1VLAA

Crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
144
structure length
144
Chain Sequence
HHHHHHMQARWIGNMMFHVRTDSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVIDQMKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEKYCSVSAILKCSSKVTYEIVYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroperoxide resistance protein OsmC
publication title Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
total genus 34
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vlaA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1vlaA02
2DE7A 3S16I 4DR3C 2PK7A 3GCFA 3S1NI 4NB8A 1WF3A 4DV6C 5C4JI 2UXBC 4LF9C 4A3II 2YCBA 3U50C 1N36C 1I3QI 4A3MI 4NBEA 1IBKC 2JNYA 4DV4C 4DR4C 2VQEC 4QTUA 4A3GI 2E2HI 4X62C 4GKKC 4DCUA 1N33C 1EGAA 2XR1A 1K83I 3VMGA 2D7VA 4Y7NI 5FLMI 4DCVA 1I6HI 4BSZA 3HOUI 3AF5A 2NVXI 4K0KC 2UXDC 5A2QD 4B3RC 2J6AA 3PO2I 1HH2P 4JI7C 1JOSA 1XNQC 4NOZA 1HNWC 3OTOC 3S14I 3HOXI 3R9XA 2JA8I 4B3TC 4YY3C 2R92I 4A3CI 3EERA 4JI1C 4LF6C 3GTPI 4A3DI 4JI2C 1HNXC 3GKUA 3ESWA 4QTTA 3S2HI 1QWIA 2DE5A 3GTKI 4DUZC 4LFBC 3M4OI 2E8FA 4JI8C 2VQFC 1KKGA 1TWAI 3T1YC 2UXCC 4NBFA 1TWCI 2E5LC 1RLYA 1X3WA 5CM2M 4A93I 3S15I 4NBGA 2NVQI 4DR1C 1NUIA 3HOWI 2OPLB 4X64C 2ONFA 1K0RA 4BY7I 5C3EI 1L2FA 4DR5C 5C4XI 2JA5I 1Y1VS 2OPLA 1I50I 4MTNA 4AQYC 2UUAC 1WW9A 3FKII 1HNZC 1TWFI 2HF1A 4NB9A 4JV5C 4B3SC 4OX9C 4BY1I 4DR7C 4JI4C 2UUBC 1PFTA 4MH4A 2HHHC 4BXXI 3JAMD 1ZB8A 1MKYA 4NXNC 5LMUC 3J80D 4NBBA 1VLAA 1USPB 1PA4A 2JMPA 2CY1A 4XX2A 1TWHI 4BBRI 1WH9A 4X6AI 3D6WA 3T1HC 5IP9I 4NBDA 2UU9C 1USPA 3H3VJ 2F4VC 4JI0C 1X3ZA 3VB9A 2R7ZI 1L1OC 2VUMI 4LF7C 5FLXD 2DE6A 4A3BI 4LFCC 1YUAA 2CXCA 2B63I 2F4OA 4X66C 2RBLA 4A3FI 4KHPC 3IEUA 4NXMC 2P3YA 3GTMI 1SFOI 3PO3I 2ZM6C 4DUYC 4DV2C 1XMOC 3K7AI 5C44I 1Y1VI 1IBMC 2PT7G 2R93I 1FJGC 2JA6I 3GTQI 1NYEA 4LF4C 3HOVI 2NVYI 1TFIA 3GTMS 2JS4A 3PO3S 4YHHC 2KZFA 1ML8A 2JR6A 4JI6C 5IP7I 2PN2A 3GTOI 1HR0C 4DV0C 3VMHA 3GTGI 4LF5C 5BR8C 3S1QI 2UUCC 2K5RA 4B3MC 5IT9D 3I07A 3RZDI 2KPIA 4A3KI 1DL6A 4Y52I 5IWAC 5LMNC 4JYAC 1TWGI 4X65C 4GKJC 4A3EI 4NBHA 3M3YI 3I4MI 2DYJA 4LF8C 4DV1C 2ASBA 2BJOA 1IBLC 3R9WA 1RO4A 2NVTI 3J81D 3S1RI 4DCSA 2E8EA 2F4MA 1LQLA 2E8CA 4DR6C 1QYPA 4DV7C 4JI3C 1ZB9A 1UKKA 3I4NI 2YU9I 2E7GA 3GTLI 1N32C 3RZOI 1XMQC 1N2FA 2AKLA 1WCMI 1N34C 4A3LI 3Q87A 2ATWA 2JA7I 3S2DI 4A3JI 2HJGA 4DR2C 3GKQA 3IEVA 4NBCA 2E2JI 3GTJI 4JI5C 4DV5C 3H0GI 4DCTA 2E2II 3CJEA 2QL8A 3VMIA 1J5EC 1XNRC 3AF6A 4NBAA 2EGTA 1Y1WI 1R9TI 3S1MI 3CQZI 3LUSA 4DV3C 4BBSI 3HOZI 3S17I 1I94C 3HOYI 4LFAC
chains in the Genus database with same CATH superfamily
2DE7A 3TDHB 3S16I 3EEDA 3JAMf 4MD9A 4PROC 2OZKA 4DR3C 1KQSY 2PK7A 3GCFA 1Q7Y2 3S1NI 4NB8A 1WF3A 3CQ1A 4WV3A 3RG2A 3CCM1 5K8FA 4DV6C 2WAQA 5C4JI 2I3CA 3CCMZ 1Q821 2OTJZ 2OTJ1 4A3II 2WD9A 2YCBA 4LF9C 3U50C 5BSVA 1N36C 1I3QI 4A3MI 2V3VA 4NBEA 2YWBA 3CCR1 3NFZA 3CCRZ 1VQK1 1VQKZ 1IBKC 2QVXX 3CCS1 2JNYA 2Z51A 3CCSZ 4G1IA 4DV4C 2VQEC 4DR4C 4QTUA 1YUKA 1IB8A 4DG8A 2RPRA 4A3GI 3NPDA 2E2HI 1VEHA 4X62C 4GKKC 2OOYB 4DCUA 1N33C 2P2JA 4IR7A 4RM2A 1EGAA 4FUTA 2XR1A 2RT9A 1K83I 1M6XC 3VMGA 1RNIA 3IFUA 2D7VA 4RM3A 2W04A 2V8KA 4Y7NI 5FLMI 4DCVA 4NH1C 1I6HI 5LCIA 4BSZA 1YJ91 1YJ9Z 4S1TA 3HOUI 1MXCA 3CC21 3CC2Z 3AF5A 4K0BA 2NVXI 3UOWA 1JWHC 2OBVA 2JIOA 2LEXA 1Z03A 4ZLPA 4K0KC 1VQL1 5FLXf 3CQ3A 1VQLZ 2UXDC 4D57A 5A2QD 1YI21 3IMLA 1YI2Z 4PZPA 1PG3A 4JI7C 2J6AA 3PO2I 1HH2P 3A25A 4B3RC 3E7XA 2BH1X 2QRDB 1JOSA 2MCQA 1VQM1 1Q812 1XNQC 1VQMZ 4NOZA 1HNWC 2DHMA 2YWCA 3OTOC 2NCLA 3S14I 3HOXI 4PUHA 3R9XA 2JA8I 4B3TC 3I561 3CXCY 4YY3C 3I56Z 2JIMA 2R92I 2QVZX 4A3CI 4E2WA 1Q7Y1 1P4EA 3EERA 2D1QA 1VQP1 2V8IA 1VQPZ 2KI7B 3CCL1 4JI1C 3CCLZ 3JAMb 4LF6C 1QVFZ 1GPMA 1RG9A 3GTPI 4A3DI 2YADA 4E30A 4RLFA 4AYBA 3J80b 3DLPX 2OOXB 5A19A 4JI2C 1HNXC 5A2Qb 3GKUA 3ESWA 1P9NA 5BSRA 4QTTA 3S2HI 1QWIA 2DE5A 1W2BZ 3GTKI 2LFUA 2GTHA 4DUZC 4LFBC 2OO4A 4BCAA 3M4OI 2E8FA 3PESA 1K9M2 4JI8C 1XRBA 2VQFC 1KKGA 1TWAI 1X0TA 2QVYX 3T1YC 5H9UA 2UXCC 4NBFA 2VPYA 1TWCI 4OYCA 2E5LC 1RLYA 1X3WA 2QEX1 5CM2M 4A93I 2QEXZ 1N8R2 4GS5A 4KTTA 1YJ7A 4JM1A 4EWCA 4RVFA 2Q4ZA 3S15I 4NBGA 2D1TA 5CZXA 3CPWZ 3IR7A 3R44A 4BC7A 1Y8CA 5IT9f 2NVQI 3H2TA 4G37A 1Q811 4DR1C 1NUIA 2QKDA 3HOWI 2IZ3A 4RS4A 4RLQA 4LE5A 5FLXb 3GR1A 2M6NA 2VPXA 2OPLB 3PROC 3IX0A 3E7WA 4X64C 2ONFA 1FLOA 3CCV1 4D4GA 3CCVZ 1K0RA 3CQ2A 3GPCA 5D1PA 3B7WA 2O53A 1M902 4BY7I 3CCU1 3CCUZ 5C3EI 1WZNA 2M48A 1L2FA 4DR5C 3A9VA 1Q16A 5C4XI 4PUIA 2JA5I 1Y1VS 2OPLA 1I50I 4E33A 4MTNA 5BUSA 3LNOA 2KDNA 1KD12 4AQYC 2QW0X 1M1K2 3F3FC 1Z01A 1WCJA 2D1SA 2JUBA 2UUAC 1WW9A 2RHBA 1K732 3I551 3FKII 2Y0SA 3I55Z 3CMAZ 3CMA1 4HPVA 4MD8A 1RO0A 1TWFI 2HF1A 4NB9A 3TQIA 4CL1A 5A1IA 5IFIA 4B3SC 4JV5C 4OX9C 4U5YD 3CME1 4BY1I 3CMEZ 3J81f 4DR7C 2VF1A 4JI4C 1TH5A 2UUBC 2UXBC 1PFTA 4MH4A 2AYAA 2HHHC 4BXXI 3JAMD 1XS3A 1ZB8A 1MKYA 4TNUA 1K9M1 2ZAEB 1S721 2Y4OA 1S72Z 5LMUC 4DQYB 4NXNC 1QVGY 4RVGA 4FUQA 3G4S1 3J80D 1QVFY 3G4SZ 2VSQA 1VLAA 4NBBA 4WS9A 1USPB 1N8R1 2RIQA 1PA4A 2JMPA 5BSTA 4MD7A 1VQ61 1VQ6Z 3UX2A 2CY1A 4XX2A 3IPLA 1ULTA 2P2FA 1TWHI 4BBRI 1WH9A 2V45A 4X6AI 3D6WA 1W2BY 3T1HC 4E2YA 5IP9I 1FUGA 4FTFA 2VPWA 1NJI2 4R1LA 3G6E1 4NBDA 3G6EZ 1MD9A 1AMUA 1YHQ1 5BURA 2UU9C 1USPA 2MM9A 3F3PC 2JIPA 1RQFA 2E9HA 1M901 1K8A2 3H3VJ 2F4VC 4ZJZA 4JI0C 2VPZA 3VNRA 1X3ZA 3LAXA 1LCIA 4RVOA 3VB9A 4E2ZA 2R7ZI 5T8SA 1P4EC 1FDIA 3KXWA 1L1OC 4RV9A 3G711 3G71Z 3K6RA 2VUMI 2R6MA 4LF7C 5K85A 4HGYA 3NH5A 2GTIA 1KD11 4GXQA 5FLXD 2DE6A 1M1K1 4A3BI 1V26A 2Y4NA 2M5HA 4LFCC 1YUAA 2CXCA 4D56A 3HKZA 2B63I 1K731 2F4OA 4X66C 2RBLA 3MZLB 4A3FI 4KHPC 2ZZMA 1Z02A 3IEUA 2P2QA 4NXMC 1MDFA 2P3YA 2QA41 2M5OA 2QA4Z 4DG9A 2JIRA 3GTMI 1SFOI 3PO3I 2ZM6C 1V25A 3A4IA 1O93A 1QM4A 2PM9A 3RV2A 3UX3A 4DUYC 1VQ91 5KEIA 1VQ9Z 3ETCA 4DV2C 1ZH1A 1NY8A 1FDOA 1XRCA 1XMOC 3LNVA 5LL6f 3K7AI 3PBKA 2PMZA 2VUGA 5E7QA 5C44I 1KRLA 1Y1VI 2AYDA 2NAPA 4RVDA 4R0MA 1IBMC 2VZEA 1QF8A 2PT7G 3TDEA 2R93I 1FJGC 3CXCZ 2JA6I 4L7IA 3EQ6A 1PU1A 2LIYA 3DAYA 3GTQI 1O90A 3A9UA 4EATA 2O4HA 1NYEA 4LF4C 5T67A 1VQN1 1VQNZ 3HOVI 2NVYI 4ISBA 4TPSB 1RO2A 4DGLA 1NJI1 5CZVA 1XHJA 1VQ71 3SO4A 2JMOA 1VQ7Z 1TFIA 3GTMS 2JS4A 1JJ2Z 3PO3S 1P7LA 5KYTA 4YHHC 2GU2A 1AA6A 2KZFA 1ML8A 1K8A1 3C5EA 5DV9A 2JR6A 4JI6C 5IP7I 2PN2A 5AE1A 3NH8A 5T8TA 3BG1B 1VQ81 4L2ZA 1VQ8Z 3GTOI 2QR1B 4G36A 2JNVA 2H85A 3I08A 3CD61 1HR0C 3CD6Z 5BSUA 4DV0C 3VMHA 3GTGI 4BC9A 3TE5B 1YIJ1 1YIJZ 4ODJA 3DHVA 3L8CA 3J7A4 3VTNA 3FCCA 3CW9A 5BR8C 4LF5C 1VQ41 1RY2A 3S1QI 1VQ4Z 2Y27A 2UUCC 2K5RA 2WB1A 4I9FA 5GTDA 5IT9D 2QREB 3I07A 4MONA 2MMAB 4B3MC 4IZ6A 2ZZNA 3J80f 3UZ0A 3RZDI 2KPIA 1T5HX 3FQMA 4A3KI 5A2Qf 2WP0C 1YIT1 1YITZ 1MDBA 4RVHA 1MXAA 5KYVA 2YX1A 3TR3A 1DL6A 3OW2Z 4Y52I 5T6BA 5IWAC 5LMNC 4JYAC 4HGZA 4R1MA 4LFAC 1M6XA 1KC82 5T64A 4RMNA 4PUGA 3T4NB 1TWGI 4X65C 2V7BA 3O2EA 4GKJC 2D1RA 3CCE1 3CCEZ 2D28C 3MONA 5AN9F 4A3EI 2Q51A 1Q862 3CW8X 1YJW1 2E0GA 3G7SA 1YJWZ 4NBHA 3M3YI 3D2LA 3I4MI 3MZKB 5JRHA 3TUFA 2DYJA 3NDJA 1KQSZ 4LF8C 1SIWA 4DV1C 2ASBA 2QRCB 3QWUA 2BJOA 3VNQA 2QLVB 3KIFA 1IBLC 3NDIA 3R9WA 1RO4A 2G2KA 2P20A 1YHQZ 5IT9b 2E7ZA 2NVTI 1VQ51 1VQ5Z 3J81D 3A26A 1WIIA 3S1RI 2W03A 3NYQA 2E8EA 4DCSA 3S82A 4E32A 2F4MA 3NYRA 1V60A 4MRIA 3GR0A 1LQLA 2E8CA 3CC41 3CC4Z 3NI2A 3NH4A 3N54B 4DR6C 2K3RA 1XRAA 3CPWY 2CU6A 5BSMA 2OTL1 4PHTA 2OTLZ 1QYPA 1O9TA 3N2QA 2PROA 4DV7C 1O92A 5AE3A 4JI3C 1ZB9A 3UEBA 2P28A 1UKKA 3D9XA 4E31A 3I4NI 2D27A 2YU9I 1Q822 2E7GA 3GTLI 1N32C 5D1OB 3RZOI 5BSWA 1VQO1 1N2FA 1XMQC 1VQOZ 1JJ2Y 1QVGZ 2AKLA 4OXIA 1WCMI 4DK1A 1N34C 4A3LI 3Q87A 1PG4A 2IV2X 2KZ0A 3IF8A 1BA3A 2ATWA 2JA7I 3S2DI 4HH4A 4L4QA 3CC71 4A3JI 3CC7Z 2HJGA 4DR2C 3GKQA 1KC81 3J81b 3IEVA 4NBCA 2E2JI 3GTJI 1WJ2A 2DPLA 5A1GA 4E2XA 4JI5C 4DV5C 3FQQA 2P02A 3CCQ1 1QXFA 3H0GI 3CCQZ 4KTVA 4DCTA 5D1OA 2E2II 1Q861 1T5DX 3CJEA 2QL8A 1YJN1 3VMIA 1YJNZ 1J5EC 1XNRC 3AF6A 4NBAA 2EGTA 4GXRA 1Y1WI 3P5JB 3AY0A 1NP6A 1R9TI 3CQZI 3S1MI 4BBYA 3LUSA 2P2MA 4DV3C 4RVNA 4BBSI 3BG0B 2JIQA 2P2BA 4NDNA 3OW2Y 3LGXA 3CCJ1 2V8JA 4NFRA 3CCJZ 3HOZI 3VNSA 3S17I 3ETOA 3L95X 1I94C 5ADZA 5BUQA 3HOYI 1UWDA 3KIHA 1MXBA 3FCEA 4D4IA 1HNZC 2IZ4A 2HU9A 1S7MA 5AE2A 4MXUA 4I9GA
chains in the Genus database with same CATH topology
2DE7A 3TDHB 3S16I 3EEDA 3JAMf 4MD9A 4PROC 2OZKA 4DR3C 1KQSY 2PK7A 3GCFA 1Q7Y2 3S1NI 4NB8A 1WF3A 4WV3A 3RG2A 3CCM1 5K8FA 4DV6C 2WAQA 5C4JI 2I3CA 3CCMZ 1Q821 2OTJZ 2OTJ1 4A3II 2WD9A 2YCBA 4LF9C 3U50C 5BSVA 1N36C 1I3QI 4A3MI 4NBEA 2YWBA 3CCR1 3NFZA 3CCRZ 1VQK1 1VQKZ 1IBKC 2QVXX 3CCS1 2JNYA 3CCSZ 4G1IA 4DV4C 2VQEC 4DR4C 4QTUA 1YUKA 4DG8A 2RPRA 4A3GI 3NPDA 2E2HI 4X62C 4GKKC 2OOYB 4DCUA 1N33C 2P2JA 4IR7A 4RM2A 1EGAA 4FUTA 2XR1A 2RT9A 1K83I 3VMGA 1RNIA 3IFUA 2D7VA 4RM3A 2W04A 2V8KA 4Y7NI 5FLMI 4DCVA 4NH1C 1I6HI 4BSZA 1YJ91 1YJ9Z 4S1TA 3HOUI 1MXCA 3CC21 3CC2Z 3AF5A 4K0BA 2NVXI 3UOWA 1JWHC 2OBVA 1Z03A 4ZLPA 4K0KC 1VQL1 5FLXf 2UXDC 1VQLZ 4D57A 5A2QD 1YI21 3IMLA 1YI2Z 4PZPA 1PG3A 4JI7C 2J6AA 3PO2I 1HH2P 4B3RC 3E7XA 2BH1X 2QRDB 1JOSA 1VQM1 1Q812 1XNQC 1VQMZ 4NOZA 1HNWC 2YWCA 3OTOC 3S14I 3HOXI 3R9XA 2JA8I 4B3TC 3I561 3CXCY 4YY3C 3I56Z 2R92I 2QVZX 4A3CI 4E2WA 1Q7Y1 3EERA 2D1QA 1VQP1 2V8IA 1VQPZ 2KI7B 3CCL1 4JI1C 3CCLZ 3JAMb 4LF6C 1QVFZ 1GPMA 1RG9A 3GTPI 4A3DI 2YADA 4E30A 4RLFA 4AYBA 3J80b 3DLPX 2OOXB 5A19A 4JI2C 1HNXC 5A2Qb 3GKUA 3ESWA 1P9NA 5BSRA 4QTTA 3S2HI 1QWIA 2DE5A 1W2BZ 3GTKI 2LFUA 2GTHA 4DUZC 4LFBC 2OO4A 4BCAA 3M4OI 2E8FA 3PESA 1K9M2 4JI8C 1XRBA 2VQFC 1KKGA 1TWAI 1X0TA 2QVYX 3T1YC 5H9UA 2UXCC 4NBFA 1TWCI 4OYCA 2E5LC 1RLYA 1X3WA 2QEX1 5CM2M 4A93I 2QEXZ 1N8R2 4GS5A 4KTTA 1YJ7A 4JM1A 4EWCA 4RVFA 2Q4ZA 3S15I 4NBGA 2D1TA 5CZXA 3CPWZ 3R44A 4BC7A 5IT9f 2NVQI 3H2TA 4G37A 1Q811 4DR1C 1NUIA 2QKDA 3HOWI 2IZ3A 4RS4A 4RLQA 4LE5A 5FLXb 3GR1A 2M6NA 3PROC 2OPLB 3IX0A 3E7WA 4X64C 2ONFA 3CCV1 4D4GA 3CCVZ 1K0RA 3GPCA 5D1PA 3B7WA 2O53A 1M902 4BY7I 3CCU1 3CCUZ 5C3EI 2M48A 1L2FA 4DR5C 3A9VA 5C4XI 2JA5I 1Y1VS 2OPLA 1I50I 4E33A 4MTNA 5BUSA 1KD12 4AQYC 2QW0X 1M1K2 3F3FC 1Z01A 2D1SA 2JUBA 2UUAC 1WW9A 2RHBA 1K732 3I551 3FKII 2Y0SA 3I55Z 3CMAZ 3CMA1 4HPVA 4MD8A 1RO0A 1TWFI 2HF1A 4NB9A 3TQIA 4CL1A 5A1IA 5IFIA 4B3SC 4JV5C 4OX9C 4U5YD 3CME1 4BY1I 3CMEZ 3J81f 4DR7C 2VF1A 4JI4C 2UUBC 2UXBC 1PFTA 4MH4A 2AYAA 2HHHC 4BXXI 3JAMD 1ZB8A 1MKYA 4TNUA 1K9M1 2ZAEB 1S721 2Y4OA 1S72Z 5LMUC 4DQYB 4NXNC 1QVGY 4RVGA 4FUQA 3G4S1 3J80D 1QVFY 3G4SZ 2VSQA 1VLAA 4NBBA 4WS9A 1USPB 1N8R1 2RIQA 1PA4A 2JMPA 5BSTA 4MD7A 1VQ61 1VQ6Z 2CY1A 4XX2A 3IPLA 1ULTA 2P2FA 1TWHI 4BBRI 1WH9A 4X6AI 3D6WA 1W2BY 3T1HC 4E2YA 5IP9I 1FUGA 4FTFA 1NJI2 4R1LA 3G6E1 4NBDA 3G6EZ 1MD9A 1AMUA 1YHQ1 5BURA 2UU9C 1USPA 3F3PC 1RQFA 2E9HA 1M901 1K8A2 3H3VJ 2F4VC 4ZJZA 4JI0C 3VNRA 1X3ZA 3LAXA 1LCIA 4RVOA 3VB9A 4E2ZA 2R7ZI 5T8SA 3KXWA 1L1OC 4RV9A 3G711 3G71Z 2VUMI 2R6MA 4LF7C 5K85A 4HGYA 3NH5A 2GTIA 1KD11 4GXQA 5FLXD 2DE6A 1M1K1 4A3BI 1V26A 2Y4NA 4LFCC 1YUAA 2CXCA 4D56A 3HKZA 2B63I 1K731 2F4OA 4X66C 2RBLA 3MZLB 4A3FI 4KHPC 1Z02A 3IEUA 2P2QA 4NXMC 1MDFA 2P3YA 2QA41 2QA4Z 4DG9A 3GTMI 1SFOI 3PO3I 2ZM6C 1V25A 3A4IA 1O93A 1QM4A 2PM9A 3RV2A 4DUYC 1VQ91 5KEIA 1VQ9Z 3ETCA 4DV2C 1ZH1A 1XRCA 1XMOC 3LNVA 5LL6f 3K7AI 3PBKA 2PMZA 2VUGA 5E7QA 5C44I 1KRLA 1Y1VI 4RVDA 4R0MA 1IBMC 2VZEA 1QF8A 2PT7G 3TDEA 2R93I 1FJGC 3CXCZ 2JA6I 4L7IA 3EQ6A 2LIYA 3DAYA 3GTQI 1O90A 3A9UA 4EATA 2O4HA 1NYEA 4LF4C 5T67A 1VQN1 1VQNZ 3HOVI 2NVYI 4ISBA 4TPSB 1RO2A 4DGLA 1NJI1 5CZVA 1VQ71 3SO4A 2JMOA 1VQ7Z 1TFIA 3GTMS 2JS4A 1JJ2Z 3PO3S 1P7LA 5KYTA 4YHHC 2GU2A 2KZFA 1ML8A 1K8A1 3C5EA 5DV9A 2JR6A 4JI6C 5IP7I 2PN2A 5AE1A 3NH8A 5T8TA 3BG1B 1VQ81 4L2ZA 1VQ8Z 3GTOI 2QR1B 4G36A 2H85A 3I08A 3CD61 1HR0C 3CD6Z 5BSUA 4DV0C 3VMHA 3GTGI 4BC9A 3TE5B 1YIJ1 1YIJZ 4ODJA 3DHVA 3L8CA 3J7A4 3VTNA 3FCCA 3CW9A 5BR8C 4LF5C 1VQ41 1RY2A 3S1QI 1VQ4Z 2Y27A 2UUCC 2K5RA 2WB1A 4I9FA 5GTDA 5IT9D 2QREB 3I07A 4MONA 4B3MC 4IZ6A 3J80f 3UZ0A 3RZDI 2KPIA 1T5HX 3FQMA 4A3KI 5A2Qf 2WP0C 1YIT1 1YITZ 1MDBA 4RVHA 1MXAA 5KYVA 1DL6A 3OW2Z 4Y52I 5T6BA 5IWAC 5LMNC 4JYAC 4HGZA 4R1MA 4LFAC 1KC82 5T64A 4RMNA 3T4NB 1TWGI 4X65C 2V7BA 4GKJC 2D1RA 3CCE1 3CCEZ 2D28C 3MONA 5AN9F 4A3EI 2Q51A 1Q862 3CW8X 1YJW1 2E0GA 3G7SA 1YJWZ 4NBHA 3M3YI 3I4MI 3MZKB 5JRHA 3TUFA 2DYJA 3NDJA 1KQSZ 4LF8C 4DV1C 2ASBA 2QRCB 3QWUA 2BJOA 3VNQA 2QLVB 3KIFA 1IBLC 3NDIA 3R9WA 1RO4A 2G2KA 2P20A 1YHQZ 5IT9b 2NVTI 1VQ51 1VQ5Z 3J81D 3NYQA 1WIIA 3S1RI 2W03A 4DCSA 2E8EA 3S82A 4E32A 2F4MA 3NYRA 3GR0A 4MRIA 1LQLA 2E8CA 3CC41 3CC4Z 3NI2A 3NH4A 3N54B 4DR6C 2K3RA 1XRAA 3CPWY 5BSMA 2OTL1 4PHTA 2OTLZ 1QYPA 1O9TA 3N2QA 2PROA 4DV7C 1O92A 5AE3A 4JI3C 1ZB9A 2P28A 1UKKA 3D9XA 4E31A 3I4NI 2D27A 2YU9I 1Q822 2E7GA 3GTLI 1N32C 5D1OB 3RZOI 5BSWA 1VQO1 1N2FA 1XMQC 1VQOZ 1JJ2Y 1QVGZ 2AKLA 4OXIA 1WCMI 4DK1A 1N34C 4A3LI 3Q87A 1PG4A 3IF8A 1BA3A 2ATWA 2JA7I 3S2DI 4HH4A 4L4QA 3CC71 4A3JI 3CC7Z 2HJGA 4DR2C 3GKQA 1KC81 3J81b 3IEVA 4NBCA 2E2JI 3GTJI 2DPLA 5A1GA 4E2XA 4JI5C 4DV5C 3FQQA 2P02A 3CCQ1 3H0GI 4KTVA 3CCQZ 4DCTA 5D1OA 2E2II 1Q861 1T5DX 3CJEA 2QL8A 1YJN1 3VMIA 1YJNZ 1J5EC 1XNRC 3AF6A 4NBAA 2EGTA 4GXRA 1Y1WI 3P5JB 1NP6A 1R9TI 3CQZI 3S1MI 4BBYA 3LUSA 2P2MA 4DV3C 4RVNA 4BBSI 3BG0B 2P2BA 4NDNA 3OW2Y 3LGXA 3CCJ1 2V8JA 4NFRA 3CCJZ 3HOZI 3VNSA 3S17I 3ETOA 3L95X 1I94C 5ADZA 5BUQA 3HOYI 3KIHA 1MXBA 3FCEA 4D4IA 1HNZC 2IZ4A 2HU9A 1S7MA 5AE2A 4MXUA 4I9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE7 A;  3S16 I;  4DR3 C;  2PK7 A;  3GCF A;  3S1N I;  4NB8 A;  1WF3 A;  4DV6 C;  5C4J I;  2UXB C;  4LF9 C;  4A3I I;  2YCB A;  3U50 C;  1N36 C;  1I3Q I;  4A3M I;  4NBE A;  1IBK C;  2JNY A;  4DV4 C;  4DR4 C;  2VQE C;  4QTU A;  4A3G I;  2E2H I;  4X62 C;  4GKK C;  4DCU A;  1N33 C;  1EGA A;  2XR1 A;  1K83 I;  3VMG A;  2D7V A;  4Y7N I;  5FLM I;  4DCV A;  1I6H I;  4BSZ A;  3HOU I;  3AF5 A;  2NVX I;  4K0K C;  2UXD C;  5A2Q D;  4B3R C;  2J6A A;  3PO2 I;  1HH2 P;  4JI7 C;  1JOS A;  1XNQ C;  4NOZ A;  1HNW C;  3OTO C;  3S14 I;  3HOX I;  3R9X A;  2JA8 I;  4B3T C;  4YY3 C;  2R92 I;  4A3C I;  3EER A;  4JI1 C;  4LF6 C;  3GTP I;  4A3D I;  4JI2 C;  1HNX C;  3GKU A;  3ESW A;  4QTT A;  3S2H I;  1QWI A;  2DE5 A;  3GTK I;  4DUZ C;  4LFB C;  3M4O I;  2E8F A;  4JI8 C;  2VQF C;  1KKG A;  1TWA I;  3T1Y C;  2UXC C;  4NBF A;  1TWC I;  2E5L C;  1RLY A;  1X3W A;  5CM2 M;  4A93 I;  3S15 I;  4NBG A;  2NVQ I;  4DR1 C;  1NUI A;  3HOW I;  2OPL B;  4X64 C;  2ONF A;  1K0R A;  4BY7 I;  5C3E I;  1L2F A;  4DR5 C;  5C4X I;  2JA5 I;  1Y1V S;  2OPL A;  1I50 I;  4MTN A;  4AQY C;  2UUA C;  1WW9 A;  3FKI I;  1HNZ C;  1TWF I;  2HF1 A;  4NB9 A;  4JV5 C;  4B3S C;  4OX9 C;  4BY1 I;  4DR7 C;  4JI4 C;  2UUB C;  1PFT A;  4MH4 A;  2HHH C;  4BXX I;  3JAM D;  1ZB8 A;  1MKY A;  4NXN C;  5LMU C;  3J80 D;  4NBB A;  1VLA A;  1USP B;  1PA4 A;  2JMP A;  2CY1 A;  4XX2 A;  1TWH I;  4BBR I;  1WH9 A;  4X6A I;  3D6W A;  3T1H C;  5IP9 I;  4NBD A;  2UU9 C;  1USP A;  3H3V J;  2F4V C;  4JI0 C;  1X3Z A;  3VB9 A;  2R7Z I;  1L1O C;  2VUM I;  4LF7 C;  5FLX D;  2DE6 A;  4A3B I;  4LFC C;  1YUA A;  2CXC A;  2B63 I;  2F4O A;  4X66 C;  2RBL A;  4A3F I;  4KHP C;  3IEU A;  4NXM C;  2P3Y A;  3GTM I;  1SFO I;  3PO3 I;  2ZM6 C;  4DUY C;  4DV2 C;  1XMO C;  3K7A I;  5C44 I;  1Y1V I;  1IBM C;  2PT7 G;  2R93 I;  1FJG C;  2JA6 I;  3GTQ I;  1NYE A;  4LF4 C;  3HOV I;  2NVY I;  1TFI A;  3GTM S;  2JS4 A;  3PO3 S;  4YHH C;  2KZF A;  1ML8 A;  2JR6 A;  4JI6 C;  5IP7 I;  2PN2 A;  3GTO I;  1HR0 C;  4DV0 C;  3VMH A;  3GTG I;  4LF5 C;  5BR8 C;  3S1Q I;  2UUC C;  2K5R A;  4B3M C;  5IT9 D;  3I07 A;  3RZD I;  2KPI A;  4A3K I;  1DL6 A;  4Y52 I;  5IWA C;  5LMN C;  4JYA C;  1TWG I;  4X65 C;  4GKJ C;  4A3E I;  4NBH A;  3M3Y I;  3I4M I;  2DYJ A;  4LF8 C;  4DV1 C;  2ASB A;  2BJO A;  1IBL C;  3R9W A;  1RO4 A;  2NVT I;  3J81 D;  3S1R I;  4DCS A;  2E8E A;  2F4M A;  1LQL A;  2E8C A;  4DR6 C;  1QYP A;  4DV7 C;  4JI3 C;  1ZB9 A;  1UKK A;  3I4N I;  2YU9 I;  2E7G A;  3GTL I;  1N32 C;  3RZO I;  1XMQ C;  1N2F A;  2AKL A;  1WCM I;  1N34 C;  4A3L I;  3Q87 A;  2ATW A;  2JA7 I;  3S2D I;  4A3J I;  2HJG A;  4DR2 C;  3GKQ A;  3IEV A;  4NBC A;  2E2J I;  3GTJ I;  4JI5 C;  4DV5 C;  3H0G I;  4DCT A;  2E2I I;  3CJE A;  2QL8 A;  3VMI A;  1J5E C;  1XNR C;  3AF6 A;  4NBA A;  2EGT A;  1Y1W I;  1R9T I;  3S1M I;  3CQZ I;  3LUS A;  4DV3 C;  4BBS I;  3HOZ I;  3S17 I;  1I94 C;  3HOY I;  4LFA C; 
#chains in the Genus database with same CATH topology
 2DE7 A;  3TDH B;  3S16 I;  3EED A;  3JAM f;  4MD9 A;  4PRO C;  2OZK A;  4DR3 C;  1KQS Y;  2PK7 A;  3GCF A;  1Q7Y 2;  3S1N I;  4NB8 A;  1WF3 A;  3CQ1 A;  4WV3 A;  3RG2 A;  3CCM 1;  5K8F A;  4DV6 C;  2WAQ A;  5C4J I;  2I3C A;  3CCM Z;  1Q82 1;  2OTJ Z;  2OTJ 1;  4A3I I;  2WD9 A;  2YCB A;  4LF9 C;  3U50 C;  5BSV A;  1N36 C;  1I3Q I;  4A3M I;  2V3V A;  4NBE A;  2YWB A;  3CCR 1;  3NFZ A;  3CCR Z;  1VQK 1;  1VQK Z;  1IBK C;  2QVX X;  3CCS 1;  2JNY A;  2Z51 A;  3CCS Z;  4G1I A;  4DV4 C;  2VQE C;  4DR4 C;  4QTU A;  1YUK A;  1IB8 A;  4DG8 A;  2RPR A;  4A3G I;  3NPD A;  2E2H I;  1VEH A;  4X62 C;  4GKK C;  2OOY B;  4DCU A;  1N33 C;  2P2J A;  4IR7 A;  4RM2 A;  1EGA A;  4FUT A;  2XR1 A;  2RT9 A;  1K83 I;  1M6X C;  3VMG A;  1RNI A;  3IFU A;  2D7V A;  4RM3 A;  2W04 A;  2V8K A;  4Y7N I;  5FLM I;  4DCV A;  4NH1 C;  1I6H I;  5LCI A;  4BSZ A;  1YJ9 1;  1YJ9 Z;  4S1T A;  3HOU I;  1MXC A;  3CC2 1;  3CC2 Z;  3AF5 A;  4K0B A;  2NVX I;  3UOW A;  1JWH C;  2OBV A;  2JIO A;  2LEX A;  1Z03 A;  4ZLP A;  4K0K C;  1VQL 1;  5FLX f;  3CQ3 A;  1VQL Z;  2UXD C;  4D57 A;  5A2Q D;  1YI2 1;  3IML A;  1YI2 Z;  4PZP A;  1PG3 A;  4JI7 C;  2J6A A;  3PO2 I;  1HH2 P;  3A25 A;  4B3R C;  3E7X A;  2BH1 X;  2QRD B;  1JOS A;  2MCQ A;  1VQM 1;  1Q81 2;  1XNQ C;  1VQM Z;  4NOZ A;  1HNW C;  2DHM A;  2YWC A;  3OTO C;  2NCL A;  3S14 I;  3HOX I;  4PUH A;  3R9X A;  2JA8 I;  4B3T C;  3I56 1;  3CXC Y;  4YY3 C;  3I56 Z;  2JIM A;  2R92 I;  2QVZ X;  4A3C I;  4E2W A;  1Q7Y 1;  1P4E A;  3EER A;  2D1Q A;  1VQP 1;  2V8I A;  1VQP Z;  2KI7 B;  3CCL 1;  4JI1 C;  3CCL Z;  3JAM b;  4LF6 C;  1QVF Z;  1GPM A;  1RG9 A;  3GTP I;  4A3D I;  2YAD A;  4E30 A;  4RLF A;  4AYB A;  3J80 b;  3DLP X;  2OOX B;  5A19 A;  4JI2 C;  1HNX C;  5A2Q b;  3GKU A;  3ESW A;  1P9N A;  5BSR A;  4QTT A;  3S2H I;  1QWI A;  2DE5 A;  1W2B Z;  3GTK I;  2LFU A;  2GTH A;  4DUZ C;  4LFB C;  2OO4 A;  4BCA A;  3M4O I;  2E8F A;  3PES A;  1K9M 2;  4JI8 C;  1XRB A;  2VQF C;  1KKG A;  1TWA I;  1X0T A;  2QVY X;  3T1Y C;  5H9U A;  2UXC C;  4NBF A;  2VPY A;  1TWC I;  4OYC A;  2E5L C;  1RLY A;  1X3W A;  2QEX 1;  5CM2 M;  4A93 I;  2QEX Z;  1N8R 2;  4GS5 A;  4KTT A;  1YJ7 A;  4JM1 A;  4EWC A;  4RVF A;  2Q4Z A;  3S15 I;  4NBG A;  2D1T A;  5CZX A;  3CPW Z;  3IR7 A;  3R44 A;  4BC7 A;  1Y8C A;  5IT9 f;  2NVQ I;  3H2T A;  4G37 A;  1Q81 1;  4DR1 C;  1NUI A;  2QKD A;  3HOW I;  2IZ3 A;  4RS4 A;  4RLQ A;  4LE5 A;  5FLX b;  3GR1 A;  2M6N A;  2VPX A;  2OPL B;  3PRO C;  3IX0 A;  3E7W A;  4X64 C;  2ONF A;  1FLO A;  3CCV 1;  4D4G A;  3CCV Z;  1K0R A;  3CQ2 A;  3GPC A;  5D1P A;  3B7W A;  2O53 A;  1M90 2;  4BY7 I;  3CCU 1;  3CCU Z;  5C3E I;  1WZN A;  2M48 A;  1L2F A;  4DR5 C;  3A9V A;  1Q16 A;  5C4X I;  4PUI A;  2JA5 I;  1Y1V S;  2OPL A;  1I50 I;  4E33 A;  4MTN A;  5BUS A;  3LNO A;  2KDN A;  1KD1 2;  4AQY C;  2QW0 X;  1M1K 2;  3F3F C;  1Z01 A;  1WCJ A;  2D1S A;  2JUB A;  2UUA C;  1WW9 A;  2RHB A;  1K73 2;  3I55 1;  3FKI I;  2Y0S A;  3I55 Z;  3CMA Z;  3CMA 1;  4HPV A;  4MD8 A;  1RO0 A;  1TWF I;  2HF1 A;  4NB9 A;  3TQI A;  4CL1 A;  5A1I A;  5IFI A;  4B3S C;  4JV5 C;  4OX9 C;  4U5Y D;  3CME 1;  4BY1 I;  3CME Z;  3J81 f;  4DR7 C;  2VF1 A;  4JI4 C;  1TH5 A;  2UUB C;  2UXB C;  1PFT A;  4MH4 A;  2AYA A;  2HHH C;  4BXX I;  3JAM D;  1XS3 A;  1ZB8 A;  1MKY A;  4TNU A;  1K9M 1;  2ZAE B;  1S72 1;  2Y4O A;  1S72 Z;  5LMU C;  4DQY B;  4NXN C;  1QVG Y;  4RVG A;  4FUQ A;  3G4S 1;  3J80 D;  1QVF Y;  3G4S Z;  2VSQ A;  1VLA A;  4NBB A;  4WS9 A;  1USP B;  1N8R 1;  2RIQ A;  1PA4 A;  2JMP A;  5BST A;  4MD7 A;  1VQ6 1;  1VQ6 Z;  3UX2 A;  2CY1 A;  4XX2 A;  3IPL A;  1ULT A;  2P2F A;  1TWH I;  4BBR I;  1WH9 A;  2V45 A;  4X6A I;  3D6W A;  1W2B Y;  3T1H C;  4E2Y A;  5IP9 I;  1FUG A;  4FTF A;  2VPW A;  1NJI 2;  4R1L A;  3G6E 1;  4NBD A;  3G6E Z;  1MD9 A;  1AMU A;  1YHQ 1;  5BUR A;  2UU9 C;  1USP A;  2MM9 A;  3F3P C;  2JIP A;  1RQF A;  2E9H A;  1M90 1;  1K8A 2;  3H3V J;  2F4V C;  4ZJZ A;  4JI0 C;  2VPZ A;  3VNR A;  1X3Z A;  3LAX A;  1LCI A;  4RVO A;  3VB9 A;  4E2Z A;  2R7Z I;  5T8S A;  1P4E C;  1FDI A;  3KXW A;  1L1O C;  4RV9 A;  3G71 1;  3G71 Z;  3K6R A;  2VUM I;  2R6M A;  4LF7 C;  5K85 A;  4HGY A;  3NH5 A;  2GTI A;  1KD1 1;  4GXQ A;  5FLX D;  2DE6 A;  1M1K 1;  4A3B I;  1V26 A;  2Y4N A;  2M5H A;  4LFC C;  1YUA A;  2CXC A;  4D56 A;  3HKZ A;  2B63 I;  1K73 1;  2F4O A;  4X66 C;  2RBL A;  3MZL B;  4A3F I;  4KHP C;  2ZZM A;  1Z02 A;  3IEU A;  2P2Q A;  4NXM C;  1MDF A;  2P3Y A;  2QA4 1;  2M5O A;  2QA4 Z;  4DG9 A;  2JIR A;  3GTM I;  1SFO I;  3PO3 I;  2ZM6 C;  1V25 A;  3A4I A;  1O93 A;  1QM4 A;  2PM9 A;  3RV2 A;  3UX3 A;  4DUY C;  1VQ9 1;  5KEI A;  1VQ9 Z;  3ETC A;  4DV2 C;  1ZH1 A;  1NY8 A;  1FDO A;  1XRC A;  1XMO C;  3LNV A;  5LL6 f;  3K7A I;  3PBK A;  2PMZ A;  2VUG A;  5E7Q A;  5C44 I;  1KRL A;  1Y1V I;  2AYD A;  2NAP A;  4RVD A;  4R0M A;  1IBM C;  2VZE A;  1QF8 A;  2PT7 G;  3TDE A;  2R93 I;  1FJG C;  3CXC Z;  2JA6 I;  4L7I A;  3EQ6 A;  1PU1 A;  2LIY A;  3DAY A;  3GTQ I;  1O90 A;  3A9U A;  4EAT A;  2O4H A;  1NYE A;  4LF4 C;  5T67 A;  1VQN 1;  1VQN Z;  3HOV I;  2NVY I;  4ISB A;  4TPS B;  1RO2 A;  4DGL A;  1NJI 1;  5CZV A;  1XHJ A;  1VQ7 1;  3SO4 A;  2JMO A;  1VQ7 Z;  1TFI A;  3GTM S;  2JS4 A;  1JJ2 Z;  3PO3 S;  1P7L A;  5KYT A;  4YHH C;  2GU2 A;  1AA6 A;  2KZF A;  1ML8 A;  1K8A 1;  3C5E A;  5DV9 A;  2JR6 A;  4JI6 C;  5IP7 I;  2PN2 A;  5AE1 A;  3NH8 A;  5T8T A;  3BG1 B;  1VQ8 1;  4L2Z A;  1VQ8 Z;  3GTO I;  2QR1 B;  4G36 A;  2JNV A;  2H85 A;  3I08 A;  3CD6 1;  1HR0 C;  3CD6 Z;  5BSU A;  4DV0 C;  3VMH A;  3GTG I;  4BC9 A;  3TE5 B;  1YIJ 1;  1YIJ Z;  4ODJ A;  3DHV A;  3L8C A;  3J7A 4;  3VTN A;  3FCC A;  3CW9 A;  5BR8 C;  4LF5 C;  1VQ4 1;  1RY2 A;  3S1Q I;  1VQ4 Z;  2Y27 A;  2UUC C;  2K5R A;  2WB1 A;  4I9F A;  5GTD A;  5IT9 D;  2QRE B;  3I07 A;  4MON A;  2MMA B;  4B3M C;  4IZ6 A;  2ZZN A;  3J80 f;  3UZ0 A;  3RZD I;  2KPI A;  1T5H X;  3FQM A;  4A3K I;  5A2Q f;  2WP0 C;  1YIT 1;  1YIT Z;  1MDB A;  4RVH A;  1MXA A;  5KYV A;  2YX1 A;  3TR3 A;  1DL6 A;  3OW2 Z;  4Y52 I;  5T6B A;  5IWA C;  5LMN C;  4JYA C;  4HGZ A;  4R1M A;  4LFA C;  1M6X A;  1KC8 2;  5T64 A;  4RMN A;  4PUG A;  3T4N B;  1TWG I;  4X65 C;  2V7B A;  3O2E A;  4GKJ C;  2D1R A;  3CCE 1;  3CCE Z;  2D28 C;  3MON A;  5AN9 F;  4A3E I;  2Q51 A;  1Q86 2;  3CW8 X;  1YJW 1;  2E0G A;  3G7S A;  1YJW Z;  4NBH A;  3M3Y I;  3D2L A;  3I4M I;  3MZK B;  5JRH A;  3TUF A;  2DYJ A;  3NDJ A;  1KQS Z;  4LF8 C;  1SIW A;  4DV1 C;  2ASB A;  2QRC B;  3QWU A;  2BJO A;  3VNQ A;  2QLV B;  3KIF A;  1IBL C;  3NDI A;  3R9W A;  1RO4 A;  2G2K A;  2P20 A;  1YHQ Z;  5IT9 b;  2E7Z A;  2NVT I;  1VQ5 1;  1VQ5 Z;  3J81 D;  3A26 A;  1WII A;  3S1R I;  2W03 A;  3NYQ A;  2E8E A;  4DCS A;  3S82 A;  4E32 A;  2F4M A;  3NYR A;  1V60 A;  4MRI A;  3GR0 A;  1LQL A;  2E8C A;  3CC4 1;  3CC4 Z;  3NI2 A;  3NH4 A;  3N54 B;  4DR6 C;  2K3R A;  1XRA A;  3CPW Y;  2CU6 A;  5BSM A;  2OTL 1;  4PHT A;  2OTL Z;  1QYP A;  1O9T A;  3N2Q A;  2PRO A;  4DV7 C;  1O92 A;  5AE3 A;  4JI3 C;  1ZB9 A;  3UEB A;  2P28 A;  1UKK A;  3D9X A;  4E31 A;  3I4N I;  2D27 A;  2YU9 I;  1Q82 2;  2E7G A;  3GTL I;  1N32 C;  5D1O B;  3RZO I;  5BSW A;  1VQO 1;  1N2F A;  1XMQ C;  1VQO Z;  1JJ2 Y;  1QVG Z;  2AKL A;  4OXI A;  1WCM I;  4DK1 A;  1N34 C;  4A3L I;  3Q87 A;  1PG4 A;  2IV2 X;  2KZ0 A;  3IF8 A;  1BA3 A;  2ATW A;  2JA7 I;  3S2D I;  4HH4 A;  4L4Q A;  3CC7 1;  4A3J I;  3CC7 Z;  2HJG A;  4DR2 C;  3GKQ A;  1KC8 1;  3J81 b;  3IEV A;  4NBC A;  2E2J I;  3GTJ I;  1WJ2 A;  2DPL A;  5A1G A;  4E2X A;  4JI5 C;  4DV5 C;  3FQQ A;  2P02 A;  3CCQ 1;  1QXF A;  3H0G I;  3CCQ Z;  4KTV A;  4DCT A;  5D1O A;  2E2I I;  1Q86 1;  1T5D X;  3CJE A;  2QL8 A;  1YJN 1;  3VMI A;  1YJN Z;  1J5E C;  1XNR C;  3AF6 A;  4NBA A;  2EGT A;  4GXR A;  1Y1W I;  3P5J B;  3AY0 A;  1NP6 A;  1R9T I;  3CQZ I;  3S1M I;  4BBY A;  3LUS A;  2P2M A;  4DV3 C;  4RVN A;  4BBS I;  3BG0 B;  2JIQ A;  2P2B A;  4NDN A;  3OW2 Y;  3LGX A;  3CCJ 1;  2V8J A;  4NFR A;  3CCJ Z;  3HOZ I;  3VNS A;  3S17 I;  3ETO A;  3L95 X;  1I94 C;  5ADZ A;  5BUQ A;  3HOY I;  1UWD A;  3KIH A;  1MXB A;  3FCE A;  4D4I A;  1HNZ C;  2IZ4 A;  2HU9 A;  1S7M A;  5AE2 A;  4MXU A;  4I9G A; 
#chains in the Genus database with same CATH homology
 2DE7 A;  3TDH B;  3S16 I;  3EED A;  3JAM f;  4MD9 A;  4PRO C;  2OZK A;  4DR3 C;  1KQS Y;  2PK7 A;  3GCF A;  1Q7Y 2;  3S1N I;  4NB8 A;  1WF3 A;  4WV3 A;  3RG2 A;  3CCM 1;  5K8F A;  4DV6 C;  2WAQ A;  5C4J I;  2I3C A;  3CCM Z;  1Q82 1;  2OTJ Z;  2OTJ 1;  4A3I I;  2WD9 A;  2YCB A;  4LF9 C;  3U50 C;  5BSV A;  1N36 C;  1I3Q I;  4A3M I;  4NBE A;  2YWB A;  3CCR 1;  3NFZ A;  3CCR Z;  1VQK 1;  1VQK Z;  1IBK C;  2QVX X;  3CCS 1;  2JNY A;  3CCS Z;  4G1I A;  4DV4 C;  2VQE C;  4DR4 C;  4QTU A;  1YUK A;  4DG8 A;  2RPR A;  4A3G I;  3NPD A;  2E2H I;  4X62 C;  4GKK C;  2OOY B;  4DCU A;  1N33 C;  2P2J A;  4IR7 A;  4RM2 A;  1EGA A;  4FUT A;  2XR1 A;  2RT9 A;  1K83 I;  3VMG A;  1RNI A;  3IFU A;  2D7V A;  4RM3 A;  2W04 A;  2V8K A;  4Y7N I;  5FLM I;  4DCV A;  4NH1 C;  1I6H I;  4BSZ A;  1YJ9 1;  1YJ9 Z;  4S1T A;  3HOU I;  1MXC A;  3CC2 1;  3CC2 Z;  3AF5 A;  4K0B A;  2NVX I;  3UOW A;  1JWH C;  2OBV A;  1Z03 A;  4ZLP A;  4K0K C;  1VQL 1;  5FLX f;  2UXD C;  1VQL Z;  4D57 A;  5A2Q D;  1YI2 1;  3IML A;  1YI2 Z;  4PZP A;  1PG3 A;  4JI7 C;  2J6A A;  3PO2 I;  1HH2 P;  4B3R C;  3E7X A;  2BH1 X;  2QRD B;  1JOS A;  1VQM 1;  1Q81 2;  1XNQ C;  1VQM Z;  4NOZ A;  1HNW C;  2YWC A;  3OTO C;  3S14 I;  3HOX I;  3R9X A;  2JA8 I;  4B3T C;  3I56 1;  3CXC Y;  4YY3 C;  3I56 Z;  2R92 I;  2QVZ X;  4A3C I;  4E2W A;  1Q7Y 1;  3EER A;  2D1Q A;  1VQP 1;  2V8I A;  1VQP Z;  2KI7 B;  3CCL 1;  4JI1 C;  3CCL Z;  3JAM b;  4LF6 C;  1QVF Z;  1GPM A;  1RG9 A;  3GTP I;  4A3D I;  2YAD A;  4E30 A;  4RLF A;  4AYB A;  3J80 b;  3DLP X;  2OOX B;  5A19 A;  4JI2 C;  1HNX C;  5A2Q b;  3GKU A;  3ESW A;  1P9N A;  5BSR A;  4QTT A;  3S2H I;  1QWI A;  2DE5 A;  1W2B Z;  3GTK I;  2LFU A;  2GTH A;  4DUZ C;  4LFB C;  2OO4 A;  4BCA A;  3M4O I;  2E8F A;  3PES A;  1K9M 2;  4JI8 C;  1XRB A;  2VQF C;  1KKG A;  1TWA I;  1X0T A;  2QVY X;  3T1Y C;  5H9U A;  2UXC C;  4NBF A;  1TWC I;  4OYC A;  2E5L C;  1RLY A;  1X3W A;  2QEX 1;  5CM2 M;  4A93 I;  2QEX Z;  1N8R 2;  4GS5 A;  4KTT A;  1YJ7 A;  4JM1 A;  4EWC A;  4RVF A;  2Q4Z A;  3S15 I;  4NBG A;  2D1T A;  5CZX A;  3CPW Z;  3R44 A;  4BC7 A;  5IT9 f;  2NVQ I;  3H2T A;  4G37 A;  1Q81 1;  4DR1 C;  1NUI A;  2QKD A;  3HOW I;  2IZ3 A;  4RS4 A;  4RLQ A;  4LE5 A;  5FLX b;  3GR1 A;  2M6N A;  3PRO C;  2OPL B;  3IX0 A;  3E7W A;  4X64 C;  2ONF A;  3CCV 1;  4D4G A;  3CCV Z;  1K0R A;  3GPC A;  5D1P A;  3B7W A;  2O53 A;  1M90 2;  4BY7 I;  3CCU 1;  3CCU Z;  5C3E I;  2M48 A;  1L2F A;  4DR5 C;  3A9V A;  5C4X I;  2JA5 I;  1Y1V S;  2OPL A;  1I50 I;  4E33 A;  4MTN A;  5BUS A;  1KD1 2;  4AQY C;  2QW0 X;  1M1K 2;  3F3F C;  1Z01 A;  2D1S A;  2JUB A;  2UUA C;  1WW9 A;  2RHB A;  1K73 2;  3I55 1;  3FKI I;  2Y0S A;  3I55 Z;  3CMA Z;  3CMA 1;  4HPV A;  4MD8 A;  1RO0 A;  1TWF I;  2HF1 A;  4NB9 A;  3TQI A;  4CL1 A;  5A1I A;  5IFI A;  4B3S C;  4JV5 C;  4OX9 C;  4U5Y D;  3CME 1;  4BY1 I;  3CME Z;  3J81 f;  4DR7 C;  2VF1 A;  4JI4 C;  2UUB C;  2UXB C;  1PFT A;  4MH4 A;  2AYA A;  2HHH C;  4BXX I;  3JAM D;  1ZB8 A;  1MKY A;  4TNU A;  1K9M 1;  2ZAE B;  1S72 1;  2Y4O A;  1S72 Z;  5LMU C;  4DQY B;  4NXN C;  1QVG Y;  4RVG A;  4FUQ A;  3G4S 1;  3J80 D;  1QVF Y;  3G4S Z;  2VSQ A;  1VLA A;  4NBB A;  4WS9 A;  1USP B;  1N8R 1;  2RIQ A;  1PA4 A;  2JMP A;  5BST A;  4MD7 A;  1VQ6 1;  1VQ6 Z;  2CY1 A;  4XX2 A;  3IPL A;  1ULT A;  2P2F A;  1TWH I;  4BBR I;  1WH9 A;  4X6A I;  3D6W A;  1W2B Y;  3T1H C;  4E2Y A;  5IP9 I;  1FUG A;  4FTF A;  1NJI 2;  4R1L A;  3G6E 1;  4NBD A;  3G6E Z;  1MD9 A;  1AMU A;  1YHQ 1;  5BUR A;  2UU9 C;  1USP A;  3F3P C;  1RQF A;  2E9H A;  1M90 1;  1K8A 2;  3H3V J;  2F4V C;  4ZJZ A;  4JI0 C;  3VNR A;  1X3Z A;  3LAX A;  1LCI A;  4RVO A;  3VB9 A;  4E2Z A;  2R7Z I;  5T8S A;  3KXW A;  1L1O C;  4RV9 A;  3G71 1;  3G71 Z;  2VUM I;  2R6M A;  4LF7 C;  5K85 A;  4HGY A;  3NH5 A;  2GTI A;  1KD1 1;  4GXQ A;  5FLX D;  2DE6 A;  1M1K 1;  4A3B I;  1V26 A;  2Y4N A;  4LFC C;  1YUA A;  2CXC A;  4D56 A;  3HKZ A;  2B63 I;  1K73 1;  2F4O A;  4X66 C;  2RBL A;  3MZL B;  4A3F I;  4KHP C;  1Z02 A;  3IEU A;  2P2Q A;  4NXM C;  1MDF A;  2P3Y A;  2QA4 1;  2QA4 Z;  4DG9 A;  3GTM I;  1SFO I;  3PO3 I;  2ZM6 C;  1V25 A;  3A4I A;  1O93 A;  1QM4 A;  2PM9 A;  3RV2 A;  4DUY C;  1VQ9 1;  5KEI A;  1VQ9 Z;  3ETC A;  4DV2 C;  1ZH1 A;  1XRC A;  1XMO C;  3LNV A;  5LL6 f;  3K7A I;  3PBK A;  2PMZ A;  2VUG A;  5E7Q A;  5C44 I;  1KRL A;  1Y1V I;  4RVD A;  4R0M A;  1IBM C;  2VZE A;  1QF8 A;  2PT7 G;  3TDE A;  2R93 I;  1FJG C;  3CXC Z;  2JA6 I;  4L7I A;  3EQ6 A;  2LIY A;  3DAY A;  3GTQ I;  1O90 A;  3A9U A;  4EAT A;  2O4H A;  1NYE A;  4LF4 C;  5T67 A;  1VQN 1;  1VQN Z;  3HOV I;  2NVY I;  4ISB A;  4TPS B;  1RO2 A;  4DGL A;  1NJI 1;  5CZV A;  1VQ7 1;  3SO4 A;  2JMO A;  1VQ7 Z;  1TFI A;  3GTM S;  2JS4 A;  1JJ2 Z;  3PO3 S;  1P7L A;  5KYT A;  4YHH C;  2GU2 A;  2KZF A;  1ML8 A;  1K8A 1;  3C5E A;  5DV9 A;  2JR6 A;  4JI6 C;  5IP7 I;  2PN2 A;  5AE1 A;  3NH8 A;  5T8T A;  3BG1 B;  1VQ8 1;  4L2Z A;  1VQ8 Z;  3GTO I;  2QR1 B;  4G36 A;  2H85 A;  3I08 A;  3CD6 1;  1HR0 C;  3CD6 Z;  5BSU A;  4DV0 C;  3VMH A;  3GTG I;  4BC9 A;  3TE5 B;  1YIJ 1;  1YIJ Z;  4ODJ A;  3DHV A;  3L8C A;  3J7A 4;  3VTN A;  3FCC A;  3CW9 A;  5BR8 C;  4LF5 C;  1VQ4 1;  1RY2 A;  3S1Q I;  1VQ4 Z;  2Y27 A;  2UUC C;  2K5R A;  2WB1 A;  4I9F A;  5GTD A;  5IT9 D;  2QRE B;  3I07 A;  4MON A;  4B3M C;  4IZ6 A;  3J80 f;  3UZ0 A;  3RZD I;  2KPI A;  1T5H X;  3FQM A;  4A3K I;  5A2Q f;  2WP0 C;  1YIT 1;  1YIT Z;  1MDB A;  4RVH A;  1MXA A;  5KYV A;  1DL6 A;  3OW2 Z;  4Y52 I;  5T6B A;  5IWA C;  5LMN C;  4JYA C;  4HGZ A;  4R1M A;  4LFA C;  1KC8 2;  5T64 A;  4RMN A;  3T4N B;  1TWG I;  4X65 C;  2V7B A;  4GKJ C;  2D1R A;  3CCE 1;  3CCE Z;  2D28 C;  3MON A;  5AN9 F;  4A3E I;  2Q51 A;  1Q86 2;  3CW8 X;  1YJW 1;  2E0G A;  3G7S A;  1YJW Z;  4NBH A;  3M3Y I;  3I4M I;  3MZK B;  5JRH A;  3TUF A;  2DYJ A;  3NDJ A;  1KQS Z;  4LF8 C;  4DV1 C;  2ASB A;  2QRC B;  3QWU A;  2BJO A;  3VNQ A;  2QLV B;  3KIF A;  1IBL C;  3NDI A;  3R9W A;  1RO4 A;  2G2K A;  2P20 A;  1YHQ Z;  5IT9 b;  2NVT I;  1VQ5 1;  1VQ5 Z;  3J81 D;  3NYQ A;  1WII A;  3S1R I;  2W03 A;  4DCS A;  2E8E A;  3S82 A;  4E32 A;  2F4M A;  3NYR A;  3GR0 A;  4MRI A;  1LQL A;  2E8C A;  3CC4 1;  3CC4 Z;  3NI2 A;  3NH4 A;  3N54 B;  4DR6 C;  2K3R A;  1XRA A;  3CPW Y;  5BSM A;  2OTL 1;  4PHT A;  2OTL Z;  1QYP A;  1O9T A;  3N2Q A;  2PRO A;  4DV7 C;  1O92 A;  5AE3 A;  4JI3 C;  1ZB9 A;  2P28 A;  1UKK A;  3D9X A;  4E31 A;  3I4N I;  2D27 A;  2YU9 I;  1Q82 2;  2E7G A;  3GTL I;  1N32 C;  5D1O B;  3RZO I;  5BSW A;  1VQO 1;  1N2F A;  1XMQ C;  1VQO Z;  1JJ2 Y;  1QVG Z;  2AKL A;  4OXI A;  1WCM I;  4DK1 A;  1N34 C;  4A3L I;  3Q87 A;  1PG4 A;  3IF8 A;  1BA3 A;  2ATW A;  2JA7 I;  3S2D I;  4HH4 A;  4L4Q A;  3CC7 1;  4A3J I;  3CC7 Z;  2HJG A;  4DR2 C;  3GKQ A;  1KC8 1;  3J81 b;  3IEV A;  4NBC A;  2E2J I;  3GTJ I;  2DPL A;  5A1G A;  4E2X A;  4JI5 C;  4DV5 C;  3FQQ A;  2P02 A;  3CCQ 1;  3H0G I;  4KTV A;  3CCQ Z;  4DCT A;  5D1O A;  2E2I I;  1Q86 1;  1T5D X;  3CJE A;  2QL8 A;  1YJN 1;  3VMI A;  1YJN Z;  1J5E C;  1XNR C;  3AF6 A;  4NBA A;  2EGT A;  4GXR A;  1Y1W I;  3P5J B;  1NP6 A;  1R9T I;  3CQZ I;  3S1M I;  4BBY A;  3LUS A;  2P2M A;  4DV3 C;  4RVN A;  4BBS I;  3BG0 B;  2P2B A;  4NDN A;  3OW2 Y;  3LGX A;  3CCJ 1;  2V8J A;  4NFR A;  3CCJ Z;  3HOZ I;  3VNS A;  3S17 I;  3ETO A;  3L95 X;  1I94 C;  5ADZ A;  5BUQ A;  3HOY I;  3KIH A;  1MXB A;  3FCE A;  4D4I A;  1HNZ C;  2IZ4 A;  2HU9 A;  1S7M A;  5AE2 A;  4MXU A;  4I9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...