;  1VQM 1;  4D56 A;  2YWB A;  5IT9 D;  4GS5 A;  2F4M A;  4QTU A;  3GTM I;  4A3I I;  1TWH I;  5C3E I;  1NJI 2;  1USP A;  4RMN A;  4XX2 A;  1ZH1 A;  1I6H I;  1YHQ 1;  4LF4 C;  1RO0 A;  2V7B A;  1HNW C;  1IBK C;  3G6E Z;  3TQI A;  3CCV Z;  2RBL A;  4B3T C;  4DR6 C;  5IFI A;  2UUA C;  3CCJ Z;  4A3J I;  1YJN Z;  1WF3 A;  3J80 b;  3VMH A;  2E8F A;  4GKK C;  2E2I I;  1VQP 1;  3HOX I;  3N54 B;  5C4X I;  5H9U A;  2GTI A;  4MRI A;  1NYE A;  1MD9 A;  2D28 C;  2E8E A;  2VSQ A;  1Q86 1;  4RV9 A;  3CCE 1;  3A4I A;  4RVH A;  4QTT A;  2CY1 A;  3J81 f;  3G4S Z;  2VQF C;  4G1I A;  2K5R A;  2QW0 X;  1RY2 A;  1P9N A;  1VQ9 Z;  2R92 I;  4ZJZ A;  1Q7Y 1;  3NYR A;  1KRL A;  5KEI A;  1M1K 1;  3SO4 A;  1VQ7 Z;  4DV1 C;  2YAD A;  2D1Q A;  2QVY X;  4B3S C;  2VQE C;  1K0R A;  4A3M I;  2HF1 A;  4DV5 C;  4LFC C;  3IF8 A;  1LQL A;  1O9T A;  4HGY A;  1BA3 A;  4AQY C;  4ODJ A;  4OYC A;  4NXM C;  3K7A I;  2OOX B;  2WB1 A;  2F4O A;  1J5E C;  1RO4 A;  2JA5 I;  3PRO C;  1NJI 1;  4NBA A;  2GTH A;  1DL6 A;  1XNQ C;  1O90 A;  5IP7 I;  4ISB A;  1YIT Z;  3IML A;  1RQF A;  3J7A 4;  1VQN Z;  1O92 A;  3VNS A;  1IBL C;  1RLY A;  4BXX I;  3E7X A;  4NOZ A;  4DGL A;  2Y27 A;  2NVX I;  1VQ5 1;  3RZO I;  3EQ6 A;  5CM2 M;  2E5L C;  4KHP C;  1VQM Z;  4D57 A;  2OPL A;  2UXC C;  2LIY A;  1VQ4 1;  4FUT A;  3UZ0 A;  4NBG A;  1QVF Y;  5JRH A;  2KPI A;  5D1O B;  3G71 1;  1PG4 A;  4NH1 C;  1YHQ Z;  1K9M 2;  3I56 1;  2OBV A;  4LF9 C;  4BBY A;  4DV3 C;  4DG8 A;  1IBM C;  3R9X A;  1MXB A;  3D9X A;  3T1H C;  2UXB C;  3NH8 A;  1QM4 A;  4BY7 I;  3CXC Y;  3M3Y I;  2P02 A;  1L2F A;  4NBH A;  3VNQ A;  3P5J B;  4DG9 A;  4FTF A;  5IWA C;  1USP B;  4Y52 I;  3BG0 B;  4R1L A;  4DR3 C;  2RT9 A;  2QRE B;  2E2J I;  3RG2 A;  2ATW A;  2NVT I;  3CJE A;  2R7Z I;  3NYQ A;  3CCE Z;  3PO2 I;  1FUG A;  4K0B A;  4RVG A;  5DV9 A;  4DR4 C;  3ETO A;  3I08 A;  4JV5 C;  1RG9 A;  1N34 C;  4JI8 C;  3IX0 A;  4A3L I;  4X65 C;  2F4V C;  4MON A;  4Y7N I;  3LAX A;  2IZ3 A;  2VUM I;  3CCR 1;  3NI2 A;  1PA4 A;  5BUR A;  3Q87 A;  3S1N I;  3CMA 1;  3NDI A;  5CZX A;  1YJW 1;  1Q7Y 2;  5A2Q b;  3PES A;  4R0M A;  3CC7 1;  2DE7 A;  3HOV I;  3DHV A;  1P7L A;  5IT9 f;  2O53 A;  1Q81 2;  2P28 A;  2UUC C;  4CL1 A;  1VQ8 1;  3GTL I;  3D6W A;  4HGZ A;  1K9M 1;  5D1P A;  1MDB A;  5CZV A;  3S1M I;  2JMO A;  3CC2 1;  3GTK I;  3VNR A;  3GTG I;  3L95 X;  2AKL A;  2VUG A;  1VQL Z;  3GPC A;  2E9H A;  1VQ5 Z;  4MD9 A;  1L1O C;  1UKK A;  3IPL A;  4GXQ A;  1MXC A;  5A1G A;  2DE5 A;  4JI2 C;  2ONF A;  5AE1 A;  3JAM D;  5LMU C;  1VQ4 Z;  4WV3 A;  3RZD I;  3G71 Z;  3HOW I;  3CW9 A;  1T5H X;  4BBS I;  5KYV A;  2UU9 C;  3H3V J;  4BY1 I;  1W2B Z;  3I56 Z;  1KQS Y;  4LF6 C;  4TNU A;  1Z03 A;  4AYB A;  1KQS Z;  3LNV A;  3FCE A;  3I4M I;  5BR8 C;  4NBC A;  2OPL B;  2JA7 I;  3S1Q I;  4DUY C;  1T5D X;  2I3C A;  1QVG Y;  4G36 A;  1XRA A;  4KTV A;  2V8K A;  1QVG Z;  5FLM I;  1WII A;  5A1I A;  4DK1 A;  1KC8 2;  3GCF A;  3CCQ 1;  4DUZ C;  3S14 I;  4BSZ A;  4A93 I;  3EER A;  3J80 D;  4GKJ C;  1XNR C;  2QEX Z;  2BH1 X;  2OOY B;  2P2F A;  4KTT A;  1K83 I;  4U5Y D;  3OW2 Y;  1Q81 1;  1Y1V S;  4D4G A;  3OW2 Z;  1VQ6 1;  1ULT A;  2J6A A;  3CCM 1;  3CCR Z;  2D1T A;  5C4J I;  4LE5 A;  3S2D I;  4DV0 C;  2P2J A;  2XR1 A;  2Q4Z A;  2RIQ A;  5BSV A;  3CMA Z;  3EED A;  1YJ9 1;  3S17 I;  5T8S A;  2JA6 I;  1YUA A;  1X3W A;  5AN9 F;  3J81 b;  4GXR A;  1GPM A;  3GTJ I;  1I3Q I;  2PK7 A;  3CC7 Z;  1Z02 A;  3E7W A;  4JM1 A;  5FLX D;  4NBD A;  3VMI A;  1HNZ C;  1VQ8 Z;  2QLV B;  3LUS A;  3CC2 Z;  4NB8 A;  1YIJ 1;  1K8A 2;  4RVN A;  4DR1 C;  4B3M C;  3G7S A;  4E2Z A;  3AF6 A;  2OTL 1;  2JA8 I;  3OTO C;  5T6B A;  4DR7 C;  4YY3 C;  2KZF A;  4D4I A;  4S1T A;  3TDE A;  3HOZ I;  4EAT A;  1JJ2 Z;  3NH4 A;  2ZAE B;  2E7G A;  5C44 I;  3S1R I;  1RNI A;  1KC8 1;  1MKY A;  4LF8 C;  1N8R 2;  3I55 1;  1JWH C;  4L4Q A;  2ASB A;  1N32 C;  3F3P C;  5ADZ A;  1AMU A;  5BUQ A;  2GU2 A;  2P20 A;  3S16 I;  4DCU A;  4RM3 A;  4WS9 A;  1LCI A;  2JR6 A;  1HH2 P;  4RM2 A;  1VQP Z;  5BSU A;  3H0G I;  5BSW A;  1KD1 1;  1VQO 1;  2OO4 A;  3GTO I;  2DPL A;  1R9T I;  3CCQ Z;  5BST A;  2QA4 1;  3CD6 1;  3IFU A;  5BSM A;  5BSR A;  1KKG A;  2H85 A;  3VB9 A;  1NUI A;  4DCS A;  4PHT A;  1WCM I;  4RS4 A;  2NVY I;  3GKU A;  4IR7 A;  4E31 A;  4NBB A;  1VQ6 Z;  3CCM Z;  4E2X A;  3CCL 1;  2NVQ I;  4X6A I;  2HJG A;  2OZK A;  1K8A 1;  1VQK 1;  3NH5 A;  3CME 1;  1MXA A;  2K3R A;  2VF1 A;  3T4N B;  4JI1 C;  1YJ9 Z;  2OTJ 1;  3JAM f;  4MTN A;  2PN2 A;  4X64 C;  2JUB A;  4NB9 A;  1FJG C;  4MD7 A;  1TWA I;  2WP0 C;  3N2Q A;  2JS4 A;  2G2K A;  2P2B A;  1N8R 1;  2P3Y A;  3BG1 B;  1JOS A;  3NDJ A;  2Y4N A;  4DCV A;  5A2Q D;  4L2Z A;  3DAY A;  1M90 2;  3FQM A;  2OTL Z;  4BCA A;  1S72 1;  2QVX X;  4R1M A;  2QKD A;  2WAQ A;  1EGA A;  4HH4 A;  2YU9 I;  2JNY A;  3MON A;  1W2B Y;  5IT9 b;  3AF5 A;  2HU9 A;  1SFO I;  4RVF A;  4DQY B;  3PO3 S;  3I55 Z;  2VZE A;  4JI0 C;  1O93 A;  5AE3 A;  3GKQ A;  3CC4 1;  1MDF A;  4DV6 C;  2UXD C;  2D7V A;  3J80 f;  3LGX A;  4I9F A;  3KIF A;  1VLA A;  1Y1W I;  2QVZ X;  3GTM S;  3CQZ I;  2YWC A;  5GTD A;  1QWI A;  1VQO Z;  3TDH B;  4A3E I;  2RHB A;  3T1Y C;  4LF5 C;  3DLP X;  3KXW A;  3A9V A;  4DV2 C;  3IEV A;  4RVD A;  4JI3 C;  3TUF A;  1WW9 A;  4FUQ A;  2QA4 Z;  3CD6 Z;  3NPD A;  3GR0 A;  3FQQ A;  1XRC A;  2AYA A;  2ZM6 C;  5T8T A;  2D1S A;  3IEU A;  1NP6 A;  1YI2 1;  2KI7 B;  1KD1 2;  1Y1V I;  4JI7 C;  5T64 A;  1WH9 A;  2WD9 A;  5FLX f;  3S2H I;  1X0T A;  3R44 A;  1ZB8 A;  5IP9 I;  4A3K I;  4RLF A;  3CCL Z;  4A3D I;  5K8F A;  1XMQ C;  2UUB C;  2Y4O A;  4BC9 A;  2D27 A;  1XRB A;  1VQK Z;  1M90 1;  1V25 A;  3I07 A;  1YJW Z;  2W04 A;  3CME Z;  1K73 1;  3MZL B;  3L8C A;  2OTJ Z;  3A9U A;  3CCU 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...