1VLAA

Crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
144
structure length
144
Chain Sequence
HHHHHHMQARWIGNMMFHVRTDSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVIDQMKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEKYCSVSAILKCSSKVTYEIVYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords Hydroperoxide resistance protein OsmC
total genus 34
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vlaA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1vlaA02
1PFTA 2JNYA 3S1QI 1HH2P 2E2HI 1N2FA 4LF5C 3K7AI 1N32C 1XMOC 5C3EI 2E2II 4LF7C 2JA6I 3FKII 2E8CA 1N34C 4QTUA 2F4OA 2J6AA 3M3YI 4X66C 4DR2C 4NBBA 1PA4A 2EGTA 4A3MI 1WF3A 5FLXD 3VMHA 4NOZA 4DCSA 4JI4C 1SFOI 4BBSI 2JS4A 2BJOA 3HOVI 1L2FA 1MKYA 5BR8C 3GTPI 2F4VC 3VB9A 3I4MI 1WCMI 1JOSA 2HJGA 4YY3C 1ZB9A 3S17I 4DV6C 1XNQC 1TWHI 2JA5I 4DR7C 1K0RA 1RLYA 2UUBC 4X6AI 2D7VA 4DV2C 2OPLA 2R92I 3HOXI 3S16I 2JR6A 4DR1C 4JI1C 4DUZC 2R93I 3VMIA 4X62C 3H3VJ 1HR0C 1YUAA 4BY1I 2DYJA 4A3CI 2ATWA 2KZFA 1Y1WI 2E8EA 3J80D 4DUYC 4JI8C 4NBAA 4JI7C 4A93I 1TWGI 4Y7NI 4YHHC 3S2DI 3I07A 3J81D 3HOUI 5C4XI 4LF6C 4NBCA 3CJEA 5A2QD 4JYAC 1N33C 2E8FA 5IP9I 4JI3C 4DR5C 1HNWC 3PO3I 3R9XA 4DCVA 2ASBA 2HF1A 4NBHA 4NXMC 3ESWA 3S1RI 1NYEA 1TWAI 2NVXI 3S14I 1RO4A 4BSZA 2ZM6C 2UUCC 4JI2C 1TWFI 4A3FI 1I6HI 3GCFA 3S1MI 1XNRC 3HOWI 1IBLC 1QYPA 4NB8A 4A3GI 3H0GI 3GTGI 4DR6C 3T1HC 4LFBC 4X65C 4A3LI 3T1YC 4JI6C 5C44I 1LQLA 3GKUA 4B3SC 2UXCC 3D6WA 2E2JI 2DE5A 3PO2I 2E7GA 2UU9C 4NBEA 1I3QI 4NBDA 4MTNA 3GTMS 2UUAC 3S2HI 2AKLA 1XMQC 4KHPC 2R7ZI 4BXXI 2K5RA 2E5LC 3LUSA 3JAMD 4LF9C 1L1OC 4A3II 3RZDI 1DL6A 1HNZC 1ML8A 3EERA 1QWIA 5C4JI 2NVYI 4Y52I 3GTJI 1USPB 3GTOI 3GTMI 2PK7A 2YU9I 4NBFA 1NUIA 3AF6A 4NXNC 1KKGA 2VUMI 2JA7I 2RBLA 3RZOI 2KPIA 4DV7C 4JV5C 4DV5C 3GTQI 1J5EC 4LF8C 3IEUA 3PO3S 1Y1VI 4XX2A 1N36C 2NVTI 4DCTA 2VQFC 4DV1C 3HOYI 4DV0C 4DV3C 1TWCI 1VLAA 1FJGC 1TFIA 2P3YA 3GTLI 1ZB8A 2XR1A 5LMNC 2JA8I 2UXDC 2OPLB 1I94C 4DCUA 1HNXC 4JI5C 4B3RC 3S1NI 4DV4C 4GKJC 4A3JI 3S15I 4BY7I 2JMPA 4JI0C 3Q87A 3U50C 4B3TC 2PT7G 3OTOC 4DR4C 1K83I 1X3WA 5FLMI 4A3KI 3CQZI 4NB9A 2YCBA 2CXCA 2VQEC 3IEVA 1WH9A 5IWAC 3AF5A 3HOZI 2HHHC 3I4NI 3R9WA 4GKKC 2QL8A 1Y1VS 4LFAC 1EGAA 2B63I 5IP7I 1I50I 2ONFA 5IT9D 1R9TI 1USPA 1UKKA 2NVQI 3VMGA 4DR3C 2F4MA 2DE6A 4B3MC 1IBKC 4BBRI 4QTTA 4MH4A 3M4OI 2PN2A 4X64C 2CY1A 5LMUC 4NBGA 1WW9A 4LFCC 4K0KC 1IBMC 4A3EI 4LF4C 2DE7A 3GKQA 5CM2M 4AQYC 1X3ZA 4A3DI 2UXBC 4OX9C 3GTKI 4A3BI
chains in the Genus database with same CATH superfamily
2LFUA 3S1QI 1T5DX 1N2FA 3NH5A 3GR1A 3CCE1 1W2BZ 3FKII 1N34C 1X0TA 4QTUA 1P7LA 2WAQA 2AYAA 3IFUA 4E2WA 2M48A 1PA4A 1YIJZ 2EGTA 4A3MI 4NOZA 4I9GA 5BSUA 1SFOI 2BJOA 3AY0A 5BR8C 1MKYA 3GTPI 2NCLA 3BG1B 3G7SA 4MD9A 1XNQC 3CW8X 1V26A 3G711 3MONA 1RY2A 2D27A 3ETOA 4FTFA 5AE2A 2R93I 3VMIA 5A2Qb 2PROA 1HR0C 1VQ6Z 4A3CI 4JI8C 4DUYC 2V8JA 4NBAA 1TWGI 4Y7NI 1TH5A 3RV2A 2VPXA 5D1OA 3HOUI 1RG9A 1VQ9Z 3K6RA 2VF1A 1QVFY 5IP9I 2E8FA 4JI3C 3PO3I 3R9XA 2P2QA 1Q822 3S1RI 2ZM6C 1HNWC 2YX1A 4KTVA 4A3FI 4RMNA 5KYVA 1XNRC 4A3GI 1Z03A 1O92A 1KD11 3JAMb 1FUGA 3T1YC 4A3LI 2QA41 1YIJ1 1MXCA 4G37A 2MCQA 1I3QI 1S7MA 3S2HI 2OTLZ 2JMOA 2WD9A 1YJ9Z 3CCJ1 3CMA1 4BXXI 4IZ6A 3JAMD 1DL6A 1HNZC 3VTNA 1ML8A 5IT9b 1M6XC 4E32A 3IPLA 1W2BY 3KIHA 4RS4A 3GTOI 2MMAB 2YU9I 4D4GA 2RBLA 3I56Z 4GS5A 3UX3A 5FLXf 1Q821 2JIOA 3CCQZ 1XS3A 1Y1VI 4XX2A 1N36C 3TQIA 1FJGC 1TWCI 5BSWA 1TFIA 3GTLI 3NYQA 3J80f 2H85A 4DQYB 5LMNC 2P2MA 2JA8I 2UXDC 1KQSY 2OPLB 1I94C 1MDBA 5IT9f 3S15I 2JMPA 1XRBA 3QWUA 2CU6A 4B3TC 3I55Z 1X3WA 3IEVA 1AA6A 2VQEC 5KYTA 4GXRA 4AYBA 1P9NA 2QA4Z 4MRIA 3A4IA 4L4QA 5T8SA 1Y1VS 4ISBA 2ONFA 1VQ41 3CCEZ 1LCIA 2KDNA 4G36A 1IBKC 4B3MC 2PN2A 4MH4A 1QVFZ 3A9VA 4RV9A 2CY1A 3CMAZ 1YJ91 4LF4C 3GKQA 4AQYC 3J80b 1VQ61 5D1OB 1Q811 4A3BI 5BSMA 3BG0B 2JNYA 2ZAEB 4RM2A 3CC71 3IX0A 2E7ZA 2JA6I 5A19A 2O53A 1XRCA 1WF3A 3TDHB 3VMHA 1KD12 4JI4C 1S72Z 1K8A1 1KQSZ 4BBSI 1GPMA 1L2FA 3C5EA 3VB9A 1WJ2A 2ZZNA 3CCM1 1M1K1 1ULTA 2DPLA 3CCR1 2M5HA 2JA5I 2Y4NA 1K0RA 2UUBC 3NH8A 3IF8A 3CD61 3HOXI 1V60A 4DR1C 4K0BA 3CD6Z 1JJ2Y 4FUTA 3NH4A 2ATWA 1PU1A 2KZFA 1Y1WI 4R1MA 4JI7C 4A93I 3S2DI 2DHMA 3J81D 2V45A 2D28C 1FLOA 3FCCA 2QRDB 1K9M2 2QEXZ 2I3CA 2Q51A 2WB1A 5A2QD 4DR5C 3TDEA 3CC7Z 2IZ3A 1K8A2 2QR1B 3A9UA 5A1GA 2HF1A 3ESWA 1NYEA 1QVGZ 5DV9A 3CC21 3S14I 2UUCC 4JI2C 2OTL1 1M1K2 1I6HI 3UOWA 3GCFA 3TR3A 5BSTA 2Y0SA 1S721 4FUQA 4X65C 5C44I 1LQLA 5A1IA 3NFZA 1YJWZ 5BSRA 2DE5A 4RVGA 3PO2I 3VNQA 1O9TA 4NBEA 2AKLA 4LE5A 4KHPC 2IV2X 2E5LC 4EWCA 1MD9A 3F3FC 2V8KA 1VQ81 3EERA 3CCRZ 5C4JI 4Y52I 1MXBA 2QVZX 1K9M1 2PK7A 4NBFA 3CCL1 1NUIA 4PUIA 5BUQA 2LEXA 3AF6A 1VQ5Z 2JA7I 4HGYA 1Q812 3CCLZ 5H9UA 3GTQI 3CCMZ 2WP0C 2Y4OA 4LF8C 1YI21 4DCTA 1Y8CA 2VQFC 5T6BA 3NDIA 5E7QA 1VLAA 4WS9A 2P3YA 1ZB8A 1FDIA 1Q862 3UEBA 3L95X 5CZVA 3D9XA 4DV4C 4BY7I 4JI0C 3U50C 1PG3A 4NH1C 5FLMI 4OXIA 1UWDA 2YCBA 2JIPA 3NI2A 1WH9A 3G71Z 3TE5B 1VQO1 5IWAC 1VQNZ 3HOZI 1VQM1 2Y27A 3R9WA 2D1TA 2IZ4A 3N2QA 1VQL1 4RLFA 1I50I 3CCU1 1YJ7A 3G6E1 1UKKA 3S82A 5AN9F 1XRAA 4PROC 4DGLA 2DE6A 3HKZA 1VQ8Z 3M4OI 4L2ZA 3A26A 1WCJA 4NBGA 4E31A 3O2EA 4PZPA 4LFCC 2QVXX 2DE7A 1VQ91 1VQ51 5T8TA 1Q861 1WIIA 1YJW1 2E2HI 2YADA 3K7AI 4BC9A 4E2YA 3EEDA 4RVOA 3CPWZ 2E8CA 2JIQA 1NJI2 2F4OA 3M3YI 4NBBA 1NP6A 2QKDA 4R0MA 2P28A 5FLXD 2Q4ZA 4RM3A 3FQMA 3GR0A 2OOXB 3HOVI 1XHJA 1M6XA 1VQ4Z 4E30A 5BSVA 1VQ71 2OBVA 4PUGA 3IMLA 1YHQ1 1JOSA 4YY3C 3OW2Z 4DV6C 5LL6f 3S17I 4DR7C 5BURA 1RLYA 2V3VA 4X6AI 4RVFA 4DV2C 2OPLA 2QEX1 2V8IA 3D2LA 1VQMZ 4DUZC 2P02A 2R6MA 2E9HA 2GU2A 4L7IA 3N54B 3UZ0A 5T67A 2E8EA 4BC7A 4U5YD 1YJN1 4YHHC 1NJI1 2QLVB 2QW0X 5K8FA 4MD7A 3RG2A 1N33C 2V7BA 4D56A 3UX2A 5BUSA 4NBHA 1RNIA 1TWAI 1MDFA 4DK1A 3CCV1 3PBKA 3HOWI 1IBLC 4PHTA 1QYPA 3H0GI 3GTGI 5IFIA 3T1HC 4LFBC 3J7A4 1RO0A 3GKUA 4B3SC 3D6WA 2E2JI 2UU9C 2VZEA 1T5HX 3KIFA 4ZLPA 4NBDA 2GTHA 2R7ZI 4HH4A 1VQN1 3LUSA 5LCIA 4LF9C 4A3II 3RZDI 3CQ1A 1WZNA 1VQLZ 4NDNA 1QWIA 3G4SZ 2NVYI 1YIT1 1USPB 1VEHA 1P4EC 3GTMI 3G6EZ 2D1RA 2YWCA 2PMZA 2O4HA 3CMEZ 2VUGA 3RZOI 2KPIA 4DV7C 4JV5C 1J5EC 3CC2Z 3IEUA 3PO3S 4BCAA 3JAMf 2NVTI 2D1QA 3HOYI 4DV0C 5KEIA 5AE3A 4E33A 2XR1A 4MONA 1QM4A 3CCS1 3OW2Y 1HNXC 4JI5C 2P2JA 3B7WA 1JWHC 4D4IA 2VPWA 3Q87A 3DAYA 3OTOC 1K83I 4TNUA 4A3KI 4NB9A 4S1TA 4I9FA 2K3RA 1NY8A 1BA3A 3AF5A 3L8CA 1KRLA 2HHHC 4GKKC 2M6NA 1M901 1EGAA 2B63I 5IP7I 1VQ7Z 5IT9D 1R9TI 1USPA 1P4EA 4DR3C 2F4MA 5K85A 4BBRI 4QTTA 1FDOA 4ODJA 4HGZA 1YI2Z 3GPCA 4X64C 3E7WA 4A3EI 3IR7A 3I08A 1K731 1VQK1 5CM2M 3CME1 1X3ZA 1YUKA 2UXBC 4OX9C 3GTKI 1V25A 4EATA 2OZKA 1PFTA 4NFRA 1HH2P 4LF5C 1N32C 1XMOC 5C3EI 3NPDA 2E2II 2YWBA 4LF7C 2W04A 4KTTA 2J6AA 4X66C 2D1SA 4DR2C 2OTJ1 3CCSZ 5D1PA 3CQ3A 3CQ2A 4DCSA 1M902 2JS4A 2G2KA 4WV3A 3CCUZ 1N8R1 4PUHA 2KZ0A 3VNSA 3I4MI 4IR7A 1WCMI 2F4VC 3I551 3A25A 3CC41 2HJGA 3NYRA 1ZB9A 3DHVA 2RT9A 1TWHI 1YJNZ 2QVYX 2D7VA 2R92I 3S16I 2JR6A 4JI1C 1Z01A 5T64A 1K732 4X62C 4R1LA 2W03A 3H3VJ 2P2BA 3R44A 1YUAA 3PESA 4BY1I 2DYJA 2M5OA 3J80D 3LGXA 4DG8A 4E2ZA 3I07A 1O90A 3LAXA 4GXQA 1KC81 3DLPX 2P20A 5C4XI 4LF6C 4NBCA 3CJEA 4HPVA 4OYCA 4JYAC 3EQ6A 2QREB 1PG4A 1Q7Y1 4DCVA 2Z51A 2ASBA 2KI7B 1N8R2 4NXMC 4BSZA 4MXUA 3MZLB 2NVXI 1RO4A 3ETCA 4RLQA 2VSQA 2AYDA 1TWFI 5A2Qf 3S1MI 2OTJZ 4JM1A 4NB8A 1VQOZ 4TPSB 2ZZMA 4G1IA 5AE1A 4DR6C 3CPWY 1YITZ 1VQKZ 3PROC 4JI6C 2UXCC 2JUBA 2RPRA 2E7GA 2VPYA 2NAPA 5CZXA 4MTNA 3GTMS 2UUAC 4ZJZA 1XMQC 2K5RA 3SO4A 2OO4A 1ZH1A 1L1OC 2BH1X 2MM9A 1RQFA 3TUFA 4D57A 3GTJI 3E7XA 2JIRA 3MZKB 4NXNC 1KKGA 2VUMI 1Q7Y2 1JJ2Z 1Z02A 4DV5C 2RHBA 3CC4Z 3CW9A 3CCVZ 4BBYA 2JIMA 4DV1C 4DV3C 4RVDA 1VQPZ 2GTIA 4CL1A 2PM9A 3NDJA 4RVHA 5GTDA 4B3RC 4GKJC 3H2TA 2E0GA 4DCUA 1VQP1 3S1NI 1QF8A 1IB8A 4A3JI 4RVNA 3LNVA 2LIYA 5ADZA 5FLXb 3I561 3CXCZ 1YHQZ 2PT7G 4DR4C 3CCQ1 3CQZI 4DG9A 2CXCA 1MXAA 1SIWA 3CCJZ 5JRHA 3I4NI 3G4S1 3LNOA 3CXCY 2JNVA 2P2FA 2HU9A 2QL8A 4LFAC 3T4NB 1QXFA 3J81f 2NVQI 2RIQA 3VMGA 3KXWA 2OOYB 1RO2A 3VNRA 4E2XA 2VPZA 1O93A 3FCEA 5LMUC 1WW9A 4K0KC 1IBMC 3F3PC 3P5JB 4MD8A 1KC82 1QVGY 4A3DI 1AMUA 1Q16A 2QRCB 3J81b 3FQQA
chains in the Genus database with same CATH topology
2LFUA 3S1QI 1T5DX 1N2FA 3NH5A 3GR1A 3CCE1 1W2BZ 3FKII 1N34C 1X0TA 4QTUA 1P7LA 2WAQA 2AYAA 3IFUA 4E2WA 2M48A 1PA4A 1YIJZ 2EGTA 4A3MI 4NOZA 4I9GA 5BSUA 1SFOI 2BJOA 5BR8C 1MKYA 3GTPI 3G7SA 3BG1B 4MD9A 1XNQC 3CW8X 1V26A 3G711 3MONA 1RY2A 2D27A 3ETOA 4FTFA 5AE2A 2R93I 3VMIA 5A2Qb 2PROA 1HR0C 1VQ6Z 4A3CI 4JI8C 4DUYC 2V8JA 4NBAA 1TWGI 4Y7NI 3RV2A 5D1OA 3HOUI 1RG9A 1VQ9Z 2VF1A 1QVFY 5IP9I 2E8FA 4JI3C 3PO3I 3R9XA 2P2QA 1Q822 3S1RI 2ZM6C 1HNWC 4KTVA 4A3FI 4RMNA 5KYVA 1XNRC 4A3GI 1Z03A 1O92A 1KD11 3JAMb 1FUGA 3T1YC 4A3LI 2QA41 1YIJ1 1MXCA 4G37A 1I3QI 1S7MA 3S2HI 2OTLZ 2JMOA 2WD9A 1YJ9Z 3CCJ1 3CMA1 4BXXI 4IZ6A 3JAMD 1DL6A 1HNZC 3VTNA 1ML8A 5IT9b 4E32A 3IPLA 1W2BY 3KIHA 4RS4A 3GTOI 2YU9I 4D4GA 2RBLA 3I56Z 4GS5A 5FLXf 1Q821 3CCQZ 1Y1VI 4XX2A 1N36C 3TQIA 1FJGC 1TWCI 5BSWA 1TFIA 3GTLI 3NYQA 3J80f 2H85A 4DQYB 5LMNC 2P2MA 2JA8I 2UXDC 1KQSY 2OPLB 1I94C 1MDBA 5IT9f 3S15I 2JMPA 1XRBA 3QWUA 4B3TC 3I55Z 1X3WA 3IEVA 2VQEC 5KYTA 4GXRA 4AYBA 1P9NA 2QA4Z 4MRIA 3A4IA 4L4QA 5T8SA 1Y1VS 4ISBA 2ONFA 1VQ41 3CCEZ 1LCIA 4G36A 1IBKC 4B3MC 2PN2A 4MH4A 1QVFZ 3A9VA 4RV9A 2CY1A 3CMAZ 1YJ91 4LF4C 3GKQA 4AQYC 3J80b 1VQ61 5D1OB 1Q811 4A3BI 5BSMA 3BG0B 2JNYA 2ZAEB 4RM2A 3CC71 3IX0A 2JA6I 5A19A 2O53A 1XRCA 1WF3A 3TDHB 3VMHA 1KD12 4JI4C 1S72Z 1K8A1 1KQSZ 4BBSI 1GPMA 1L2FA 3C5EA 3VB9A 3CCM1 1M1K1 1ULTA 2DPLA 3CCR1 2JA5I 2Y4NA 1K0RA 2UUBC 3NH8A 3IF8A 3CD61 3HOXI 4DR1C 4K0BA 3CD6Z 1JJ2Y 4FUTA 3NH4A 2ATWA 2KZFA 1Y1WI 4R1MA 4JI7C 4A93I 3S2DI 3J81D 2D28C 3FCCA 2QRDB 1K9M2 2QEXZ 2I3CA 2Q51A 2WB1A 5A2QD 4DR5C 3TDEA 3CC7Z 2IZ3A 1K8A2 2QR1B 3A9UA 5A1GA 2HF1A 3ESWA 1NYEA 1QVGZ 5DV9A 3CC21 3S14I 2UUCC 4JI2C 2OTL1 1M1K2 1I6HI 3UOWA 3GCFA 5BSTA 2Y0SA 1S721 4FUQA 4X65C 5C44I 1LQLA 5A1IA 3NFZA 1YJWZ 5BSRA 2DE5A 4RVGA 3PO2I 3VNQA 1O9TA 4NBEA 2AKLA 4LE5A 4KHPC 2E5LC 4EWCA 1MD9A 3F3FC 2V8KA 1VQ81 3EERA 3CCRZ 5C4JI 4Y52I 1MXBA 2QVZX 1K9M1 2PK7A 4NBFA 3CCL1 1NUIA 5BUQA 3AF6A 1VQ5Z 2JA7I 4HGYA 1Q812 3CCLZ 5H9UA 3GTQI 3CCMZ 2WP0C 2Y4OA 4LF8C 1YI21 4DCTA 2VQFC 5T6BA 3NDIA 5E7QA 1VLAA 4WS9A 2P3YA 1ZB8A 1Q862 3L95X 5CZVA 3D9XA 4DV4C 4BY7I 4JI0C 3U50C 1PG3A 4NH1C 5FLMI 4OXIA 2YCBA 3NI2A 1WH9A 3G71Z 3TE5B 1VQO1 5IWAC 1VQNZ 3HOZI 1VQM1 2Y27A 3R9WA 2D1TA 2IZ4A 3N2QA 1VQL1 4RLFA 1I50I 3CCU1 1YJ7A 3G6E1 1UKKA 3S82A 5AN9F 1XRAA 4PROC 4DGLA 2DE6A 3HKZA 1VQ8Z 3M4OI 4L2ZA 4NBGA 4E31A 4PZPA 4LFCC 2QVXX 2DE7A 1VQ91 1VQ51 5T8TA 1Q861 1WIIA 1YJW1 2E2HI 2YADA 3K7AI 4BC9A 4E2YA 3EEDA 4RVOA 3CPWZ 2E8CA 1NJI2 2F4OA 3M3YI 4NBBA 1NP6A 2QKDA 4R0MA 2P28A 5FLXD 2Q4ZA 4RM3A 3FQMA 3GR0A 2OOXB 3HOVI 1VQ4Z 4E30A 5BSVA 1VQ71 2OBVA 3IMLA 1YHQ1 1JOSA 4YY3C 3OW2Z 4DV6C 5LL6f 3S17I 4DR7C 5BURA 1RLYA 4X6AI 4RVFA 4DV2C 2OPLA 2QEX1 2V8IA 1VQMZ 4DUZC 2P02A 2R6MA 2E9HA 2GU2A 4L7IA 3N54B 3UZ0A 5T67A 2E8EA 4BC7A 4U5YD 1YJN1 4YHHC 1NJI1 2QLVB 2QW0X 5K8FA 4MD7A 3RG2A 1N33C 2V7BA 4D56A 5BUSA 4NBHA 1RNIA 1TWAI 1MDFA 4DK1A 3CCV1 3PBKA 3HOWI 1IBLC 4PHTA 1QYPA 3H0GI 3GTGI 5IFIA 3T1HC 4LFBC 3J7A4 1RO0A 3GKUA 4B3SC 3D6WA 2E2JI 2UU9C 2VZEA 1T5HX 3KIFA 4ZLPA 4NBDA 2GTHA 2R7ZI 4HH4A 1VQN1 3LUSA 4LF9C 4A3II 3RZDI 1VQLZ 4NDNA 1QWIA 3G4SZ 2NVYI 1YIT1 1USPB 3GTMI 3G6EZ 2D1RA 2YWCA 2PMZA 2O4HA 3CMEZ 2VUGA 3RZOI 2KPIA 4DV7C 4JV5C 1J5EC 3CC2Z 3IEUA 3PO3S 4BCAA 3JAMf 2NVTI 2D1QA 3HOYI 4DV0C 5KEIA 5AE3A 4E33A 2XR1A 4MONA 1QM4A 3CCS1 3OW2Y 1HNXC 4JI5C 2P2JA 3B7WA 1JWHC 4D4IA 3Q87A 3DAYA 3OTOC 1K83I 4TNUA 4A3KI 4NB9A 4S1TA 4I9FA 2K3RA 1BA3A 3AF5A 3L8CA 1KRLA 2HHHC 4GKKC 2M6NA 1M901 1EGAA 2B63I 5IP7I 1VQ7Z 5IT9D 1R9TI 1USPA 4DR3C 2F4MA 5K85A 4BBRI 4QTTA 4ODJA 4HGZA 1YI2Z 3GPCA 4X64C 3E7WA 4A3EI 3I08A 1K731 1VQK1 5CM2M 3CME1 1X3ZA 1YUKA 2UXBC 4OX9C 3GTKI 1V25A 4EATA 2OZKA 1PFTA 4NFRA 1HH2P 4LF5C 1N32C 1XMOC 5C3EI 3NPDA 2E2II 2YWBA 4LF7C 2W04A 4KTTA 2J6AA 4X66C 2D1SA 4DR2C 2OTJ1 3CCSZ 5D1PA 4DCSA 1M902 2JS4A 2G2KA 4WV3A 3CCUZ 1N8R1 3VNSA 2F4VC 3I4MI 4IR7A 1WCMI 3I551 3CC41 2HJGA 3NYRA 1ZB9A 3DHVA 2RT9A 1TWHI 1YJNZ 2QVYX 2D7VA 2R92I 3S16I 2JR6A 4JI1C 1Z01A 5T64A 1K732 4X62C 4R1LA 2W03A 3H3VJ 2P2BA 3R44A 1YUAA 3PESA 4BY1I 2DYJA 3J80D 3LGXA 4DG8A 4E2ZA 3I07A 1O90A 3LAXA 4GXQA 1KC81 3DLPX 2P20A 5C4XI 4LF6C 4NBCA 3CJEA 4HPVA 4OYCA 4JYAC 3EQ6A 2QREB 1PG4A 1Q7Y1 4DCVA 2ASBA 2KI7B 1N8R2 4NXMC 4BSZA 4MXUA 3MZLB 2NVXI 1RO4A 3ETCA 4RLQA 2VSQA 1TWFI 5A2Qf 3S1MI 2OTJZ 4JM1A 4NB8A 1VQOZ 4TPSB 4G1IA 5AE1A 4DR6C 3CPWY 1YITZ 1VQKZ 3PROC 4JI6C 2UXCC 2JUBA 2RPRA 2E7GA 5CZXA 4MTNA 3GTMS 2UUAC 4ZJZA 1XMQC 2K5RA 3SO4A 2OO4A 1ZH1A 1L1OC 2BH1X 1RQFA 3TUFA 4D57A 3GTJI 3E7XA 3MZKB 4NXNC 1KKGA 2VUMI 1Q7Y2 1JJ2Z 1Z02A 4DV5C 2RHBA 3CC4Z 3CW9A 3CCVZ 4BBYA 4DV1C 4DV3C 4RVDA 1VQPZ 2GTIA 4CL1A 2PM9A 3NDJA 4RVHA 5GTDA 4B3RC 4GKJC 3H2TA 2E0GA 4DCUA 1VQP1 3S1NI 1QF8A 4A3JI 4RVNA 3LNVA 2LIYA 5ADZA 5FLXb 3I561 3CXCZ 1YHQZ 2PT7G 4DR4C 3CCQ1 3CQZI 4DG9A 2CXCA 1MXAA 3CCJZ 5JRHA 3I4NI 3G4S1 3CXCY 2P2FA 2HU9A 2QL8A 4LFAC 3T4NB 3J81f 2NVQI 2RIQA 3VMGA 3KXWA 2OOYB 1RO2A 3VNRA 4E2XA 1O93A 3FCEA 5LMUC 1WW9A 4K0KC 1IBMC 3F3PC 3P5JB 4MD8A 1KC82 1QVGY 4A3DI 1AMUA 2QRCB 3J81b 3FQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFT A;  2JNY A;  3S1Q I;  1HH2 P;  2E2H I;  1N2F A;  4LF5 C;  3K7A I;  1N32 C;  1XMO C;  5C3E I;  2E2I I;  4LF7 C;  2JA6 I;  3FKI I;  2E8C A;  1N34 C;  4QTU A;  2F4O A;  2J6A A;  3M3Y I;  4X66 C;  4DR2 C;  4NBB A;  1PA4 A;  2EGT A;  4A3M I;  1WF3 A;  5FLX D;  3VMH A;  4NOZ A;  4DCS A;  4JI4 C;  1SFO I;  4BBS I;  2JS4 A;  2BJO A;  3HOV I;  1L2F A;  1MKY A;  5BR8 C;  3GTP I;  2F4V C;  3VB9 A;  3I4M I;  1WCM I;  1JOS A;  2HJG A;  4YY3 C;  1ZB9 A;  3S17 I;  4DV6 C;  1XNQ C;  1TWH I;  2JA5 I;  4DR7 C;  1K0R A;  1RLY A;  2UUB C;  4X6A I;  2D7V A;  4DV2 C;  2OPL A;  2R92 I;  3HOX I;  3S16 I;  2JR6 A;  4DR1 C;  4JI1 C;  4DUZ C;  2R93 I;  3VMI A;  4X62 C;  3H3V J;  1HR0 C;  1YUA A;  4BY1 I;  2DYJ A;  4A3C I;  2ATW A;  2KZF A;  1Y1W I;  2E8E A;  3J80 D;  4DUY C;  4JI8 C;  4NBA A;  4JI7 C;  4A93 I;  1TWG I;  4Y7N I;  4YHH C;  3S2D I;  3I07 A;  3J81 D;  3HOU I;  5C4X I;  4LF6 C;  4NBC A;  3CJE A;  5A2Q D;  4JYA C;  1N33 C;  2E8F A;  5IP9 I;  4JI3 C;  4DR5 C;  1HNW C;  3PO3 I;  3R9X A;  4DCV A;  2ASB A;  2HF1 A;  4NBH A;  4NXM C;  3ESW A;  3S1R I;  1NYE A;  1TWA I;  2NVX I;  3S14 I;  1RO4 A;  4BSZ A;  2ZM6 C;  2UUC C;  4JI2 C;  1TWF I;  4A3F I;  1I6H I;  3GCF A;  3S1M I;  1XNR C;  3HOW I;  1IBL C;  1QYP A;  4NB8 A;  4A3G I;  3H0G I;  3GTG I;  4DR6 C;  3T1H C;  4LFB C;  4X65 C;  4A3L I;  3T1Y C;  4JI6 C;  5C44 I;  1LQL A;  3GKU A;  4B3S C;  2UXC C;  3D6W A;  2E2J I;  2DE5 A;  3PO2 I;  2E7G A;  2UU9 C;  4NBE A;  1I3Q I;  4NBD A;  4MTN A;  3GTM S;  2UUA C;  3S2H I;  2AKL A;  1XMQ C;  4KHP C;  2R7Z I;  4BXX I;  2K5R A;  2E5L C;  3LUS A;  3JAM D;  4LF9 C;  1L1O C;  4A3I I;  3RZD I;  1DL6 A;  1HNZ C;  1ML8 A;  3EER A;  1QWI A;  5C4J I;  2NVY I;  4Y52 I;  3GTJ I;  1USP B;  3GTO I;  3GTM I;  2PK7 A;  2YU9 I;  4NBF A;  1NUI A;  3AF6 A;  4NXN C;  1KKG A;  2VUM I;  2JA7 I;  2RBL A;  3RZO I;  2KPI A;  4DV7 C;  4JV5 C;  4DV5 C;  3GTQ I;  1J5E C;  4LF8 C;  3IEU A;  3PO3 S;  1Y1V I;  4XX2 A;  1N36 C;  2NVT I;  4DCT A;  2VQF C;  4DV1 C;  3HOY I;  4DV0 C;  4DV3 C;  1TWC I;  1VLA A;  1FJG C;  1TFI A;  2P3Y A;  3GTL I;  1ZB8 A;  2XR1 A;  5LMN C;  2JA8 I;  2UXD C;  2OPL B;  1I94 C;  4DCU A;  1HNX C;  4JI5 C;  4B3R C;  3S1N I;  4DV4 C;  4GKJ C;  4A3J I;  3S15 I;  4BY7 I;  2JMP A;  4JI0 C;  3Q87 A;  3U50 C;  4B3T C;  2PT7 G;  3OTO C;  4DR4 C;  1K83 I;  1X3W A;  5FLM I;  4A3K I;  3CQZ I;  4NB9 A;  2YCB A;  2CXC A;  2VQE C;  3IEV A;  1WH9 A;  5IWA C;  3AF5 A;  3HOZ I;  2HHH C;  3I4N I;  3R9W A;  4GKK C;  2QL8 A;  1Y1V S;  4LFA C;  1EGA A;  2B63 I;  5IP7 I;  1I50 I;  2ONF A;  5IT9 D;  1R9T I;  1USP A;  1UKK A;  2NVQ I;  3VMG A;  4DR3 C;  2F4M A;  2DE6 A;  4B3M C;  1IBK C;  4BBR I;  4QTT A;  4MH4 A;  3M4O I;  2PN2 A;  4X64 C;  2CY1 A;  5LMU C;  4NBG A;  1WW9 A;  4LFC C;  4K0K C;  1IBM C;  4A3E I;  4LF4 C;  2DE7 A;  3GKQ A;  5CM2 M;  4AQY C;  1X3Z A;  4A3D I;  2UXB C;  4OX9 C;  3GTK I;  4A3B I; 
#chains in the Genus database with same CATH topology
 2LFU A;  3S1Q I;  1T5D X;  1N2F A;  3NH5 A;  3GR1 A;  3CCE 1;  1W2B Z;  3FKI I;  1N34 C;  1X0T A;  4QTU A;  1P7L A;  2WAQ A;  2AYA A;  3IFU A;  4E2W A;  2M48 A;  1PA4 A;  1YIJ Z;  2EGT A;  4A3M I;  4NOZ A;  4I9G A;  5BSU A;  1SFO I;  2BJO A;  3AY0 A;  5BR8 C;  1MKY A;  3GTP I;  2NCL A;  3BG1 B;  3G7S A;  4MD9 A;  1XNQ C;  3CW8 X;  1V26 A;  3G71 1;  3MON A;  1RY2 A;  2D27 A;  3ETO A;  4FTF A;  5AE2 A;  2R93 I;  3VMI A;  5A2Q b;  2PRO A;  1HR0 C;  1VQ6 Z;  4A3C I;  4JI8 C;  4DUY C;  2V8J A;  4NBA A;  1TWG I;  4Y7N I;  1TH5 A;  3RV2 A;  2VPX A;  5D1O A;  3HOU I;  1RG9 A;  1VQ9 Z;  3K6R A;  2VF1 A;  1QVF Y;  5IP9 I;  2E8F A;  4JI3 C;  3PO3 I;  3R9X A;  2P2Q A;  1Q82 2;  3S1R I;  2ZM6 C;  1HNW C;  2YX1 A;  4KTV A;  4A3F I;  4RMN A;  5KYV A;  1XNR C;  4A3G I;  1Z03 A;  1O92 A;  1KD1 1;  3JAM b;  1FUG A;  3T1Y C;  4A3L I;  2QA4 1;  1YIJ 1;  1MXC A;  4G37 A;  2MCQ A;  1I3Q I;  1S7M A;  3S2H I;  2OTL Z;  2JMO A;  2WD9 A;  1YJ9 Z;  3CCJ 1;  3CMA 1;  4BXX I;  4IZ6 A;  3JAM D;  1DL6 A;  1HNZ C;  3VTN A;  1ML8 A;  5IT9 b;  1M6X C;  4E32 A;  3IPL A;  1W2B Y;  3KIH A;  4RS4 A;  3GTO I;  2MMA B;  2YU9 I;  4D4G A;  2RBL A;  3I56 Z;  4GS5 A;  3UX3 A;  5FLX f;  1Q82 1;  2JIO A;  3CCQ Z;  1XS3 A;  1Y1V I;  4XX2 A;  1N36 C;  3TQI A;  1FJG C;  1TWC I;  5BSW A;  1TFI A;  3GTL I;  3NYQ A;  3J80 f;  2H85 A;  4DQY B;  5LMN C;  2P2M A;  2JA8 I;  2UXD C;  1KQS Y;  2OPL B;  1I94 C;  1MDB A;  5IT9 f;  3S15 I;  2JMP A;  1XRB A;  3QWU A;  2CU6 A;  4B3T C;  3I55 Z;  1X3W A;  3IEV A;  1AA6 A;  2VQE C;  5KYT A;  4GXR A;  4AYB A;  1P9N A;  2QA4 Z;  4MRI A;  3A4I A;  4L4Q A;  5T8S A;  1Y1V S;  4ISB A;  2ONF A;  1VQ4 1;  3CCE Z;  1LCI A;  2KDN A;  4G36 A;  1IBK C;  4B3M C;  2PN2 A;  4MH4 A;  1QVF Z;  3A9V A;  4RV9 A;  2CY1 A;  3CMA Z;  1YJ9 1;  4LF4 C;  3GKQ A;  4AQY C;  3J80 b;  1VQ6 1;  5D1O B;  1Q81 1;  4A3B I;  5BSM A;  3BG0 B;  2JNY A;  2ZAE B;  4RM2 A;  3CC7 1;  3IX0 A;  2E7Z A;  2JA6 I;  5A19 A;  2O53 A;  1XRC A;  1WF3 A;  3TDH B;  3VMH A;  1KD1 2;  4JI4 C;  1S72 Z;  1K8A 1;  1KQS Z;  4BBS I;  1GPM A;  1L2F A;  3C5E A;  3VB9 A;  1WJ2 A;  2ZZN A;  3CCM 1;  1M1K 1;  1ULT A;  2DPL A;  3CCR 1;  2M5H A;  2JA5 I;  2Y4N A;  1K0R A;  2UUB C;  3NH8 A;  3IF8 A;  3CD6 1;  3HOX I;  1V60 A;  4DR1 C;  4K0B A;  3CD6 Z;  1JJ2 Y;  4FUT A;  3NH4 A;  2ATW A;  1PU1 A;  2KZF A;  1Y1W I;  4R1M A;  4JI7 C;  4A93 I;  3S2D I;  2DHM A;  3J81 D;  2V45 A;  2D28 C;  1FLO A;  3FCC A;  2QRD B;  1K9M 2;  2QEX Z;  2I3C A;  2Q51 A;  2WB1 A;  5A2Q D;  4DR5 C;  3TDE A;  3CC7 Z;  2IZ3 A;  1K8A 2;  2QR1 B;  3A9U A;  5A1G A;  2HF1 A;  3ESW A;  1NYE A;  1QVG Z;  5DV9 A;  3CC2 1;  3S14 I;  2UUC C;  4JI2 C;  2OTL 1;  1M1K 2;  1I6H I;  3UOW A;  3GCF A;  3TR3 A;  5BST A;  2Y0S A;  1S72 1;  4FUQ A;  4X65 C;  5C44 I;  1LQL A;  5A1I A;  3NFZ A;  1YJW Z;  5BSR A;  2DE5 A;  4RVG A;  3PO2 I;  3VNQ A;  1O9T A;  4NBE A;  2AKL A;  4LE5 A;  4KHP C;  2IV2 X;  2E5L C;  4EWC A;  1MD9 A;  3F3F C;  2V8K A;  1VQ8 1;  3EER A;  3CCR Z;  5C4J I;  4Y52 I;  1MXB A;  2QVZ X;  1K9M 1;  2PK7 A;  4NBF A;  3CCL 1;  1NUI A;  4PUI A;  5BUQ A;  2LEX A;  3AF6 A;  1VQ5 Z;  2JA7 I;  4HGY A;  1Q81 2;  3CCL Z;  5H9U A;  3GTQ I;  3CCM Z;  2WP0 C;  2Y4O A;  4LF8 C;  1YI2 1;  4DCT A;  1Y8C A;  2VQF C;  5T6B A;  3NDI A;  5E7Q A;  1VLA A;  4WS9 A;  2P3Y A;  1ZB8 A;  1FDI A;  1Q86 2;  3UEB A;  3L95 X;  5CZV A;  3D9X A;  4DV4 C;  4BY7 I;  4JI0 C;  3U50 C;  1PG3 A;  4NH1 C;  5FLM I;  4OXI A;  1UWD A;  2YCB A;  2JIP A;  3NI2 A;  1WH9 A;  3G71 Z;  3TE5 B;  1VQO 1;  5IWA C;  1VQN Z;  3HOZ I;  1VQM 1;  2Y27 A;  3R9W A;  2D1T A;  2IZ4 A;  3N2Q A;  1VQL 1;  4RLF A;  1I50 I;  3CCU 1;  1YJ7 A;  3G6E 1;  1UKK A;  3S82 A;  5AN9 F;  1XRA A;  4PRO C;  4DGL A;  2DE6 A;  3HKZ A;  1VQ8 Z;  3M4O I;  4L2Z A;  3A26 A;  1WCJ A;  4NBG A;  4E31 A;  3O2E A;  4PZP A;  4LFC C;  2QVX X;  2DE7 A;  1VQ9 1;  1VQ5 1;  5T8T A;  1Q86 1;  1WII A;  1YJW 1;  2E2H I;  2YAD A;  3K7A I;  4BC9 A;  4E2Y A;  3EED A;  4RVO A;  3CPW Z;  2E8C A;  2JIQ A;  1NJI 2;  2F4O A;  3M3Y I;  4NBB A;  1NP6 A;  2QKD A;  4R0M A;  2P28 A;  5FLX D;  2Q4Z A;  4RM3 A;  3FQM A;  3GR0 A;  2OOX B;  3HOV I;  1XHJ A;  1M6X A;  1VQ4 Z;  4E30 A;  5BSV A;  1VQ7 1;  2OBV A;  4PUG A;  3IML A;  1YHQ 1;  1JOS A;  4YY3 C;  3OW2 Z;  4DV6 C;  5LL6 f;  3S17 I;  4DR7 C;  5BUR A;  1RLY A;  2V3V A;  4X6A I;  4RVF A;  4DV2 C;  2OPL A;  2QEX 1;  2V8I A;  3D2L A;  1VQM Z;  4DUZ C;  2P02 A;  2R6M A;  2E9H A;  2GU2 A;  4L7I A;  3N54 B;  3UZ0 A;  5T67 A;  2E8E A;  4BC7 A;  4U5Y D;  1YJN 1;  4YHH C;  1NJI 1;  2QLV B;  2QW0 X;  5K8F A;  4MD7 A;  3RG2 A;  1N33 C;  2V7B A;  4D56 A;  3UX2 A;  5BUS A;  4NBH A;  1RNI A;  1TWA I;  1MDF A;  4DK1 A;  3CCV 1;  3PBK A;  3HOW I;  1IBL C;  4PHT A;  1QYP A;  3H0G I;  3GTG I;  5IFI A;  3T1H C;  4LFB C;  3J7A 4;  1RO0 A;  3GKU A;  4B3S C;  3D6W A;  2E2J I;  2UU9 C;  2VZE A;  1T5H X;  3KIF A;  4ZLP A;  4NBD A;  2GTH A;  2R7Z I;  4HH4 A;  1VQN 1;  3LUS A;  5LCI A;  4LF9 C;  4A3I I;  3RZD I;  3CQ1 A;  1WZN A;  1VQL Z;  4NDN A;  1QWI A;  3G4S Z;  2NVY I;  1YIT 1;  1USP B;  1VEH A;  1P4E C;  3GTM I;  3G6E Z;  2D1R A;  2YWC A;  2PMZ A;  2O4H A;  3CME Z;  2VUG A;  3RZO I;  2KPI A;  4DV7 C;  4JV5 C;  1J5E C;  3CC2 Z;  3IEU A;  3PO3 S;  4BCA A;  3JAM f;  2NVT I;  2D1Q A;  3HOY I;  4DV0 C;  5KEI A;  5AE3 A;  4E33 A;  2XR1 A;  4MON A;  1QM4 A;  3CCS 1;  3OW2 Y;  1HNX C;  4JI5 C;  2P2J A;  3B7W A;  1JWH C;  4D4I A;  2VPW A;  3Q87 A;  3DAY A;  3OTO C;  1K83 I;  4TNU A;  4A3K I;  4NB9 A;  4S1T A;  4I9F A;  2K3R A;  1NY8 A;  1BA3 A;  3AF5 A;  3L8C A;  1KRL A;  2HHH C;  4GKK C;  2M6N A;  1M90 1;  1EGA A;  2B63 I;  5IP7 I;  1VQ7 Z;  5IT9 D;  1R9T I;  1USP A;  1P4E A;  4DR3 C;  2F4M A;  5K85 A;  4BBR I;  4QTT A;  1FDO A;  4ODJ A;  4HGZ A;  1YI2 Z;  3GPC A;  4X64 C;  3E7W A;  4A3E I;  3IR7 A;  3I08 A;  1K73 1;  1VQK 1;  5CM2 M;  3CME 1;  1X3Z A;  1YUK A;  2UXB C;  4OX9 C;  3GTK I;  1V25 A;  4EAT A;  2OZK A;  1PFT A;  4NFR A;  1HH2 P;  4LF5 C;  1N32 C;  1XMO C;  5C3E I;  3NPD A;  2E2I I;  2YWB A;  4LF7 C;  2W04 A;  4KTT A;  2J6A A;  4X66 C;  2D1S A;  4DR2 C;  2OTJ 1;  3CCS Z;  5D1P A;  3CQ3 A;  3CQ2 A;  4DCS A;  1M90 2;  2JS4 A;  2G2K A;  4WV3 A;  3CCU Z;  1N8R 1;  4PUH A;  2KZ0 A;  3VNS A;  3I4M I;  4IR7 A;  1WCM I;  2F4V C;  3I55 1;  3A25 A;  3CC4 1;  2HJG A;  3NYR A;  1ZB9 A;  3DHV A;  2RT9 A;  1TWH I;  1YJN Z;  2QVY X;  2D7V A;  2R92 I;  3S16 I;  2JR6 A;  4JI1 C;  1Z01 A;  5T64 A;  1K73 2;  4X62 C;  4R1L A;  2W03 A;  3H3V J;  2P2B A;  3R44 A;  1YUA A;  3PES A;  4BY1 I;  2DYJ A;  2M5O A;  3J80 D;  3LGX A;  4DG8 A;  4E2Z A;  3I07 A;  1O90 A;  3LAX A;  4GXQ A;  1KC8 1;  3DLP X;  2P20 A;  5C4X I;  4LF6 C;  4NBC A;  3CJE A;  4HPV A;  4OYC A;  4JYA C;  3EQ6 A;  2QRE B;  1PG4 A;  1Q7Y 1;  4DCV A;  2Z51 A;  2ASB A;  2KI7 B;  1N8R 2;  4NXM C;  4BSZ A;  4MXU A;  3MZL B;  2NVX I;  1RO4 A;  3ETC A;  4RLQ A;  2VSQ A;  2AYD A;  1TWF I;  5A2Q f;  3S1M I;  2OTJ Z;  4JM1 A;  4NB8 A;  1VQO Z;  4TPS B;  2ZZM A;  4G1I A;  5AE1 A;  4DR6 C;  3CPW Y;  1YIT Z;  1VQK Z;  3PRO C;  4JI6 C;  2UXC C;  2JUB A;  2RPR A;  2E7G A;  2VPY A;  2NAP A;  5CZX A;  4MTN A;  3GTM S;  2UUA C;  4ZJZ A;  1XMQ C;  2K5R A;  3SO4 A;  2OO4 A;  1ZH1 A;  1L1O C;  2BH1 X;  2MM9 A;  1RQF A;  3TUF A;  4D57 A;  3GTJ I;  3E7X A;  2JIR A;  3MZK B;  4NXN C;  1KKG A;  2VUM I;  1Q7Y 2;  1JJ2 Z;  1Z02 A;  4DV5 C;  2RHB A;  3CC4 Z;  3CW9 A;  3CCV Z;  4BBY A;  2JIM A;  4DV1 C;  4DV3 C;  4RVD A;  1VQP Z;  2GTI A;  4CL1 A;  2PM9 A;  3NDJ A;  4RVH A;  5GTD A;  4B3R C;  4GKJ C;  3H2T A;  2E0G A;  4DCU A;  1VQP 1;  3S1N I;  1QF8 A;  1IB8 A;  4A3J I;  4RVN A;  3LNV A;  2LIY A;  5ADZ A;  5FLX b;  3I56 1;  3CXC Z;  1YHQ Z;  2PT7 G;  4DR4 C;  3CCQ 1;  3CQZ I;  4DG9 A;  2CXC A;  1MXA A;  1SIW A;  3CCJ Z;  5JRH A;  3I4N I;  3G4S 1;  3LNO A;  3CXC Y;  2JNV A;  2P2F A;  2HU9 A;  2QL8 A;  4LFA C;  3T4N B;  1QXF A;  3J81 f;  2NVQ I;  2RIQ A;  3VMG A;  3KXW A;  2OOY B;  1RO2 A;  3VNR A;  4E2X A;  2VPZ A;  1O93 A;  3FCE A;  5LMU C;  1WW9 A;  4K0K C;  1IBM C;  3F3P C;  3P5J B;  4MD8 A;  1KC8 2;  1QVG Y;  4A3D I;  1AMU A;  1Q16 A;  2QRC B;  3J81 b;  3FQQ A; 
#chains in the Genus database with same CATH homology
 2LFU A;  3S1Q I;  1T5D X;  1N2F A;  3NH5 A;  3GR1 A;  3CCE 1;  1W2B Z;  3FKI I;  1N34 C;  1X0T A;  4QTU A;  1P7L A;  2WAQ A;  2AYA A;  3IFU A;  4E2W A;  2M48 A;  1PA4 A;  1YIJ Z;  2EGT A;  4A3M I;  4NOZ A;  4I9G A;  5BSU A;  1SFO I;  2BJO A;  5BR8 C;  1MKY A;  3GTP I;  3G7S A;  3BG1 B;  4MD9 A;  1XNQ C;  3CW8 X;  1V26 A;  3G71 1;  3MON A;  1RY2 A;  2D27 A;  3ETO A;  4FTF A;  5AE2 A;  2R93 I;  3VMI A;  5A2Q b;  2PRO A;  1HR0 C;  1VQ6 Z;  4A3C I;  4JI8 C;  4DUY C;  2V8J A;  4NBA A;  1TWG I;  4Y7N I;  3RV2 A;  5D1O A;  3HOU I;  1RG9 A;  1VQ9 Z;  2VF1 A;  1QVF Y;  5IP9 I;  2E8F A;  4JI3 C;  3PO3 I;  3R9X A;  2P2Q A;  1Q82 2;  3S1R I;  2ZM6 C;  1HNW C;  4KTV A;  4A3F I;  4RMN A;  5KYV A;  1XNR C;  4A3G I;  1Z03 A;  1O92 A;  1KD1 1;  3JAM b;  1FUG A;  3T1Y C;  4A3L I;  2QA4 1;  1YIJ 1;  1MXC A;  4G37 A;  1I3Q I;  1S7M A;  3S2H I;  2OTL Z;  2JMO A;  2WD9 A;  1YJ9 Z;  3CCJ 1;  3CMA 1;  4BXX I;  4IZ6 A;  3JAM D;  1DL6 A;  1HNZ C;  3VTN A;  1ML8 A;  5IT9 b;  4E32 A;  3IPL A;  1W2B Y;  3KIH A;  4RS4 A;  3GTO I;  2YU9 I;  4D4G A;  2RBL A;  3I56 Z;  4GS5 A;  5FLX f;  1Q82 1;  3CCQ Z;  1Y1V I;  4XX2 A;  1N36 C;  3TQI A;  1FJG C;  1TWC I;  5BSW A;  1TFI A;  3GTL I;  3NYQ A;  3J80 f;  2H85 A;  4DQY B;  5LMN C;  2P2M A;  2JA8 I;  2UXD C;  1KQS Y;  2OPL B;  1I94 C;  1MDB A;  5IT9 f;  3S15 I;  2JMP A;  1XRB A;  3QWU A;  4B3T C;  3I55 Z;  1X3W A;  3IEV A;  2VQE C;  5KYT A;  4GXR A;  4AYB A;  1P9N A;  2QA4 Z;  4MRI A;  3A4I A;  4L4Q A;  5T8S A;  1Y1V S;  4ISB A;  2ONF A;  1VQ4 1;  3CCE Z;  1LCI A;  4G36 A;  1IBK C;  4B3M C;  2PN2 A;  4MH4 A;  1QVF Z;  3A9V A;  4RV9 A;  2CY1 A;  3CMA Z;  1YJ9 1;  4LF4 C;  3GKQ A;  4AQY C;  3J80 b;  1VQ6 1;  5D1O B;  1Q81 1;  4A3B I;  5BSM A;  3BG0 B;  2JNY A;  2ZAE B;  4RM2 A;  3CC7 1;  3IX0 A;  2JA6 I;  5A19 A;  2O53 A;  1XRC A;  1WF3 A;  3TDH B;  3VMH A;  1KD1 2;  4JI4 C;  1S72 Z;  1K8A 1;  1KQS Z;  4BBS I;  1GPM A;  1L2F A;  3C5E A;  3VB9 A;  3CCM 1;  1M1K 1;  1ULT A;  2DPL A;  3CCR 1;  2JA5 I;  2Y4N A;  1K0R A;  2UUB C;  3NH8 A;  3IF8 A;  3CD6 1;  3HOX I;  4DR1 C;  4K0B A;  3CD6 Z;  1JJ2 Y;  4FUT A;  3NH4 A;  2ATW A;  2KZF A;  1Y1W I;  4R1M A;  4JI7 C;  4A93 I;  3S2D I;  3J81 D;  2D28 C;  3FCC A;  2QRD B;  1K9M 2;  2QEX Z;  2I3C A;  2Q51 A;  2WB1 A;  5A2Q D;  4DR5 C;  3TDE A;  3CC7 Z;  2IZ3 A;  1K8A 2;  2QR1 B;  3A9U A;  5A1G A;  2HF1 A;  3ESW A;  1NYE A;  1QVG Z;  5DV9 A;  3CC2 1;  3S14 I;  2UUC C;  4JI2 C;  2OTL 1;  1M1K 2;  1I6H I;  3UOW A;  3GCF A;  5BST A;  2Y0S A;  1S72 1;  4FUQ A;  4X65 C;  5C44 I;  1LQL A;  5A1I A;  3NFZ A;  1YJW Z;  5BSR A;  2DE5 A;  4RVG A;  3PO2 I;  3VNQ A;  1O9T A;  4NBE A;  2AKL A;  4LE5 A;  4KHP C;  2E5L C;  4EWC A;  1MD9 A;  3F3F C;  2V8K A;  1VQ8 1;  3EER A;  3CCR Z;  5C4J I;  4Y52 I;  1MXB A;  2QVZ X;  1K9M 1;  2PK7 A;  4NBF A;  3CCL 1;  1NUI A;  5BUQ A;  3AF6 A;  1VQ5 Z;  2JA7 I;  4HGY A;  1Q81 2;  3CCL Z;  5H9U A;  3GTQ I;  3CCM Z;  2WP0 C;  2Y4O A;  4LF8 C;  1YI2 1;  4DCT A;  2VQF C;  5T6B A;  3NDI A;  5E7Q A;  1VLA A;  4WS9 A;  2P3Y A;  1ZB8 A;  1Q86 2;  3L95 X;  5CZV A;  3D9X A;  4DV4 C;  4BY7 I;  4JI0 C;  3U50 C;  1PG3 A;  4NH1 C;  5FLM I;  4OXI A;  2YCB A;  3NI2 A;  1WH9 A;  3G71 Z;  3TE5 B;  1VQO 1;  5IWA C;  1VQN Z;  3HOZ I;  1VQM 1;  2Y27 A;  3R9W A;  2D1T A;  2IZ4 A;  3N2Q A;  1VQL 1;  4RLF A;  1I50 I;  3CCU 1;  1YJ7 A;  3G6E 1;  1UKK A;  3S82 A;  5AN9 F;  1XRA A;  4PRO C;  4DGL A;  2DE6 A;  3HKZ A;  1VQ8 Z;  3M4O I;  4L2Z A;  4NBG A;  4E31 A;  4PZP A;  4LFC C;  2QVX X;  2DE7 A;  1VQ9 1;  1VQ5 1;  5T8T A;  1Q86 1;  1WII A;  1YJW 1;  2E2H I;  2YAD A;  3K7A I;  4BC9 A;  4E2Y A;  3EED A;  4RVO A;  3CPW Z;  2E8C A;  1NJI 2;  2F4O A;  3M3Y I;  4NBB A;  1NP6 A;  2QKD A;  4R0M A;  2P28 A;  5FLX D;  2Q4Z A;  4RM3 A;  3FQM A;  3GR0 A;  2OOX B;  3HOV I;  1VQ4 Z;  4E30 A;  5BSV A;  1VQ7 1;  2OBV A;  3IML A;  1YHQ 1;  1JOS A;  4YY3 C;  3OW2 Z;  4DV6 C;  5LL6 f;  3S17 I;  4DR7 C;  5BUR A;  1RLY A;  4X6A I;  4RVF A;  4DV2 C;  2OPL A;  2QEX 1;  2V8I A;  1VQM Z;  4DUZ C;  2P02 A;  2R6M A;  2E9H A;  2GU2 A;  4L7I A;  3N54 B;  3UZ0 A;  5T67 A;  2E8E A;  4BC7 A;  4U5Y D;  1YJN 1;  4YHH C;  1NJI 1;  2QLV B;  2QW0 X;  5K8F A;  4MD7 A;  3RG2 A;  1N33 C;  2V7B A;  4D56 A;  5BUS A;  4NBH A;  1RNI A;  1TWA I;  1MDF A;  4DK1 A;  3CCV 1;  3PBK A;  3HOW I;  1IBL C;  4PHT A;  1QYP A;  3H0G I;  3GTG I;  5IFI A;  3T1H C;  4LFB C;  3J7A 4;  1RO0 A;  3GKU A;  4B3S C;  3D6W A;  2E2J I;  2UU9 C;  2VZE A;  1T5H X;  3KIF A;  4ZLP A;  4NBD A;  2GTH A;  2R7Z I;  4HH4 A;  1VQN 1;  3LUS A;  4LF9 C;  4A3I I;  3RZD I;  1VQL Z;  4NDN A;  1QWI A;  3G4S Z;  2NVY I;  1YIT 1;  1USP B;  3GTM I;  3G6E Z;  2D1R A;  2YWC A;  2PMZ A;  2O4H A;  3CME Z;  2VUG A;  3RZO I;  2KPI A;  4DV7 C;  4JV5 C;  1J5E C;  3CC2 Z;  3IEU A;  3PO3 S;  4BCA A;  3JAM f;  2NVT I;  2D1Q A;  3HOY I;  4DV0 C;  5KEI A;  5AE3 A;  4E33 A;  2XR1 A;  4MON A;  1QM4 A;  3CCS 1;  3OW2 Y;  1HNX C;  4JI5 C;  2P2J A;  3B7W A;  1JWH C;  4D4I A;  3Q87 A;  3DAY A;  3OTO C;  1K83 I;  4TNU A;  4A3K I;  4NB9 A;  4S1T A;  4I9F A;  2K3R A;  1BA3 A;  3AF5 A;  3L8C A;  1KRL A;  2HHH C;  4GKK C;  2M6N A;  1M90 1;  1EGA A;  2B63 I;  5IP7 I;  1VQ7 Z;  5IT9 D;  1R9T I;  1USP A;  4DR3 C;  2F4M A;  5K85 A;  4BBR I;  4QTT A;  4ODJ A;  4HGZ A;  1YI2 Z;  3GPC A;  4X64 C;  3E7W A;  4A3E I;  3I08 A;  1K73 1;  1VQK 1;  5CM2 M;  3CME 1;  1X3Z A;  1YUK A;  2UXB C;  4OX9 C;  3GTK I;  1V25 A;  4EAT A;  2OZK A;  1PFT A;  4NFR A;  1HH2 P;  4LF5 C;  1N32 C;  1XMO C;  5C3E I;  3NPD A;  2E2I I;  2YWB A;  4LF7 C;  2W04 A;  4KTT A;  2J6A A;  4X66 C;  2D1S A;  4DR2 C;  2OTJ 1;  3CCS Z;  5D1P A;  4DCS A;  1M90 2;  2JS4 A;  2G2K A;  4WV3 A;  3CCU Z;  1N8R 1;  3VNS A;  2F4V C;  3I4M I;  4IR7 A;  1WCM I;  3I55 1;  3CC4 1;  2HJG A;  3NYR A;  1ZB9 A;  3DHV A;  2RT9 A;  1TWH I;  1YJN Z;  2QVY X;  2D7V A;  2R92 I;  3S16 I;  2JR6 A;  4JI1 C;  1Z01 A;  5T64 A;  1K73 2;  4X62 C;  4R1L A;  2W03 A;  3H3V J;  2P2B A;  3R44 A;  1YUA A;  3PES A;  4BY1 I;  2DYJ A;  3J80 D;  3LGX A;  4DG8 A;  4E2Z A;  3I07 A;  1O90 A;  3LAX A;  4GXQ A;  1KC8 1;  3DLP X;  2P20 A;  5C4X I;  4LF6 C;  4NBC A;  3CJE A;  4HPV A;  4OYC A;  4JYA C;  3EQ6 A;  2QRE B;  1PG4 A;  1Q7Y 1;  4DCV A;  2ASB A;  2KI7 B;  1N8R 2;  4NXM C;  4BSZ A;  4MXU A;  3MZL B;  2NVX I;  1RO4 A;  3ETC A;  4RLQ A;  2VSQ A;  1TWF I;  5A2Q f;  3S1M I;  2OTJ Z;  4JM1 A;  4NB8 A;  1VQO Z;  4TPS B;  4G1I A;  5AE1 A;  4DR6 C;  3CPW Y;  1YIT Z;  1VQK Z;  3PRO C;  4JI6 C;  2UXC C;  2JUB A;  2RPR A;  2E7G A;  5CZX A;  4MTN A;  3GTM S;  2UUA C;  4ZJZ A;  1XMQ C;  2K5R A;  3SO4 A;  2OO4 A;  1ZH1 A;  1L1O C;  2BH1 X;  1RQF A;  3TUF A;  4D57 A;  3GTJ I;  3E7X A;  3MZK B;  4NXN C;  1KKG A;  2VUM I;  1Q7Y 2;  1JJ2 Z;  1Z02 A;  4DV5 C;  2RHB A;  3CC4 Z;  3CW9 A;  3CCV Z;  4BBY A;  4DV1 C;  4DV3 C;  4RVD A;  1VQP Z;  2GTI A;  4CL1 A;  2PM9 A;  3NDJ A;  4RVH A;  5GTD A;  4B3R C;  4GKJ C;  3H2T A;  2E0G A;  4DCU A;  1VQP 1;  3S1N I;  1QF8 A;  4A3J I;  4RVN A;  3LNV A;  2LIY A;  5ADZ A;  5FLX b;  3I56 1;  3CXC Z;  1YHQ Z;  2PT7 G;  4DR4 C;  3CCQ 1;  3CQZ I;  4DG9 A;  2CXC A;  1MXA A;  3CCJ Z;  5JRH A;  3I4N I;  3G4S 1;  3CXC Y;  2P2F A;  2HU9 A;  2QL8 A;  4LFA C;  3T4N B;  3J81 f;  2NVQ I;  2RIQ A;  3VMG A;  3KXW A;  2OOY B;  1RO2 A;  3VNR A;  4E2X A;  1O93 A;  3FCE A;  5LMU C;  1WW9 A;  4K0K C;  1IBM C;  3F3P C;  3P5J B;  4MD8 A;  1KC8 2;  1QVG Y;  4A3D I;  1AMU A;  2QRC B;  3J81 b;  3FQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...