1VLAA

Crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
144
structure length
144
Chain Sequence
b'HHHHHHMQARWIGNMMFHVRTDSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVIDQMKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEKYCSVSAILKCSSKVTYEIVYEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroperoxide resistance protein OsmC
publication title Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 34
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vlaA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1vlaA02
4DV5C 1KKGA 1HH2P 1NYEA 2JMPA 2UUAC 5FLMI 3ESWA 2VQEC 3S2HI 2ONFA 1TWCI 4JI1C 3VB9A 1N34C 4DUZC 4YY3C 2NVTI 3M4OI 5LMNC 2JA8I 3J80D 2NVXI 3GTMI 1XMOC 3S1RI 3K7AI 1HNXC 3VMHA 3CJEA 4LF9C 2AKLA 5LMUC 4NXNC 4DR4C 3I4NI 4DR5C 2BJOA 3HOUI 4DV4C 2F4OA 1XNRC 4AQYC 3HOWI 2ZM6C 4A3CI 4QTTA 3AF6A 1WW9A 4DV7C 4NB9A 2UXBC 4GKKC 3D6WA 3GTLI 2VUMI 2R7ZI 4K0KC 2K5RA 2OPLA 3JAMD 3RZDI 1XMQC 4DV3C 1HNZC 2HHHC 3S1QI 1VLAA 4A3BI 2DE5A 4BSZA 4DCSA 4X64C 2ATWA 5IT9D 2JA7I 1FJGC 4BBSI 1RLYA 2DE6A 2E2II 2CXCA 3I4MI 4NBFA 4DV6C 1USPB 4JYAC 1L1OC 2R92I 2E8EA 4JI8C 1WCMI 3PO3I 4YHHC 1I6HI 4JI6C 1UKKA 4B3SC 1DL6A 2RBLA 4OX9C 4X65C 5FLXD 1NUIA 3S1MI 4DR3C 3J81D 3PO2I 1SFOI 3Q87A 2DE7A 2UUCC 4A3KI 2NVYI 4B3MC 2B63I 2UXDC 2PK7A 1WH9A 4XX2A 2NVQI 3S14I 3PO3S 1I50I 2D7VA 2EGTA 3GKQA 1QYPA 4A3DI 5CM2M 2PN2A 5IWAC 3CQZI 4BXXI 5C4XI 4A3FI 4JI5C 1JOSA 4DR2C 4JV5C 4BY1I 1YUAA 2UXCC 1WF3A 2DYJA 3S15I 2UUBC 4A93I 4A3LI 2KZFA 4B3RC 1ZB8A 1Y1VS 4Y52I 3HOZI 1MKYA 1K83I 1K0RA 3T1YC 4Y7NI 1L2FA 3OTOC 1I3QI 2R93I 4NBDA 5IP9I 2E2JI 2OPLB 5C44I 4B3TC 1N36C 2E8FA 1QWIA 3H0GI 3LUSA 4LFBC 3HOYI 3GKUA 3R9XA 1ZB9A 3R9WA 4LF8C 4MH4A 4BY7I 3I07A 4NBAA 4DUYC 2HF1A 2E2HI 3M3YI 3AF5A 4LFCC 3GTQI 2J6AA 4NBEA 3U50C 1LQLA 5C3EI 4JI2C 4QTUA 3IEVA 4JI3C 3VMIA 3IEUA 4DCUA 4A3EI 1J5EC 2JS4A 3GTOI 2QL8A 4NXMC 4A3II 4GKJC 1Y1VI 5C4JI 4NBHA 2KPIA 1TWGI 1PFTA 4DR1C 4DCVA 4NB8A 2PT7G 3EERA 4MTNA 4JI7C 2ASBA 1TWFI 3FKII 4LF7C 4BBRI 3S2DI 1ML8A 3T1HC 4NBGA 4DR6C 3GTKI 4NOZA 4LF5C 4X6AI 3RZOI 4JI0C 2E5LC 1HNWC 2UU9C 3GTJI 1N33C 2YCBA 5A2QD 1TWHI 1IBLC 4LF4C 4JI4C 3S1NI 1N32C 1N2FA 1IBMC 1I94C 2JR6A 2F4MA 1IBKC 4DV0C 4DCTA 3HOXI 3S17I 2E7GA 3VMGA 2JNYA 4A3MI 1HR0C 1RO4A 1TFIA 5IP7I 1Y1WI 2YU9I 3GTMS 1PA4A 4LF6C 1USPA 4DR7C 2HJGA 1R9TI 4A3GI 4NBBA 1X3ZA 4X66C 1EGAA 5BR8C 1TWAI 2VQFC 2P3YA 2JA6I 4NBCA 4DV2C 1X3WA 4LFAC 1XNQC 3H3VJ 3GTPI 4KHPC 2F4VC 2CY1A 4A3JI 4DV1C 3HOVI 3S16I 2JA5I 4X62C 2XR1A 3GCFA 2E8CA 3GTGI
chains in the Genus database with same CATH superfamily
3CCRZ 4DV5C 2P20A 1KKGA 1MDFA 3J80f 2VPZA 1HH2P 1NYEA 2QVZX 2JMPA 4L2ZA 4E32A 2UUAC 3J80b 3MZKB 1QF8A 1MD9A 3UOWA 2P02A 3IPLA 1RG9A 3CCEZ 4RVHA 1YJ7A 5KEIA 1KC81 5FLMI 3ESWA 3C5EA 5D1OA 1FLOA 2VQEC 3S2HI 2ONFA 1P7LA 2M6NA 3T4NB 3UX2A 1TWCI 4JI1C 3A25A 1VQM1 3VB9A 1P4EA 1N34C 1YJW1 4DUZC 1M6XC 2Y27A 2NVTI 3M4OI 4YY3C 5LMNC 4GS5A 2V7BA 5DV9A 2DPLA 2JA8I 2MMAB 3NH4A 2KI7B 1FDOA 4DGLA 5A19A 5GTDA 4PZPA 3J80D 1QVGY 3PROC 2NCLA 1VQMZ 1YJWZ 3I551 2NVXI 3UZ0A 4U5YD 3KIHA 1M1K2 3CC41 4DK1A 3KIFA 2Y0SA 3GTMI 3A4IA 3NDJA 3S1RI 2P2JA 4GXQA 3S82A 2IZ3A 3K7AI 1MXBA 4PHTA 4E31A 5BSTA 5KYVA 1HNXC 3VMHA 3CJEA 2YWCA 1JJ2Y 4LF9C 3CCS1 3AY0A 1NJI2 2AKLA 3CMA1 5LMUC 2JUBA 1LCIA 2BH1X 4NXNC 4L4QA 4ISBA 2HU9A 3TR3A 2QW0X 3DAYA 3I4NI 2AYAA 3I55Z 1K732 2QA41 2LEXA 1Q7Y2 2BJOA 2DHMA 4KTVA 4DR5C 3CC4Z 1ZH1A 3HOUI 3HKZA 3ETOA 2JNVA 3NI2A 5BUSA 4DV4C 2F4OA 4E30A 1PG3A 3JAMb 3N54B 1XNRC 4AQYC 4MD9A 3HOWI 4PUGA 3CCSZ 2ZM6C 4A3CI 4D4IA 4QTTA 5BURA 3CC71 3AF6A 1WW9A 4DV7C 2YX1A 3A26A 1M1K1 1QM4A 2QA4Z 2D1SA 4NB9A 4G36A 2UXBC 2QRCB 2CU6A 1XHJA 4GKKC 3D6WA 3GTLI 1VQ81 1VQ71 3TUFA 2JIRA 5AE3A 1JWHC 4E2ZA 2E9HA 2P2BA 1W2BZ 4IZ6A 2W04A 2VUMI 1WIIA 2R7ZI 4K0KC 1Q7Y1 2K5RA 2OPLA 3GR0A 3JAMD 1V25A 3RZDI 3E7WA 1XMQC 4DV3C 1HNZC 2GU2A 2HHHC 3S1QI 1VLAA 4RS4A 4A3BI 5BSUA 1M6XA 4L7IA 2QREB 3OW2Z 2DE5A 1VQ7Z 4BSZA 3LAXA 4DCSA 2QVYX 4X64C 2ATWA 5IT9D 3VNSA 1FDIA 1VQLZ 3CCJZ 3FQQA 2JA7I 3IF8A 3TQIA 3D9XA 3CCV1 2KZ0A 3CPWY 1FJGC 4BBSI 1RLYA 2DE6A 2E2II 5KYTA 2CXCA 3I4MI 1YIJ1 3CCUZ 1VQO1 1O90A 4RVNA 4R1MA 4NBFA 4DV6C 2ZZNA 5FLXf 4EATA 1USPB 4JYAC 1RNIA 2KDNA 1L1OC 2R92I 3VNRA 5CZVA 1KD11 4HGZA 5JRHA 5FLXb 4BC7A 2E8EA 1KQSY 1X0TA 4JI8C 1VQOZ 5LCIA 1Q16A 2W03A 1WCMI 1Z01A 5T64A 3J81b 1SIWA 3PO3I 4YHHC 1I6HI 2JMOA 4DG8A 4OXIA 4AYBA 4JI6C 2D1QA 1UKKA 2P2QA 4B3SC 3RG2A 1DL6A 4FUQA 2RBLA 4RLQA 4OX9C 1M902 4PROC 2QEX1 4X65C 5FLXD 1VQ51 1K9M1 1NUIA 1V26A 3NH5A 2LIYA 3S1MI 5E7QA 4HGYA 4DR3C 3J81D 3PO2I 2VZEA 5AE1A 1SFOI 3A9UA 3Q87A 2MCQA 2DE7A 2QEXZ 1T5HX 2OBVA 4BCAA 3UX3A 1QVGZ 4JM1A 2VF1A 4RV9A 2UUCC 4A3KI 1VQ5Z 2NVYI 3VTNA 4BC9A 4B3MC 3G7SA 2B63I 2UXDC 3CC21 1N8R2 1T5DX 2RPRA 1M901 2PK7A 3N2QA 1VQ61 1WH9A 2VPWA 1AMUA 4K0BA 5D1OB 5BSRA 1WJ2A 4XX2A 1JJ2Z 2NVQI 3S14I 4RLFA 1KRLA 2V3VA 3PO3S 2YWBA 1I50I 2D7VA 2EGTA 2OOXB 4HH4A 3GKQA 1QYPA 2WD9A 1NP6A 1Z02A 2OTJ1 3CC2Z 4LE5A 4WS9A 4A3DI 5D1PA 3A9VA 5CM2M 2D27A 2PN2A 5IFIA 5IWAC 1VQ6Z 5ADZA 3CQZI 4BXXI 3NH8A 2OOYB 2D28C 3JAMf 3PBKA 5C4XI 4A3FI 4JI5C 1N8R1 1JOSA 4HPVA 2OTJZ 4DR2C 3CXCY 1RQFA 4JV5C 1YIT1 3E7XA 4BY1I 4RMNA 5IT9f 1YUAA 2UXCC 1WF3A 1VQP1 2Y4NA 2V8KA 3NDIA 3NYRA 2DYJA 4E33A 3S15I 4RVOA 4RM3A 2UUBC 5IT9b 2OTL1 3FCCA 4A93I 1MXCA 2RHBA 4I9FA 3B7WA 4ZLPA 1YITZ 1XS3A 1NJI1 4A3LI 2Q51A 3DHVA 2VPXA 2KZFA 1XMOC 1Q862 1VQL1 4B3RC 1ZB8A 3CCJ1 3RV2A 1Y1VS 4Y52I 3IX0A 3HOZI 1VQPZ 2VPYA 4RVDA 3L8CA 1MKYA 1K731 2D1RA 1K83I 3TDEA 3CQ2A 4ZJZA 1K0RA 3T1YC 2OTLZ 3CCMZ 3CCU1 3CPWZ 1FUGA 3CQ3A 2ZZMA 4Y7NI 1AA6A 4BBYA 1L2FA 3LGXA 3OTOC 4ODJA 2LFUA 3H2TA 2VSQA 2GTIA 1I3QI 1BA3A 4PUHA 2M5HA 2R93I 4NBDA 1YHQ1 2JIMA 5IP9I 2JIQA 1O9TA 2QRDB 4NDNA 2E2JI 2OPLB 3CQ1A 5C44I 3TDHB 5BUQA 4B3TC 1N36C 1Q861 3CCL1 2JIPA 1K8A2 1KQSZ 2E8FA 1P4EC 1QWIA 4WV3A 3H0GI 3LUSA 2R6MA 1V60A 3SO4A 4TNUA 4LFBC 3HOYI 2D1TA 3GR1A 3GKUA 4D4GA 1YHQZ 3R9XA 1QVFY 1ZB9A 1QXFA 3J81f 3IR7A 2V8JA 3R9WA 4E2XA 4LF8C 2P28A 4MH4A 4BY7I 3I07A 4NBAA 4DUYC 2HF1A 2E2HI 3M3YI 3CCLZ 2E7ZA 3AF5A 4R0MA 4LFCC 3GTQI 2J6AA 4R1LA 4NBEA 3U50C 2ZAEB 2PMZA 1LQLA 2P2MA 3NFZA 3CW9A 3I08A 3K6RA 4S1TA 5C3EI 4JI2C 5T6BA 1K8A1 4QTUA 3IEVA 4JI3C 4FTFA 2AYDA 1MDBA 3VMIA 3IEUA 4DCUA 1Q822 3UEBA 4CL1A 3CD61 4A3EI 3F3FC 1YI21 4E2YA 2RIQA 4TPSB 1J5EC 2GTHA 4RVGA 2JS4A 3GTOI 2QL8A 1XRAA 4NXMC 1VQK1 2E0GA 1Q812 4FUTA 4MXUA 4A3II 1S7MA 2IV2X 3CD6Z 1YI2Z 1S721 4GKJC 1Y1VI 4MRIA 5C4JI 1P9NA 1Y8CA 4NBHA 4IR7A 2IZ4A 1UWDA 5T8TA 2KPIA 3VNQA 3KXWA 1TWGI 1PFTA 4MD8A 3QWUA 1VQKZ 1Q821 1O92A 3TE5B 1XRBA 3FCEA 1RY2A 2Z51A 5CZXA 4DCVA 4DR1C 4NB8A 2I3CA 3CXCZ 1S72Z 4D56A 5A2Qf 2PT7G 4NFRA 3BG0B 3EERA 2P2FA 1NY8A 4MTNA 4JI7C 3LNVA 4DR4C 1Q811 2G2KA 3GPCA 2ASBA 1TWFI 5A2Qb 2Y4OA 5BSVA 3FKII 5LL6f 4LF7C 3NPDA 4BBRI 3S2DI 1ML8A 4PUIA 2RT9A 2YADA 1YJN1 1GPMA 2VUGA 4EWCA 2WB1A 3O2EA 5BSWA 3FQMA 5AN9F 3T1HC 2V45A 4NBGA 4DR6C 1O93A 5BSMA 3DLPX 5A1IA 4RVFA 3GTKI 4NOZA 4LF5C 2M48A 4X6AI 3CCM1 3BG1B 3RZOI 2JIOA 4MD7A 1Z03A 1VQ41 2OO4A 4JI0C 2K3RA 5T8SA 2E5LC 1HNWC 2O4HA 4KTTA 3GTJI 2UU9C 1YJNZ 1N33C 2YCBA 5A2QD 1TWHI 2V8IA 4G37A 2MM9A 2QR1B 1IBLC 4LF4C 4JI4C 3S1NI 3CMAZ 1N32C 1N2FA 1IBMC 1I94C 2JR6A 2H85A 1VQ4Z 1XRCA 2WP0C 5K85A 2F4MA 5H9UA 1IBKC 4DV0C 4DCTA 3IMLA 3HOXI 3S17I 2Q4ZA 2E7GA 3VMGA 2JNYA 3R44A 4A3MI 2PM9A 4D57A 3CCQ1 3CC7Z 3NYQA 1HR0C 4DQYB 4RM2A 1QVFZ 3P5JB 1RO4A 1TFIA 4NH1C 5IP7I 1Y1WI 1KD12 2YU9I 3GTMS 3EEDA 2O53A 1TH5A 1RO0A 1PA4A 3I561 4GXRA 4LF6C 1VQN1 3L95X 1USPA 1W2BY 2HJGA 1VQ8Z 4MONA 4DR7C 1R9TI 4A3GI 1YJ91 2QVXX 3MONA 4NBBA 3G6E1 2M5OA 4DG9A 3J7A4 1X3ZA 2NAPA 4I9GA 1VEHA 4X66C 1EGAA 3CCQZ 5BR8C 3PESA 1TWAI 3G4S1 4G1IA 2VQFC 2P3YA 2QLVB 2JA6I 1IB8A 3OW2Y 3IFUA 1RO2A 3CME1 3I56Z 2OZKA 5A1GA 4NBCA 1VQNZ 1PG4A 4DV2C 1X3WA 1WCJA 4LFAC 3CW8X 1YJ9Z 3ETCA 3G6EZ 3G711 1XNQC 1VQ91 1YUKA 3D2LA 1K9M2 1WZNA 3GTPI 3H3VJ 4KHPC 3LNOA 2PROA 2CY1A 1MXAA 4OYCA 2F4VC 4A3JI 3CCVZ 4DV1C 5K8FA 3F3PC 3G4SZ 3CCR1 1KC82 5AE2A 3EQ6A 1YIJZ 1ULTA 3HOVI 3CMEZ 5T67A 3S16I 2JA5I 4X62C 4E2WA 2XR1A 2QKDA 3G71Z 1VQ9Z 3MZLB 3GCFA 1PU1A 3CCE1 2WAQA 2E8CA 3GTGI
chains in the Genus database with same CATH topology
3CCRZ 4DV5C 2P20A 1KKGA 1MDFA 3J80f 1HH2P 1NYEA 2QVZX 2JMPA 4L2ZA 4E32A 2UUAC 3J80b 3MZKB 1QF8A 1MD9A 3UOWA 2P02A 3IPLA 1RG9A 3CCEZ 4RVHA 1YJ7A 5KEIA 1KC81 5FLMI 3ESWA 3C5EA 5D1OA 2VQEC 3S2HI 2ONFA 1P7LA 2M6NA 3T4NB 1TWCI 4JI1C 1VQM1 3VB9A 1N34C 1YJW1 4DUZC 2Y27A 2NVTI 3M4OI 4YY3C 5LMNC 4GS5A 2V7BA 5DV9A 2DPLA 2JA8I 3NH4A 2KI7B 4DGLA 5A19A 5GTDA 4PZPA 3J80D 1QVGY 3PROC 1VQMZ 1YJWZ 3I551 2NVXI 3UZ0A 4U5YD 3KIHA 1M1K2 3CC41 4DK1A 3KIFA 2Y0SA 3GTMI 3A4IA 3NDJA 3S1RI 2P2JA 4GXQA 3S82A 2IZ3A 3K7AI 1MXBA 4PHTA 4E31A 5BSTA 5KYVA 1HNXC 3VMHA 3CJEA 2YWCA 1JJ2Y 4LF9C 3CCS1 1NJI2 2AKLA 3CMA1 5LMUC 2JUBA 1LCIA 2BH1X 4NXNC 4L4QA 4ISBA 2HU9A 4DR4C 2QW0X 3DAYA 3I4NI 2AYAA 3I55Z 1K732 2QA41 1Q7Y2 4KTVA 2BJOA 4DR5C 3CC4Z 1ZH1A 3HOUI 3HKZA 3ETOA 3NI2A 5BUSA 4DV4C 2F4OA 4E30A 1PG3A 3JAMb 3N54B 1XNRC 4AQYC 4MD9A 3HOWI 3CCSZ 2ZM6C 4A3CI 4D4IA 4QTTA 5BURA 3CC71 3AF6A 1WW9A 4DV7C 1M1K1 1QM4A 2QA4Z 2D1SA 4NB9A 4G36A 2UXBC 2QRCB 4GKKC 3D6WA 3GTLI 1VQ81 1VQ71 3TUFA 5AE3A 1JWHC 4E2ZA 2E9HA 2P2BA 1W2BZ 4IZ6A 2W04A 2VUMI 1WIIA 2R7ZI 4K0KC 1Q7Y1 2K5RA 2OPLA 3GR0A 3JAMD 1V25A 3RZDI 3E7WA 1XMQC 4DV3C 1HNZC 2GU2A 2HHHC 3S1QI 1VLAA 4RS4A 4A3BI 5BSUA 4L7IA 2QREB 3OW2Z 2DE5A 1VQ7Z 4BSZA 3LAXA 4DCSA 2QVYX 4X64C 2ATWA 5IT9D 3VNSA 1VQLZ 3CCJZ 3FQQA 2JA7I 3IF8A 3TQIA 3D9XA 3CCV1 3CPWY 1FJGC 4BBSI 1RLYA 2DE6A 2E2II 5KYTA 2CXCA 3I4MI 1YIJ1 3CCUZ 1VQO1 1O90A 4RVNA 4R1MA 4NBFA 4DV6C 5FLXf 4EATA 1USPB 4JYAC 1RNIA 1L1OC 2R92I 3VNRA 5CZVA 1KD11 4HGZA 5JRHA 5FLXb 4BC7A 2E8EA 1KQSY 1X0TA 4JI8C 1VQOZ 2W03A 1WCMI 1Z01A 5T64A 3J81b 3PO3I 4YHHC 1I6HI 2JMOA 4DG8A 4OXIA 4AYBA 4JI6C 2D1QA 1UKKA 2P2QA 4B3SC 3RG2A 1DL6A 4FUQA 2RBLA 4RLQA 4OX9C 1M902 4PROC 2QEX1 4X65C 5FLXD 1VQ51 1K9M1 1NUIA 1V26A 3NH5A 2LIYA 3S1MI 5E7QA 4HGYA 4DR3C 3J81D 3PO2I 2VZEA 5AE1A 1SFOI 3A9UA 3Q87A 2DE7A 2QEXZ 1T5HX 2OBVA 4BCAA 1QVGZ 4JM1A 2VF1A 4RV9A 2UUCC 4A3KI 1VQ5Z 2NVYI 3VTNA 4BC9A 4B3MC 3G7SA 2B63I 2UXDC 3CC21 1N8R2 1T5DX 2RPRA 1M901 2PK7A 3N2QA 1VQ61 1WH9A 1AMUA 4K0BA 5D1OB 5BSRA 4XX2A 1JJ2Z 2NVQI 3S14I 4RLFA 1KRLA 3PO3S 2YWBA 1I50I 2D7VA 2EGTA 2OOXB 4HH4A 3GKQA 1QYPA 2WD9A 1NP6A 1Z02A 2OTJ1 3CC2Z 4LE5A 4WS9A 4A3DI 5D1PA 3A9VA 5CM2M 2D27A 2PN2A 5IFIA 5IWAC 1VQ6Z 5ADZA 3CQZI 4BXXI 3NH8A 2OOYB 2D28C 3JAMf 3PBKA 5C4XI 4A3FI 4JI5C 1N8R1 1JOSA 4HPVA 2OTJZ 4DR2C 3CXCY 1RQFA 4JV5C 1YIT1 3E7XA 4BY1I 4RMNA 5IT9f 1YUAA 2UXCC 1WF3A 1VQP1 2Y4NA 2V8KA 3NDIA 3NYRA 2DYJA 4E33A 3S15I 4RVOA 4RM3A 2UUBC 5IT9b 2OTL1 3FCCA 4A93I 1MXCA 2RHBA 4I9FA 3B7WA 4ZLPA 1YITZ 1NJI1 4A3LI 2Q51A 3DHVA 2KZFA 4B3RC 1XMOC 1Q862 1VQL1 1ZB8A 3CCJ1 3RV2A 1Y1VS 4Y52I 3IX0A 3HOZI 1VQPZ 4RVDA 3L8CA 1MKYA 1K731 2D1RA 1K83I 3TDEA 4ZJZA 1K0RA 3T1YC 2OTLZ 3CCMZ 3CCU1 3CPWZ 1FUGA 4Y7NI 4BBYA 1L2FA 3LGXA 3OTOC 4ODJA 2LFUA 3H2TA 2VSQA 2GTIA 1I3QI 1BA3A 2R93I 4NBDA 1YHQ1 5IP9I 1O9TA 2QRDB 4NDNA 2E2JI 2OPLB 5BUQA 5C44I 3TDHB 4B3TC 1N36C 1Q861 3CCL1 1KQSZ 1K8A2 2E8FA 1QWIA 4WV3A 3H0GI 3LUSA 2R6MA 3SO4A 4TNUA 4LFBC 3HOYI 2D1TA 3GR1A 3GKUA 4D4GA 1YHQZ 3R9XA 1QVFY 1ZB9A 3J81f 2V8JA 3R9WA 4E2XA 4LF8C 2P28A 4MH4A 4BY7I 3I07A 4NBAA 4DUYC 2HF1A 2E2HI 3M3YI 3CCLZ 4R0MA 3AF5A 4LFCC 3GTQI 2J6AA 4R1LA 4NBEA 3U50C 2ZAEB 2PMZA 1LQLA 2P2MA 3NFZA 3CW9A 3I08A 4S1TA 5C3EI 4JI2C 5T6BA 1K8A1 4QTUA 3IEVA 4JI3C 4FTFA 1MDBA 3VMIA 3IEUA 4DCUA 1Q822 4CL1A 3CD61 4A3EI 3F3FC 1YI21 4E2YA 2RIQA 4TPSB 1J5EC 2GTHA 4RVGA 2JS4A 3GTOI 2QL8A 1XRAA 4NXMC 1VQK1 2E0GA 1Q812 4FUTA 4MXUA 4A3II 1S7MA 3CD6Z 1YI2Z 1S721 4GKJC 1Y1VI 4MRIA 5C4JI 1P9NA 4NBHA 4IR7A 2IZ4A 5T8TA 2KPIA 3VNQA 3KXWA 1TWGI 1PFTA 4MD8A 3QWUA 1VQKZ 1Q821 1O92A 3TE5B 1XRBA 3FCEA 1RY2A 5CZXA 4DCVA 4DR1C 4NB8A 2I3CA 3CXCZ 1S72Z 4D56A 5A2Qf 2PT7G 4NFRA 3BG0B 3EERA 2P2FA 4MTNA 4JI7C 3LNVA 1Q811 2G2KA 3GPCA 2ASBA 1TWFI 5A2Qb 2Y4OA 5BSVA 3FKII 5LL6f 4LF7C 3NPDA 4BBRI 3S2DI 1ML8A 2RT9A 2YADA 1YJN1 1GPMA 2VUGA 4EWCA 2WB1A 5BSWA 3FQMA 5AN9F 3T1HC 4NBGA 4DR6C 1O93A 5BSMA 3DLPX 5A1IA 4RVFA 3GTKI 4NOZA 4LF5C 2M48A 4X6AI 3CCM1 3BG1B 3RZOI 4MD7A 1Z03A 1VQ41 2OO4A 4JI0C 2K3RA 5T8SA 2E5LC 1HNWC 2O4HA 4KTTA 3GTJI 2UU9C 1YJNZ 1N33C 2YCBA 5A2QD 1TWHI 2V8IA 4G37A 2QR1B 1IBLC 4LF4C 4JI4C 3S1NI 3CMAZ 1N32C 1N2FA 1IBMC 1I94C 2JR6A 2H85A 1VQ4Z 1XRCA 2WP0C 5K85A 2F4MA 5H9UA 1IBKC 4DV0C 4DCTA 3IMLA 3HOXI 3S17I 2Q4ZA 2E7GA 3VMGA 2JNYA 3R44A 4A3MI 2PM9A 4D57A 3CCQ1 3CC7Z 3NYQA 1HR0C 4DQYB 4RM2A 1QVFZ 3P5JB 1RO4A 1TFIA 4NH1C 5IP7I 1Y1WI 1KD12 2YU9I 3GTMS 3EEDA 2O53A 1RO0A 1PA4A 3I561 4GXRA 4LF6C 1VQN1 3L95X 1USPA 1W2BY 2HJGA 1VQ8Z 4MONA 4DR7C 1R9TI 4A3GI 1YJ91 2QVXX 3MONA 4NBBA 3G6E1 4DG9A 3J7A4 1X3ZA 4I9GA 4X66C 1EGAA 3CCQZ 5BR8C 3PESA 1TWAI 3G4S1 4G1IA 2VQFC 2P3YA 2QLVB 2JA6I 3OW2Y 3IFUA 1RO2A 3CME1 3I56Z 2OZKA 5A1GA 4NBCA 1VQNZ 1PG4A 4DV2C 1X3WA 4LFAC 3CW8X 1YJ9Z 3ETCA 3G6EZ 3G711 1XNQC 1VQ91 1YUKA 1K9M2 3GTPI 3H3VJ 4KHPC 2PROA 2CY1A 1MXAA 4OYCA 2F4VC 4A3JI 3CCVZ 4DV1C 5K8FA 3F3PC 3G4SZ 3CCR1 1KC82 5AE2A 3EQ6A 1YIJZ 1ULTA 3HOVI 3CMEZ 5T67A 3S16I 2JA5I 4X62C 4E2WA 2XR1A 2QKDA 3G71Z 1VQ9Z 3MZLB 3GCFA 3CCE1 2WAQA 2E8CA 3GTGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 C;  1KKG A;  1HH2 P;  1NYE A;  2JMP A;  2UUA C;  5FLM I;  3ESW A;  2VQE C;  3S2H I;  2ONF A;  1TWC I;  4JI1 C;  3VB9 A;  1N34 C;  4DUZ C;  4YY3 C;  2NVT I;  3M4O I;  5LMN C;  2JA8 I;  3J80 D;  2NVX I;  3GTM I;  1XMO C;  3S1R I;  3K7A I;  1HNX C;  3VMH A;  3CJE A;  4LF9 C;  2AKL A;  5LMU C;  4NXN C;  4DR4 C;  3I4N I;  4DR5 C;  2BJO A;  3HOU I;  4DV4 C;  2F4O A;  1XNR C;  4AQY C;  3HOW I;  2ZM6 C;  4A3C I;  4QTT A;  3AF6 A;  1WW9 A;  4DV7 C;  4NB9 A;  2UXB C;  4GKK C;  3D6W A;  3GTL I;  2VUM I;  2R7Z I;  4K0K C;  2K5R A;  2OPL A;  3JAM D;  3RZD I;  1XMQ C;  4DV3 C;  1HNZ C;  2HHH C;  3S1Q I;  1VLA A;  4A3B I;  2DE5 A;  4BSZ A;  4DCS A;  4X64 C;  2ATW A;  5IT9 D;  2JA7 I;  1FJG C;  4BBS I;  1RLY A;  2DE6 A;  2E2I I;  2CXC A;  3I4M I;  4NBF A;  4DV6 C;  1USP B;  4JYA C;  1L1O C;  2R92 I;  2E8E A;  4JI8 C;  1WCM I;  3PO3 I;  4YHH C;  1I6H I;  4JI6 C;  1UKK A;  4B3S C;  1DL6 A;  2RBL A;  4OX9 C;  4X65 C;  5FLX D;  1NUI A;  3S1M I;  4DR3 C;  3J81 D;  3PO2 I;  1SFO I;  3Q87 A;  2DE7 A;  2UUC C;  4A3K I;  2NVY I;  4B3M C;  2B63 I;  2UXD C;  2PK7 A;  1WH9 A;  4XX2 A;  2NVQ I;  3S14 I;  3PO3 S;  1I50 I;  2D7V A;  2EGT A;  3GKQ A;  1QYP A;  4A3D I;  5CM2 M;  2PN2 A;  5IWA C;  3CQZ I;  4BXX I;  5C4X I;  4A3F I;  4JI5 C;  1JOS A;  4DR2 C;  4JV5 C;  4BY1 I;  1YUA A;  2UXC C;  1WF3 A;  2DYJ A;  3S15 I;  2UUB C;  4A93 I;  4A3L I;  2KZF A;  4B3R C;  1ZB8 A;  1Y1V S;  4Y52 I;  3HOZ I;  1MKY A;  1K83 I;  1K0R A;  3T1Y C;  4Y7N I;  1L2F A;  3OTO C;  1I3Q I;  2R93 I;  4NBD A;  5IP9 I;  2E2J I;  2OPL B;  5C44 I;  4B3T C;  1N36 C;  2E8F A;  1QWI A;  3H0G I;  3LUS A;  4LFB C;  3HOY I;  3GKU A;  3R9X A;  1ZB9 A;  3R9W A;  4LF8 C;  4MH4 A;  4BY7 I;  3I07 A;  4NBA A;  4DUY C;  2HF1 A;  2E2H I;  3M3Y I;  3AF5 A;  4LFC C;  3GTQ I;  2J6A A;  4NBE A;  3U50 C;  1LQL A;  5C3E I;  4JI2 C;  4QTU A;  3IEV A;  4JI3 C;  3VMI A;  3IEU A;  4DCU A;  4A3E I;  1J5E C;  2JS4 A;  3GTO I;  2QL8 A;  4NXM C;  4A3I I;  4GKJ C;  1Y1V I;  5C4J I;  4NBH A;  2KPI A;  1TWG I;  1PFT A;  4DR1 C;  4DCV A;  4NB8 A;  2PT7 G;  3EER A;  4MTN A;  4JI7 C;  2ASB A;  1TWF I;  3FKI I;  4LF7 C;  4BBR I;  3S2D I;  1ML8 A;  3T1H C;  4NBG A;  4DR6 C;  3GTK I;  4NOZ A;  4LF5 C;  4X6A I;  3RZO I;  4JI0 C;  2E5L C;  1HNW C;  2UU9 C;  3GTJ I;  1N33 C;  2YCB A;  5A2Q D;  1TWH I;  1IBL C;  4LF4 C;  4JI4 C;  3S1N I;  1N32 C;  1N2F A;  1IBM C;  1I94 C;  2JR6 A;  2F4M A;  1IBK C;  4DV0 C;  4DCT A;  3HOX I;  3S17 I;  2E7G A;  3VMG A;  2JNY A;  4A3M I;  1HR0 C;  1RO4 A;  1TFI A;  5IP7 I;  1Y1W I;  2YU9 I;  3GTM S;  1PA4 A;  4LF6 C;  1USP A;  4DR7 C;  2HJG A;  1R9T I;  4A3G I;  4NBB A;  1X3Z A;  4X66 C;  1EGA A;  5BR8 C;  1TWA I;  2VQF C;  2P3Y A;  2JA6 I;  4NBC A;  4DV2 C;  1X3W A;  4LFA C;  1XNQ C;  3H3V J;  3GTP I;  4KHP C;  2F4V C;  2CY1 A;  4A3J I;  4DV1 C;  3HOV I;  3S16 I;  2JA5 I;  4X62 C;  2XR1 A;  3GCF A;  2E8C A;  3GTG I; 
#chains in the Genus database with same CATH topology
 3CCR Z;  4DV5 C;  2P20 A;  1KKG A;  1MDF A;  3J80 f;  2VPZ A;  1HH2 P;  1NYE A;  2QVZ X;  2JMP A;  4L2Z A;  4E32 A;  2UUA C;  3J80 b;  3MZK B;  1QF8 A;  1MD9 A;  3UOW A;  2P02 A;  3IPL A;  1RG9 A;  3CCE Z;  4RVH A;  1YJ7 A;  5KEI A;  1KC8 1;  5FLM I;  3ESW A;  3C5E A;  5D1O A;  1FLO A;  2VQE C;  3S2H I;  2ONF A;  1P7L A;  2M6N A;  3T4N B;  3UX2 A;  1TWC I;  4JI1 C;  3A25 A;  1VQM 1;  3VB9 A;  1P4E A;  1N34 C;  1YJW 1;  4DUZ C;  1M6X C;  2Y27 A;  2NVT I;  3M4O I;  4YY3 C;  5LMN C;  4GS5 A;  2V7B A;  5DV9 A;  2DPL A;  2JA8 I;  2MMA B;  3NH4 A;  2KI7 B;  1FDO A;  4DGL A;  5A19 A;  5GTD A;  4PZP A;  3J80 D;  1QVG Y;  3PRO C;  2NCL A;  1VQM Z;  1YJW Z;  3I55 1;  2NVX I;  3UZ0 A;  4U5Y D;  3KIH A;  1M1K 2;  3CC4 1;  4DK1 A;  3KIF A;  2Y0S A;  3GTM I;  3A4I A;  3NDJ A;  3S1R I;  2P2J A;  4GXQ A;  3S82 A;  2IZ3 A;  3K7A I;  1MXB A;  4PHT A;  4E31 A;  5BST A;  5KYV A;  1HNX C;  3VMH A;  3CJE A;  2YWC A;  1JJ2 Y;  4LF9 C;  3CCS 1;  3AY0 A;  1NJI 2;  2AKL A;  3CMA 1;  5LMU C;  2JUB A;  1LCI A;  2BH1 X;  4NXN C;  4L4Q A;  4ISB A;  2HU9 A;  3TR3 A;  2QW0 X;  3DAY A;  3I4N I;  2AYA A;  3I55 Z;  1K73 2;  2QA4 1;  2LEX A;  1Q7Y 2;  2BJO A;  2DHM A;  4KTV A;  4DR5 C;  3CC4 Z;  1ZH1 A;  3HOU I;  3HKZ A;  3ETO A;  2JNV A;  3NI2 A;  5BUS A;  4DV4 C;  2F4O A;  4E30 A;  1PG3 A;  3JAM b;  3N54 B;  1XNR C;  4AQY C;  4MD9 A;  3HOW I;  4PUG A;  3CCS Z;  2ZM6 C;  4A3C I;  4D4I A;  4QTT A;  5BUR A;  3CC7 1;  3AF6 A;  1WW9 A;  4DV7 C;  2YX1 A;  3A26 A;  1M1K 1;  1QM4 A;  2QA4 Z;  2D1S A;  4NB9 A;  4G36 A;  2UXB C;  2QRC B;  2CU6 A;  1XHJ A;  4GKK C;  3D6W A;  3GTL I;  1VQ8 1;  1VQ7 1;  3TUF A;  2JIR A;  5AE3 A;  1JWH C;  4E2Z A;  2E9H A;  2P2B A;  1W2B Z;  4IZ6 A;  2W04 A;  2VUM I;  1WII A;  2R7Z I;  4K0K C;  1Q7Y 1;  2K5R A;  2OPL A;  3GR0 A;  3JAM D;  1V25 A;  3RZD I;  3E7W A;  1XMQ C;  4DV3 C;  1HNZ C;  2GU2 A;  2HHH C;  3S1Q I;  1VLA A;  4RS4 A;  4A3B I;  5BSU A;  1M6X A;  4L7I A;  2QRE B;  3OW2 Z;  2DE5 A;  1VQ7 Z;  4BSZ A;  3LAX A;  4DCS A;  2QVY X;  4X64 C;  2ATW A;  5IT9 D;  3VNS A;  1FDI A;  1VQL Z;  3CCJ Z;  3FQQ A;  2JA7 I;  3IF8 A;  3TQI A;  3D9X A;  3CCV 1;  2KZ0 A;  3CPW Y;  1FJG C;  4BBS I;  1RLY A;  2DE6 A;  2E2I I;  5KYT A;  2CXC A;  3I4M I;  1YIJ 1;  3CCU Z;  1VQO 1;  1O90 A;  4RVN A;  4R1M A;  4NBF A;  4DV6 C;  2ZZN A;  5FLX f;  4EAT A;  1USP B;  4JYA C;  1RNI A;  2KDN A;  1L1O C;  2R92 I;  3VNR A;  5CZV A;  1KD1 1;  4HGZ A;  5JRH A;  5FLX b;  4BC7 A;  2E8E A;  1KQS Y;  1X0T A;  4JI8 C;  1VQO Z;  5LCI A;  1Q16 A;  2W03 A;  1WCM I;  1Z01 A;  5T64 A;  3J81 b;  1SIW A;  3PO3 I;  4YHH C;  1I6H I;  2JMO A;  4DG8 A;  4OXI A;  4AYB A;  4JI6 C;  2D1Q A;  1UKK A;  2P2Q A;  4B3S C;  3RG2 A;  1DL6 A;  4FUQ A;  2RBL A;  4RLQ A;  4OX9 C;  1M90 2;  4PRO C;  2QEX 1;  4X65 C;  5FLX D;  1VQ5 1;  1K9M 1;  1NUI A;  1V26 A;  3NH5 A;  2LIY A;  3S1M I;  5E7Q A;  4HGY A;  4DR3 C;  3J81 D;  3PO2 I;  2VZE A;  5AE1 A;  1SFO I;  3A9U A;  3Q87 A;  2MCQ A;  2DE7 A;  2QEX Z;  1T5H X;  2OBV A;  4BCA A;  3UX3 A;  1QVG Z;  4JM1 A;  2VF1 A;  4RV9 A;  2UUC C;  4A3K I;  1VQ5 Z;  2NVY I;  3VTN A;  4BC9 A;  4B3M C;  3G7S A;  2B63 I;  2UXD C;  3CC2 1;  1N8R 2;  1T5D X;  2RPR A;  1M90 1;  2PK7 A;  3N2Q A;  1VQ6 1;  1WH9 A;  2VPW A;  1AMU A;  4K0B A;  5D1O B;  5BSR A;  1WJ2 A;  4XX2 A;  1JJ2 Z;  2NVQ I;  3S14 I;  4RLF A;  1KRL A;  2V3V A;  3PO3 S;  2YWB A;  1I50 I;  2D7V A;  2EGT A;  2OOX B;  4HH4 A;  3GKQ A;  1QYP A;  2WD9 A;  1NP6 A;  1Z02 A;  2OTJ 1;  3CC2 Z;  4LE5 A;  4WS9 A;  4A3D I;  5D1P A;  3A9V A;  5CM2 M;  2D27 A;  2PN2 A;  5IFI A;  5IWA C;  1VQ6 Z;  5ADZ A;  3CQZ I;  4BXX I;  3NH8 A;  2OOY B;  2D28 C;  3JAM f;  3PBK A;  5C4X I;  4A3F I;  4JI5 C;  1N8R 1;  1JOS A;  4HPV A;  2OTJ Z;  4DR2 C;  3CXC Y;  1RQF A;  4JV5 C;  1YIT 1;  3E7X A;  4BY1 I;  4RMN A;  5IT9 f;  1YUA A;  2UXC C;  1WF3 A;  1VQP 1;  2Y4N A;  2V8K A;  3NDI A;  3NYR A;  2DYJ A;  4E33 A;  3S15 I;  4RVO A;  4RM3 A;  2UUB C;  5IT9 b;  2OTL 1;  3FCC A;  4A93 I;  1MXC A;  2RHB A;  4I9F A;  3B7W A;  4ZLP A;  1YIT Z;  1XS3 A;  1NJI 1;  4A3L I;  2Q51 A;  3DHV A;  2VPX A;  2KZF A;  1XMO C;  1Q86 2;  1VQL 1;  4B3R C;  1ZB8 A;  3CCJ 1;  3RV2 A;  1Y1V S;  4Y52 I;  3IX0 A;  3HOZ I;  1VQP Z;  2VPY A;  4RVD A;  3L8C A;  1MKY A;  1K73 1;  2D1R A;  1K83 I;  3TDE A;  3CQ2 A;  4ZJZ A;  1K0R A;  3T1Y C;  2OTL Z;  3CCM Z;  3CCU 1;  3CPW Z;  1FUG A;  3CQ3 A;  2ZZM A;  4Y7N I;  1AA6 A;  4BBY A;  1L2F A;  3LGX A;  3OTO C;  4ODJ A;  2LFU A;  3H2T A;  2VSQ A;  2GTI A;  1I3Q I;  1BA3 A;  4PUH A;  2M5H A;  2R93 I;  4NBD A;  1YHQ 1;  2JIM A;  5IP9 I;  2JIQ A;  1O9T A;  2QRD B;  4NDN A;  2E2J I;  2OPL B;  3CQ1 A;  5C44 I;  3TDH B;  5BUQ A;  4B3T C;  1N36 C;  1Q86 1;  3CCL 1;  2JIP A;  1K8A 2;  1KQS Z;  2E8F A;  1P4E C;  1QWI A;  4WV3 A;  3H0G I;  3LUS A;  2R6M A;  1V60 A;  3SO4 A;  4TNU A;  4LFB C;  3HOY I;  2D1T A;  3GR1 A;  3GKU A;  4D4G A;  1YHQ Z;  3R9X A;  1QVF Y;  1ZB9 A;  1QXF A;  3J81 f;  3IR7 A;  2V8J A;  3R9W A;  4E2X A;  4LF8 C;  2P28 A;  4MH4 A;  4BY7 I;  3I07 A;  4NBA A;  4DUY C;  2HF1 A;  2E2H I;  3M3Y I;  3CCL Z;  2E7Z A;  3AF5 A;  4R0M A;  4LFC C;  3GTQ I;  2J6A A;  4R1L A;  4NBE A;  3U50 C;  2ZAE B;  2PMZ A;  1LQL A;  2P2M A;  3NFZ A;  3CW9 A;  3I08 A;  3K6R A;  4S1T A;  5C3E I;  4JI2 C;  5T6B A;  1K8A 1;  4QTU A;  3IEV A;  4JI3 C;  4FTF A;  2AYD A;  1MDB A;  3VMI A;  3IEU A;  4DCU A;  1Q82 2;  3UEB A;  4CL1 A;  3CD6 1;  4A3E I;  3F3F C;  1YI2 1;  4E2Y A;  2RIQ A;  4TPS B;  1J5E C;  2GTH A;  4RVG A;  2JS4 A;  3GTO I;  2QL8 A;  1XRA A;  4NXM C;  1VQK 1;  2E0G A;  1Q81 2;  4FUT A;  4MXU A;  4A3I I;  1S7M A;  2IV2 X;  3CD6 Z;  1YI2 Z;  1S72 1;  4GKJ C;  1Y1V I;  4MRI A;  5C4J I;  1P9N A;  1Y8C A;  4NBH A;  4IR7 A;  2IZ4 A;  1UWD A;  5T8T A;  2KPI A;  3VNQ A;  3KXW A;  1TWG I;  1PFT A;  4MD8 A;  3QWU A;  1VQK Z;  1Q82 1;  1O92 A;  3TE5 B;  1XRB A;  3FCE A;  1RY2 A;  2Z51 A;  5CZX A;  4DCV A;  4DR1 C;  4NB8 A;  2I3C A;  3CXC Z;  1S72 Z;  4D56 A;  5A2Q f;  2PT7 G;  4NFR A;  3BG0 B;  3EER A;  2P2F A;  1NY8 A;  4MTN A;  4JI7 C;  3LNV A;  4DR4 C;  1Q81 1;  2G2K A;  3GPC A;  2ASB A;  1TWF I;  5A2Q b;  2Y4O A;  5BSV A;  3FKI I;  5LL6 f;  4LF7 C;  3NPD A;  4BBR I;  3S2D I;  1ML8 A;  4PUI A;  2RT9 A;  2YAD A;  1YJN 1;  1GPM A;  2VUG A;  4EWC A;  2WB1 A;  3O2E A;  5BSW A;  3FQM A;  5AN9 F;  3T1H C;  2V45 A;  4NBG A;  4DR6 C;  1O93 A;  5BSM A;  3DLP X;  5A1I A;  4RVF A;  3GTK I;  4NOZ A;  4LF5 C;  2M48 A;  4X6A I;  3CCM 1;  3BG1 B;  3RZO I;  2JIO A;  4MD7 A;  1Z03 A;  1VQ4 1;  2OO4 A;  4JI0 C;  2K3R A;  5T8S A;  2E5L C;  1HNW C;  2O4H A;  4KTT A;  3GTJ I;  2UU9 C;  1YJN Z;  1N33 C;  2YCB A;  5A2Q D;  1TWH I;  2V8I A;  4G37 A;  2MM9 A;  2QR1 B;  1IBL C;  4LF4 C;  4JI4 C;  3S1N I;  3CMA Z;  1N32 C;  1N2F A;  1IBM C;  1I94 C;  2JR6 A;  2H85 A;  1VQ4 Z;  1XRC A;  2WP0 C;  5K85 A;  2F4M A;  5H9U A;  1IBK C;  4DV0 C;  4DCT A;  3IML A;  3HOX I;  3S17 I;  2Q4Z A;  2E7G A;  3VMG A;  2JNY A;  3R44 A;  4A3M I;  2PM9 A;  4D57 A;  3CCQ 1;  3CC7 Z;  3NYQ A;  1HR0 C;  4DQY B;  4RM2 A;  1QVF Z;  3P5J B;  1RO4 A;  1TFI A;  4NH1 C;  5IP7 I;  1Y1W I;  1KD1 2;  2YU9 I;  3GTM S;  3EED A;  2O53 A;  1TH5 A;  1RO0 A;  1PA4 A;  3I56 1;  4GXR A;  4LF6 C;  1VQN 1;  3L95 X;  1USP A;  1W2B Y;  2HJG A;  1VQ8 Z;  4MON A;  4DR7 C;  1R9T I;  4A3G I;  1YJ9 1;  2QVX X;  3MON A;  4NBB A;  3G6E 1;  2M5O A;  4DG9 A;  3J7A 4;  1X3Z A;  2NAP A;  4I9G A;  1VEH A;  4X66 C;  1EGA A;  3CCQ Z;  5BR8 C;  3PES A;  1TWA I;  3G4S 1;  4G1I A;  2VQF C;  2P3Y A;  2QLV B;  2JA6 I;  1IB8 A;  3OW2 Y;  3IFU A;  1RO2 A;  3CME 1;  3I56 Z;  2OZK A;  5A1G A;  4NBC A;  1VQN Z;  1PG4 A;  4DV2 C;  1X3W A;  1WCJ A;  4LFA C;  3CW8 X;  1YJ9 Z;  3ETC A;  3G6E Z;  3G71 1;  1XNQ C;  1VQ9 1;  1YUK A;  3D2L A;  1K9M 2;  1WZN A;  3GTP I;  3H3V J;  4KHP C;  3LNO A;  2PRO A;  2CY1 A;  1MXA A;  4OYC A;  2F4V C;  4A3J I;  3CCV Z;  4DV1 C;  5K8F A;  3F3P C;  3G4S Z;  3CCR 1;  1KC8 2;  5AE2 A;  3EQ6 A;  1YIJ Z;  1ULT A;  3HOV I;  3CME Z;  5T67 A;  3S16 I;  2JA5 I;  4X62 C;  4E2W A;  2XR1 A;  2QKD A;  3G71 Z;  1VQ9 Z;  3MZL B;  3GCF A;  1PU1 A;  3CCE 1;  2WAQ A;  2E8C A;  3GTG I; 
#chains in the Genus database with same CATH homology
 3CCR Z;  4DV5 C;  2P20 A;  1KKG A;  1MDF A;  3J80 f;  1HH2 P;  1NYE A;  2QVZ X;  2JMP A;  4L2Z A;  4E32 A;  2UUA C;  3J80 b;  3MZK B;  1QF8 A;  1MD9 A;  3UOW A;  2P02 A;  3IPL A;  1RG9 A;  3CCE Z;  4RVH A;  1YJ7 A;  5KEI A;  1KC8 1;  5FLM I;  3ESW A;  3C5E A;  5D1O A;  2VQE C;  3S2H I;  2ONF A;  1P7L A;  2M6N A;  3T4N B;  1TWC I;  4JI1 C;  1VQM 1;  3VB9 A;  1N34 C;  1YJW 1;  4DUZ C;  2Y27 A;  2NVT I;  3M4O I;  4YY3 C;  5LMN C;  4GS5 A;  2V7B A;  5DV9 A;  2DPL A;  2JA8 I;  3NH4 A;  2KI7 B;  4DGL A;  5A19 A;  5GTD A;  4PZP A;  3J80 D;  1QVG Y;  3PRO C;  1VQM Z;  1YJW Z;  3I55 1;  2NVX I;  3UZ0 A;  4U5Y D;  3KIH A;  1M1K 2;  3CC4 1;  4DK1 A;  3KIF A;  2Y0S A;  3GTM I;  3A4I A;  3NDJ A;  3S1R I;  2P2J A;  4GXQ A;  3S82 A;  2IZ3 A;  3K7A I;  1MXB A;  4PHT A;  4E31 A;  5BST A;  5KYV A;  1HNX C;  3VMH A;  3CJE A;  2YWC A;  1JJ2 Y;  4LF9 C;  3CCS 1;  1NJI 2;  2AKL A;  3CMA 1;  5LMU C;  2JUB A;  1LCI A;  2BH1 X;  4NXN C;  4L4Q A;  4ISB A;  2HU9 A;  4DR4 C;  2QW0 X;  3DAY A;  3I4N I;  2AYA A;  3I55 Z;  1K73 2;  2QA4 1;  1Q7Y 2;  4KTV A;  2BJO A;  4DR5 C;  3CC4 Z;  1ZH1 A;  3HOU I;  3HKZ A;  3ETO A;  3NI2 A;  5BUS A;  4DV4 C;  2F4O A;  4E30 A;  1PG3 A;  3JAM b;  3N54 B;  1XNR C;  4AQY C;  4MD9 A;  3HOW I;  3CCS Z;  2ZM6 C;  4A3C I;  4D4I A;  4QTT A;  5BUR A;  3CC7 1;  3AF6 A;  1WW9 A;  4DV7 C;  1M1K 1;  1QM4 A;  2QA4 Z;  2D1S A;  4NB9 A;  4G36 A;  2UXB C;  2QRC B;  4GKK C;  3D6W A;  3GTL I;  1VQ8 1;  1VQ7 1;  3TUF A;  5AE3 A;  1JWH C;  4E2Z A;  2E9H A;  2P2B A;  1W2B Z;  4IZ6 A;  2W04 A;  2VUM I;  1WII A;  2R7Z I;  4K0K C;  1Q7Y 1;  2K5R A;  2OPL A;  3GR0 A;  3JAM D;  1V25 A;  3RZD I;  3E7W A;  1XMQ C;  4DV3 C;  1HNZ C;  2GU2 A;  2HHH C;  3S1Q I;  1VLA A;  4RS4 A;  4A3B I;  5BSU A;  4L7I A;  2QRE B;  3OW2 Z;  2DE5 A;  1VQ7 Z;  4BSZ A;  3LAX A;  4DCS A;  2QVY X;  4X64 C;  2ATW A;  5IT9 D;  3VNS A;  1VQL Z;  3CCJ Z;  3FQQ A;  2JA7 I;  3IF8 A;  3TQI A;  3D9X A;  3CCV 1;  3CPW Y;  1FJG C;  4BBS I;  1RLY A;  2DE6 A;  2E2I I;  5KYT A;  2CXC A;  3I4M I;  1YIJ 1;  3CCU Z;  1VQO 1;  1O90 A;  4RVN A;  4R1M A;  4NBF A;  4DV6 C;  5FLX f;  4EAT A;  1USP B;  4JYA C;  1RNI A;  1L1O C;  2R92 I;  3VNR A;  5CZV A;  1KD1 1;  4HGZ A;  5JRH A;  5FLX b;  4BC7 A;  2E8E A;  1KQS Y;  1X0T A;  4JI8 C;  1VQO Z;  2W03 A;  1WCM I;  1Z01 A;  5T64 A;  3J81 b;  3PO3 I;  4YHH C;  1I6H I;  2JMO A;  4DG8 A;  4OXI A;  4AYB A;  4JI6 C;  2D1Q A;  1UKK A;  2P2Q A;  4B3S C;  3RG2 A;  1DL6 A;  4FUQ A;  2RBL A;  4RLQ A;  4OX9 C;  1M90 2;  4PRO C;  2QEX 1;  4X65 C;  5FLX D;  1VQ5 1;  1K9M 1;  1NUI A;  1V26 A;  3NH5 A;  2LIY A;  3S1M I;  5E7Q A;  4HGY A;  4DR3 C;  3J81 D;  3PO2 I;  2VZE A;  5AE1 A;  1SFO I;  3A9U A;  3Q87 A;  2DE7 A;  2QEX Z;  1T5H X;  2OBV A;  4BCA A;  1QVG Z;  4JM1 A;  2VF1 A;  4RV9 A;  2UUC C;  4A3K I;  1VQ5 Z;  2NVY I;  3VTN A;  4BC9 A;  4B3M C;  3G7S A;  2B63 I;  2UXD C;  3CC2 1;  1N8R 2;  1T5D X;  2RPR A;  1M90 1;  2PK7 A;  3N2Q A;  1VQ6 1;  1WH9 A;  1AMU A;  4K0B A;  5D1O B;  5BSR A;  4XX2 A;  1JJ2 Z;  2NVQ I;  3S14 I;  4RLF A;  1KRL A;  3PO3 S;  2YWB A;  1I50 I;  2D7V A;  2EGT A;  2OOX B;  4HH4 A;  3GKQ A;  1QYP A;  2WD9 A;  1NP6 A;  1Z02 A;  2OTJ 1;  3CC2 Z;  4LE5 A;  4WS9 A;  4A3D I;  5D1P A;  3A9V A;  5CM2 M;  2D27 A;  2PN2 A;  5IFI A;  5IWA C;  1VQ6 Z;  5ADZ A;  3CQZ I;  4BXX I;  3NH8 A;  2OOY B;  2D28 C;  3JAM f;  3PBK A;  5C4X I;  4A3F I;  4JI5 C;  1N8R 1;  1JOS A;  4HPV A;  2OTJ Z;  4DR2 C;  3CXC Y;  1RQF A;  4JV5 C;  1YIT 1;  3E7X A;  4BY1 I;  4RMN A;  5IT9 f;  1YUA A;  2UXC C;  1WF3 A;  1VQP 1;  2Y4N A;  2V8K A;  3NDI A;  3NYR A;  2DYJ A;  4E33 A;  3S15 I;  4RVO A;  4RM3 A;  2UUB C;  5IT9 b;  2OTL 1;  3FCC A;  4A93 I;  1MXC A;  2RHB A;  4I9F A;  3B7W A;  4ZLP A;  1YIT Z;  1NJI 1;  4A3L I;  2Q51 A;  3DHV A;  2KZF A;  4B3R C;  1XMO C;  1Q86 2;  1VQL 1;  1ZB8 A;  3CCJ 1;  3RV2 A;  1Y1V S;  4Y52 I;  3IX0 A;  3HOZ I;  1VQP Z;  4RVD A;  3L8C A;  1MKY A;  1K73 1;  2D1R A;  1K83 I;  3TDE A;  4ZJZ A;  1K0R A;  3T1Y C;  2OTL Z;  3CCM Z;  3CCU 1;  3CPW Z;  1FUG A;  4Y7N I;  4BBY A;  1L2F A;  3LGX A;  3OTO C;  4ODJ A;  2LFU A;  3H2T A;  2VSQ A;  2GTI A;  1I3Q I;  1BA3 A;  2R93 I;  4NBD A;  1YHQ 1;  5IP9 I;  1O9T A;  2QRD B;  4NDN A;  2E2J I;  2OPL B;  5BUQ A;  5C44 I;  3TDH B;  4B3T C;  1N36 C;  1Q86 1;  3CCL 1;  1KQS Z;  1K8A 2;  2E8F A;  1QWI A;  4WV3 A;  3H0G I;  3LUS A;  2R6M A;  3SO4 A;  4TNU A;  4LFB C;  3HOY I;  2D1T A;  3GR1 A;  3GKU A;  4D4G A;  1YHQ Z;  3R9X A;  1QVF Y;  1ZB9 A;  3J81 f;  2V8J A;  3R9W A;  4E2X A;  4LF8 C;  2P28 A;  4MH4 A;  4BY7 I;  3I07 A;  4NBA A;  4DUY C;  2HF1 A;  2E2H I;  3M3Y I;  3CCL Z;  4R0M A;  3AF5 A;  4LFC C;  3GTQ I;  2J6A A;  4R1L A;  4NBE A;  3U50 C;  2ZAE B;  2PMZ A;  1LQL A;  2P2M A;  3NFZ A;  3CW9 A;  3I08 A;  4S1T A;  5C3E I;  4JI2 C;  5T6B A;  1K8A 1;  4QTU A;  3IEV A;  4JI3 C;  4FTF A;  1MDB A;  3VMI A;  3IEU A;  4DCU A;  1Q82 2;  4CL1 A;  3CD6 1;  4A3E I;  3F3F C;  1YI2 1;  4E2Y A;  2RIQ A;  4TPS B;  1J5E C;  2GTH A;  4RVG A;  2JS4 A;  3GTO I;  2QL8 A;  1XRA A;  4NXM C;  1VQK 1;  2E0G A;  1Q81 2;  4FUT A;  4MXU A;  4A3I I;  1S7M A;  3CD6 Z;  1YI2 Z;  1S72 1;  4GKJ C;  1Y1V I;  4MRI A;  5C4J I;  1P9N A;  4NBH A;  4IR7 A;  2IZ4 A;  5T8T A;  2KPI A;  3VNQ A;  3KXW A;  1TWG I;  1PFT A;  4MD8 A;  3QWU A;  1VQK Z;  1Q82 1;  1O92 A;  3TE5 B;  1XRB A;  3FCE A;  1RY2 A;  5CZX A;  4DCV A;  4DR1 C;  4NB8 A;  2I3C A;  3CXC Z;  1S72 Z;  4D56 A;  5A2Q f;  2PT7 G;  4NFR A;  3BG0 B;  3EER A;  2P2F A;  4MTN A;  4JI7 C;  3LNV A;  1Q81 1;  2G2K A;  3GPC A;  2ASB A;  1TWF I;  5A2Q b;  2Y4O A;  5BSV A;  3FKI I;  5LL6 f;  4LF7 C;  3NPD A;  4BBR I;  3S2D I;  1ML8 A;  2RT9 A;  2YAD A;  1YJN 1;  1GPM A;  2VUG A;  4EWC A;  2WB1 A;  5BSW A;  3FQM A;  5AN9 F;  3T1H C;  4NBG A;  4DR6 C;  1O93 A;  5BSM A;  3DLP X;  5A1I A;  4RVF A;  3GTK I;  4NOZ A;  4LF5 C;  2M48 A;  4X6A I;  3CCM 1;  3BG1 B;  3RZO I;  4MD7 A;  1Z03 A;  1VQ4 1;  2OO4 A;  4JI0 C;  2K3R A;  5T8S A;  2E5L C;  1HNW C;  2O4H A;  4KTT A;  3GTJ I;  2UU9 C;  1YJN Z;  1N33 C;  2YCB A;  5A2Q D;  1TWH I;  2V8I A;  4G37 A;  2QR1 B;  1IBL C;  4LF4 C;  4JI4 C;  3S1N I;  3CMA Z;  1N32 C;  1N2F A;  1IBM C;  1I94 C;  2JR6 A;  2H85 A;  1VQ4 Z;  1XRC A;  2WP0 C;  5K85 A;  2F4M A;  5H9U A;  1IBK C;  4DV0 C;  4DCT A;  3IML A;  3HOX I;  3S17 I;  2Q4Z A;  2E7G A;  3VMG A;  2JNY A;  3R44 A;  4A3M I;  2PM9 A;  4D57 A;  3CCQ 1;  3CC7 Z;  3NYQ A;  1HR0 C;  4DQY B;  4RM2 A;  1QVF Z;  3P5J B;  1RO4 A;  1TFI A;  4NH1 C;  5IP7 I;  1Y1W I;  1KD1 2;  2YU9 I;  3GTM S;  3EED A;  2O53 A;  1RO0 A;  1PA4 A;  3I56 1;  4GXR A;  4LF6 C;  1VQN 1;  3L95 X;  1USP A;  1W2B Y;  2HJG A;  1VQ8 Z;  4MON A;  4DR7 C;  1R9T I;  4A3G I;  1YJ9 1;  2QVX X;  3MON A;  4NBB A;  3G6E 1;  4DG9 A;  3J7A 4;  1X3Z A;  4I9G A;  4X66 C;  1EGA A;  3CCQ Z;  5BR8 C;  3PES A;  1TWA I;  3G4S 1;  4G1I A;  2VQF C;  2P3Y A;  2QLV B;  2JA6 I;  3OW2 Y;  3IFU A;  1RO2 A;  3CME 1;  3I56 Z;  2OZK A;  5A1G A;  4NBC A;  1VQN Z;  1PG4 A;  4DV2 C;  1X3W A;  4LFA C;  3CW8 X;  1YJ9 Z;  3ETC A;  3G6E Z;  3G71 1;  1XNQ C;  1VQ9 1;  1YUK A;  1K9M 2;  3GTP I;  3H3V J;  4KHP C;  2PRO A;  2CY1 A;  1MXA A;  4OYC A;  2F4V C;  4A3J I;  3CCV Z;  4DV1 C;  5K8F A;  3F3P C;  3G4S Z;  3CCR 1;  1KC8 2;  5AE2 A;  3EQ6 A;  1YIJ Z;  1ULT A;  3HOV I;  3CME Z;  5T67 A;  3S16 I;  2JA5 I;  4X62 C;  4E2W A;  2XR1 A;  2QKD A;  3G71 Z;  1VQ9 Z;  3MZL B;  3GCF A;  3CCE 1;  2WAQ A;  2E8C A;  3GTG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...