1VLAA

Crystal structure of hydroperoxide resistance protein osmc (tm0919) from thermotoga maritima at 1.80 a resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
144
structure length
144
Chain Sequence
HHHHHHMQARWIGNMMFHVRTDSNHDVLMDTKEEVGGKDAAPRPLELVLTGLMGCTGMDVVSILRKMKVIDQMKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEKYCSVSAILKCSSKVTYEIVYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydroperoxide resistance protein OsmC
publication title Crystal structure of Hydroperoxide resistance protein OsmC (TM0919) from Thermotoga maritima at 1.80 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
total genus 34
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1vlaA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1vlaA02
1QWIA 3AF6A 1UKKA 4LF4C 3S15I 3OTOC 2NVYI 2E8FA 2OPLB 2DE6A 4BY1I 3PO3I 2E5LC 2JMPA 1LQLA 3IEUA 1TWFI 2CXCA 4DR2C 4QTTA 3I4MI 3EERA 2JA6I 5C4JI 2PN2A 4DCVA 5BR8C 4JI0C 3J81D 3D6WA 2YCBA 4B3MC 2E8CA 2R92I 1ZB9A 3S16I 2ASBA 3S1NI 4LF5C 4DV6C 3H3VJ 4GKKC 1K0RA 1MKYA 3GTKI 3T1HC 4A3DI 1XMOC 4NBEA 4GKJC 2VQFC 4BBSI 1Y1VS 1K83I 5FLMI 4DV5C 3PO2I 4JYAC 4NOZA 4NBHA 4LFBC 1N36C 3S1RI 2RBLA 4DR1C 2K5RA 4B3RC 3GTGI 4NB9A 2NVTI 4X62C 3HOVI 4A3MI 4JI6C 4A3JI 4JI7C 4A3KI 3JAMD 4JI8C 2JA5I 2JA7I 2F4OA 1HNWC 4JI5C 4NBAA 4JI2C 3GTMI 4OX9C 2JNYA 1N34C 3IEVA 1XNQC 1HH2P 2QL8A 1I6HI 2JA8I 5CM2M 1I94C 2KPIA 1Y1VI 3GTLI 1IBLC 4A3FI 4X66C 4B3TC 4DV2C 3RZDI 4DCUA 1TWCI 5IP9I 2PK7A 1PFTA 2UUBC 2VQEC 1TFIA 1R9TI 4BXXI 3J80D 3S1MI 2F4MA 4X64C 4NXMC 2UXDC 4DV3C 1WF3A 2EGTA 1HNXC 1VLAA 3K7AI 1YUAA 2B63I 3S1QI 1USPA 2UXCC 2JS4A 4A3CI 1QYPA 2UXBC 1ML8A 3GTMS 2F4VC 3H0GI 2DYJA 3R9XA 1TWAI 4DV1C 3GTJI 3ESWA 3GTPI 3CJEA 3GTOI 1IBKC 3S17I 3GKUA 4K0KC 4DR7C 1X3WA 2JR6A 4A93I 2R93I 4LF8C 2UUCC 2BJOA 2YU9I 3GTQI 2HHHC 2DE5A 3HOWI 4DV4C 5LMNC 4KHPC 1FJGC 5IWAC 4LF9C 3I4NI 2HF1A 3RZOI 4NXNC 4LF7C 1XMQC 4DR6C 3VMGA 4NBDA 4DR4C 4JI1C 1HR0C 1HNZC 1RO4A 1IBMC 2KZFA 1J5EC 3VMHA 2J6AA 4NBCA 1DL6A 4X65C 4DV7C 3AF5A 4DR3C 4NBBA 4DUZC 1WCMI 4JI4C 2E2HI 5IT9D 4X6AI 4DCSA 4BSZA 1KKGA 2ATWA 2OPLA 4BBRI 4Y52I 2DE7A 2E2II 2UUAC 1WH9A 1PA4A 4DR5C 4MTNA 5C4XI 4XX2A 1NYEA 1N32C 1XNRC 1N2FA 4YY3C 4JI3C 1RLYA 4A3GI 1TWGI 4NB8A 1N33C 2R7ZI 4LFCC 3VMIA 4A3II 4JV5C 2UU9C 1JOSA 2D7VA 3HOUI 1I50I 3M3YI 4MH4A 4A3BI 1TWHI 4B3SC 3HOXI 3I07A 3GCFA 3LUSA 4AQYC 2AKLA 3FKII 4Y7NI 1I3QI 1L1OC 3Q87A 5LMUC 4DCTA 1USPB 3VB9A 1NUIA 4A3EI 3S2HI 4DV0C 2HJGA 5IP7I 2NVQI 4A3LI 2E2JI 2PT7G 5C44I 4BY7I 3CQZI 4LF6C 2XR1A 1X3ZA 3S2DI 3PO3S 4DUYC 2P3YA 5C3EI 1WW9A 2VUMI 2CY1A 5A2QD 3T1YC 3S14I 1SFOI 5FLXD 3M4OI 1L2FA 1ZB8A 4LFAC 2NVXI 3U50C 1EGAA 2ZM6C 4NBGA 2ONFA 3HOZI 3R9WA 4NBFA 4YHHC 4QTUA 3HOYI 1Y1WI 2E8EA 2E7GA 3GKQA
chains in the Genus database with same CATH superfamily
3VTNA 3CCMZ 2JIOA 4K0BA 1QWIA 1QF8A 5H9UA 5KYTA 2K3RA 2KZ0A 3CME1 4DG8A 4EATA 1UKKA 3AF6A 4CL1A 2VSQA 2M6NA 1Q812 1IB8A 3CC41 2NAPA 2Y27A 4LF4C 1T5HX 3S15I 2P02A 4IZ6A 1RO0A 4WS9A 3OTOC 3CMEZ 4IR7A 2NVYI 2IV2X 3L95X 5A1IA 1SIWA 4DK1A 5T8TA 3ETCA 1K731 3A9VA 1FDIA 1MDBA 5GTDA 3DHVA 2E8FA 5BURA 4RMNA 2OPLB 3FQQA 5A2Qf 2DE6A 4BY1I 3PO3I 1WJ2A 2M5OA 2E5LC 1ZH1A 2JMPA 5KYVA 3PROC 1LQLA 3IEUA 1TWFI 2CXCA 4DR2C 1YIJ1 4QTTA 2IZ3A 5FLXf 3I4MI 3TDEA 2E7ZA 3EERA 3UZ0A 2JA6I 5C4JI 3GR1A 1V26A 2OOYB 2PN2A 4DCVA 5BR8C 4JI0C 3NI2A 1YIJZ 3J81D 3D6WA 2D1TA 2YCBA 1VQK1 4B3MC 1O9TA 4MRIA 2Y4OA 2E8CA 3BG1B 2R92I 1FUGA 4NDNA 1NJI1 1ZB9A 3KIFA 3D2LA 1T5DX 1VQKZ 1Q821 2DHMA 3S16I 5CZVA 2ASBA 3F3FC 3G4S1 2QVZX 1V60A 3S1NI 3UOWA 4GS5A 1P4EC 4LF5C 4DV6C 3H3VJ 4GKKC 1K0RA 3T4NB 1MKYA 2WP0C 4E32A 3G4SZ 3GTKI 3CCRZ 2QKDA 1KC81 3T1HC 4A3DI 1XMOC 4NBEA 4GKJC 4D4GA 2VQFC 1Z03A 4BBSI 2V7BA 5K8FA 1Y1VS 4PHTA 1K83I 5FLMI 2P2BA 4DV5C 3PO2I 4D4IA 4JYAC 1Q822 4NOZA 2OOXB 4NBHA 1YHQ1 4LFBC 5IT9b 2H85A 4L2ZA 1N36C 3S1RI 2RBLA 1K8A1 1VQ4Z 4DR1C 3NH8A 2K5RA 4B3RC 3GTGI 1WCJA 4EWCA 1RG9A 1YHQZ 1KC82 1Q7Y1 3UX2A 3J81f 2QVXX 2RIQA 4NB9A 2NVTI 4X62C 3CCJ1 3HOVI 1YJ91 2E9HA 4A3MI 4TNUA 2P28A 3CC71 2E0GA 1BA3A 3DLPX 4JI6C 4A3JI 4MD9A 4JI7C 2QW0X 2GTIA 3G6E1 4U5YD 1YJ9Z 3CC7Z 3TDHB 2QA41 4RVFA 4A3KI 3NDIA 1VQLZ 3JAMD 3IR7A 4G36A 1O93A 3MONA 4JI8C 2JUBA 1PG4A 3CCE1 3IF8A 3G6EZ 2JA5I 3CCS1 1VQ61 2JA7I 2F4OA 4HGYA 1HNWC 1S72Z 4JI5C 2QA4Z 4E2YA 4RVOA 5AE1A 2OBVA 1QVGY 4NBAA 4JI2C 3GTMI 4OX9C 2JNYA 3CCSZ 4DQYB 1VQ6Z 1N34C 2M5HA 5JRHA 3IEVA 1XNQC 1PG3A 1QVGZ 1HH2P 2QL8A 4RVNA 1I6HI 5DV9A 2JA8I 5BUSA 5CM2M 3CCM1 1I94C 2AYDA 3TUFA 3SO4A 2KPIA 1Y1VI 3PBKA 1Y8CA 3G71Z 2P2QA 5BSVA 2V8JA 4PUHA 3GTLI 1UWDA 3CCUZ 1Z02A 5T6BA 3CCQZ 3CW9A 3NPDA 1IBLC 3E7WA 2D27A 4A3FI 4BCAA 3CCVZ 1KD11 4X66C 1NP6A 2YWBA 1JWHC 4DV2C 3RZDI 4B3TC 1MXAA 3I551 3CC21 4DCUA 1TWCI 5T8SA 5IP9I 2BH1X 2PK7A 1PFTA 2M48A 2OO4A 2VQEC 2UUBC 1VQMZ 3JAMf 3I55Z 3CC2Z 3H2TA 1S7MA 1QM4A 3NYQA 1TFIA 1R9TI 4BXXI 1VQPZ 5D1OB 2MM9A 1QXFA 4PZPA 3J80D 3IMLA 3S1MI 1VEHA 3QWUA 4OYCA 2F4MA 1O90A 1Q861 1N8R1 4X64C 1LCIA 2QRCB 2WD9A 4RV9A 2AYAA 4E2XA 3G7SA 4NXMC 1K732 3CQ1A 2UXDC 4GXQA 2V45A 2Y4NA 4R1LA 1WF3A 4DV3C 3VNRA 3B7WA 2MCQA 2EGTA 2VPWA 1PU1A 4PROC 1HNXC 2ZZMA 1VLAA 3K7AI 4BC9A 1YUAA 2B63I 2VZEA 3S1QI 4I9FA 1USPA 2UXCC 3CCR1 2JS4A 1MD9A 1TH5A 4BC7A 4A3CI 1QYPA 1VQN1 3GPCA 2UXBC 1YJ7A 4I9GA 3CW8X 1ML8A 3GTMS 4RVHA 3A25A 2F4VC 2RPRA 3H0GI 4R0MA 1XS3A 2DYJA 1YIT1 1VQ8Z 2YX1A 3R9XA 3TE5B 1VQNZ 1M6XA 5T64A 1TWAI 4DV1C 3GTJI 3ESWA 5AN9F 3GTPI 3CJEA 3S82A 1VQ41 3GTOI 3VNQA 3AY0A 1NJI2 5A2Qb 1YITZ 3IPLA 3J80f 3UX3A 3OW2Y 3LNOA 4D57A 1VQO1 2QRDB 2GTHA 4RVGA 1RQFA 5FLXb 2P2JA 1IBKC 2RT9A 3OW2Z 3S17I 2LEXA 4E2WA 1M1K1 2KDNA 2QVYX 3A9UA 3KXWA 1VQOZ 3GKUA 4K0KC 1VQ5Z 2QLVB 4DR7C 1X3WA 2JR6A 3MZKB 4A93I 2R93I 1P9NA 4LF8C 2UUCC 4RLFA 2BJOA 2YU9I 3F3PC 3GTQI 4MD7A 2YADA 4L7IA 2HHHC 1RO2A 2DE5A 1VQL1 5D1PA 3HOWI 4DV4C 1W2BY 5LMNC 2WB1A 3RV2A 5AE3A 4KHPC 2WAQA 3R44A 4JI1C 2DPLA 1FJGC 5IWAC 1YI21 1K8A2 3FCEA 3TQIA 1RNIA 1S721 3I4NI 1W2BZ 4LF9C 4E2ZA 1M1K2 2HF1A 1M901 3RZOI 1ULTA 4NXNC 1Q7Y2 1XRCA 4MONA 4LF7C 1YI2Z 4MXUA 1XMQC 4DR6C 3VMGA 1NY8A 4NBDA 3CPWY 4DR4C 2JIQA 2R6MA 3P5JB 2PROA 1HR0C 3G711 2Z51A 1RO4A 1HNZC 1IBMC 2KZFA 4RLQA 2CU6A 2LIYA 4ODJA 1J5EC 1FDOA 4RM3A 3VMHA 3CPWZ 2J6AA 2W04A 4NBCA 3CCLZ 3CCU1 1DL6A 4X65C 5T67A 4AYBA 4DV7C 3CCQ1 3AF5A 3I561 4DR3C 3MZLB 3L8CA 5BSTA 4NBBA 3CCV1 4DUZC 2Q51A 1M6XC 2VPXA 1AMUA 1WCMI 1MXBA 3N54B 2ZAEB 2Q4ZA 2E2HI 4JI4C 5IT9D 3J81b 4X6AI 3I56Z 3NFZA 3K6RA 1Q811 4BSZA 4DCSA 1VQM1 1GPMA 4KTVA 1XHJA 1KKGA 2ATWA 4BBYA 2OPLA 4RS4A 4BBRI 4Y52I 2DE7A 3CXCY 4ISBA 2V3VA 2E2II 3J7A4 2UUAC 2OTJZ 1QVFY 4LE5A 3CXCZ 2VPZA 4KTTA 1WH9A 1PA4A 4DR5C 1MDFA 4MTNA 3A26A 5C4XI 1QVFZ 4XX2A 4NH1C 4E30A 1NYEA 1N32C 3NH5A 2P2MA 3C5EA 2O53A 1XNRC 1X0TA 1MXCA 3IX0A 3CQ2A 1KD12 3BG0B 1N2FA 1YJW1 2P2FA 4YY3C 4G37A 4JI3C 1RLYA 4D56A 4A3GI 1KRLA 1TWGI 4NB8A 2I3CA 2OZKA 3CC4Z 1N33C 1YJWZ 2R7ZI 5LCIA 4LFCC 1KQSY 3VMIA 1YUKA 4FUTA 4A3II 3TR3A 4G1IA 4JV5C 2UU9C 5IT9f 3GR0A 1KQSZ 1O92A 1JOSA 2D7VA 1VQ81 5K85A 1Q862 1N8R2 3LGXA 4S1TA 3RG2A 2QEX1 3FCCA 2PMZA 5AE2A 2V8KA 3HOUI 1I50I 2P20A 2PM9A 1XRBA 3LNVA 1WZNA 2RHBA 3NYRA 4FTFA 2QREB 4NFRA 3M3YI 2JIMA 4MH4A 4FUQA 3I08A 2KI7B 2QEXZ 4A3BI 5BSWA 1K9M1 1TWHI 4RM2A 4B3SC 1VQ91 3JAMb 3HOXI 3N2QA 3I07A 3HKZA 3NDJA 4ZLPA 3GCFA 1VQ71 3LUSA 4AQYC 2AKLA 3FKII 4Y7NI 1VQ51 4HPVA 1VQ9Z 3CQ3A 2NCLA 4OXIA 1I3QI 1JJ2Y 1L1OC 3IFUA 1Z01A 1VQ7Z 3CD61 3Q87A 5LMUC 4DCTA 1USPB 3VB9A 5BSRA 1JJ2Z 1WIIA 1K9M2 3VNSA 3CD6Z 1NUIA 5BUQA 4A3EI 3S2HI 2W03A 1RY2A 4DV0C 2HJGA 5IP7I 4JM1A 2G2KA 3NH4A 3ETOA 2MMAB 2NVQI 4A3LI 2V8IA 2E2JI 2JIRA 5LL6f 4HH4A 3CMA1 4PUGA 3FQMA 2PT7G 4E33A 2VF1A 2QR1B 5C44I 1FLOA 3E7XA 3EQ6A 3CMAZ 4BY7I 2D1RA 3CQZI 1P7LA 4LF6C 2D28C 3KIHA 2XR1A 3CCL1 5BSMA 5IFIA 3EEDA 1X3ZA 3A4IA 2VPYA 2IZ4A 2VUGA 4RVDA 2LFUA 3S2DI 3DAYA 3PO3S 2YWCA 3LAXA 4E31A 4L4QA 5BSUA 4DGLA 3J80b 3CCJZ 4DUYC 4ZJZA 2P3YA 5C3EI 2JIPA 2OTL1 1WW9A 2VUMI 3PESA 2O4HA 2CY1A 5E7QA 1M902 4MD8A 5A2QD 3O2EA 4WV3A 3T1YC 3S14I 1V25A 4GXRA 4PUIA 4HGZA 2OTLZ 5CZXA 1YJN1 1SFOI 5FLXD 3CCEZ 3M4OI 1ZB8A 1L2FA 4TPSB 4LFAC 3UEBA 2OTJ1 1AA6A 2D1QA 2NVXI 3U50C 2HU9A 1P4EA 1EGAA 2ZZNA 2ZM6C 1YJNZ 4NBGA 2ONFA 3HOZI 5D1OA 1VQP1 5A1GA 2D1SA 5ADZA 2JNVA 4DG9A 4R1MA 3D9XA 4NBFA 3R9WA 4YHHC 4QTUA 3HOYI 1Q16A 1Y1WI 2GU2A 2JMOA 5A19A 1XRAA 2E8EA 2E7GA 2Y0SA 5KEIA 3GKQA
chains in the Genus database with same CATH topology
3VTNA 3CCMZ 4K0BA 1QWIA 1QF8A 5H9UA 5KYTA 2K3RA 3CME1 4DG8A 4EATA 1UKKA 3AF6A 4CL1A 2VSQA 2M6NA 1Q812 3CC41 2Y27A 4LF4C 1T5HX 3S15I 2P02A 4IZ6A 1RO0A 4WS9A 3OTOC 3CMEZ 4IR7A 2NVYI 3L95X 5A1IA 4DK1A 5T8TA 3ETCA 1K731 3A9VA 1MDBA 5GTDA 3DHVA 2E8FA 5BURA 4RMNA 2OPLB 3FQQA 5A2Qf 2DE6A 4BY1I 3PO3I 2E5LC 1ZH1A 2JMPA 5KYVA 3PROC 1LQLA 3IEUA 1TWFI 2CXCA 4DR2C 1YIJ1 4QTTA 2IZ3A 5FLXf 3I4MI 3TDEA 3EERA 3UZ0A 2JA6I 5C4JI 3GR1A 1V26A 2OOYB 2PN2A 4DCVA 5BR8C 4JI0C 3NI2A 1YIJZ 3J81D 3D6WA 2D1TA 2YCBA 1VQK1 4B3MC 1O9TA 4MRIA 2Y4OA 2E8CA 3BG1B 2R92I 1FUGA 4NDNA 1NJI1 1ZB9A 3KIFA 1T5DX 1VQKZ 1Q821 5CZVA 3S16I 2ASBA 3F3FC 3G4S1 2QVZX 3S1NI 3UOWA 4GS5A 4LF5C 4DV6C 3H3VJ 4GKKC 1K0RA 3T4NB 1MKYA 2WP0C 4E32A 3G4SZ 3GTKI 3CCRZ 2QKDA 1KC81 3T1HC 4A3DI 1XMOC 4NBEA 4GKJC 4D4GA 2VQFC 1Z03A 4BBSI 2V7BA 5K8FA 1Y1VS 4PHTA 1K83I 5FLMI 2P2BA 4DV5C 3PO2I 4D4IA 4JYAC 1Q822 4NOZA 2OOXB 4NBHA 1YHQ1 4LFBC 5IT9b 2H85A 4L2ZA 1N36C 3S1RI 2RBLA 1K8A1 1VQ4Z 4DR1C 3NH8A 2K5RA 4B3RC 3GTGI 4EWCA 1RG9A 1YHQZ 1KC82 1Q7Y1 3J81f 2QVXX 2RIQA 4NB9A 2NVTI 4X62C 3CCJ1 3HOVI 1YJ91 4A3MI 2E9HA 4TNUA 2P28A 3CC71 2E0GA 1BA3A 3DLPX 4JI6C 4A3JI 4MD9A 4JI7C 2QW0X 2GTIA 3G6E1 4U5YD 1YJ9Z 3CC7Z 3TDHB 2QA41 4RVFA 4A3KI 3NDIA 1VQLZ 3JAMD 4G36A 1O93A 3MONA 4JI8C 2JUBA 1PG4A 3CCE1 3IF8A 3G6EZ 2JA5I 3CCS1 1VQ61 2JA7I 2F4OA 4HGYA 1HNWC 1S72Z 4JI5C 2QA4Z 4E2YA 4RVOA 5AE1A 2OBVA 1QVGY 4NBAA 4JI2C 3GTMI 4OX9C 2JNYA 3CCSZ 4DQYB 1VQ6Z 1N34C 5JRHA 3IEVA 1XNQC 1PG3A 1QVGZ 1HH2P 2QL8A 4RVNA 1I6HI 5DV9A 2JA8I 5BUSA 5CM2M 3CCM1 1I94C 3TUFA 3SO4A 2KPIA 1Y1VI 3PBKA 3G71Z 2P2QA 5BSVA 2V8JA 3GTLI 3CCUZ 1Z02A 5T6BA 3CCQZ 3CW9A 3NPDA 1IBLC 3E7WA 2D27A 4A3FI 4BCAA 3CCVZ 1KD11 4X66C 1NP6A 2YWBA 1JWHC 4DV2C 3RZDI 4B3TC 1MXAA 3I551 3CC21 4DCUA 1TWCI 5T8SA 5IP9I 2BH1X 2PK7A 1PFTA 2M48A 2OO4A 2VQEC 2UUBC 1VQMZ 3JAMf 3I55Z 3CC2Z 3H2TA 1S7MA 1QM4A 3NYQA 1TFIA 1R9TI 4BXXI 1VQPZ 5D1OB 4PZPA 3J80D 3IMLA 3S1MI 3QWUA 4OYCA 2F4MA 1O90A 1Q861 1N8R1 4X64C 1LCIA 2QRCB 2WD9A 4RV9A 2AYAA 4E2XA 3G7SA 4NXMC 1K732 2UXDC 4GXQA 2Y4NA 4R1LA 1WF3A 4DV3C 3VNRA 3B7WA 2EGTA 1HNXC 4PROC 1VLAA 3K7AI 4BC9A 1YUAA 2B63I 2VZEA 3S1QI 4I9FA 1USPA 2UXCC 3CCR1 2JS4A 1MD9A 4BC7A 4A3CI 1QYPA 1VQN1 3GPCA 2UXBC 1YJ7A 4I9GA 3CW8X 1ML8A 3GTMS 4RVHA 2F4VC 2RPRA 3H0GI 4R0MA 2DYJA 1YIT1 1VQ8Z 3R9XA 3TE5B 1VQNZ 5T64A 1TWAI 4DV1C 3GTJI 3ESWA 5AN9F 3GTPI 3CJEA 3S82A 1VQ41 3GTOI 3VNQA 1NJI2 5A2Qb 1YITZ 3IPLA 3J80f 3OW2Y 4D57A 1VQO1 2QRDB 2GTHA 4RVGA 1RQFA 5FLXb 2P2JA 1IBKC 2RT9A 3OW2Z 3S17I 1M1K1 4E2WA 3A9UA 2QVYX 3KXWA 1VQOZ 3GKUA 4K0KC 1VQ5Z 2QLVB 4DR7C 1X3WA 2JR6A 3MZKB 4A93I 2R93I 1P9NA 4LF8C 2UUCC 4RLFA 2BJOA 2YU9I 3F3PC 3GTQI 4MD7A 2YADA 4L7IA 2HHHC 1RO2A 2DE5A 1VQL1 5D1PA 3HOWI 4DV4C 1W2BY 5LMNC 2WB1A 3RV2A 5AE3A 4KHPC 2WAQA 3R44A 2DPLA 1FJGC 5IWAC 1YI21 1K8A2 3FCEA 3TQIA 1RNIA 1S721 3I4NI 1W2BZ 4LF9C 4E2ZA 1M1K2 2HF1A 1M901 3RZOI 1ULTA 4NXNC 1Q7Y2 1XRCA 4MONA 4LF7C 1YI2Z 4MXUA 1XMQC 4DR6C 3VMGA 4NBDA 3CPWY 4DR4C 2R6MA 3P5JB 2PROA 1HR0C 3G711 1HNZC 1RO4A 1IBMC 4JI1C 2KZFA 4RLQA 2LIYA 4ODJA 1J5EC 4RM3A 3VMHA 3CPWZ 2J6AA 2W04A 4NBCA 3CCLZ 3CCU1 1DL6A 4X65C 5T67A 4AYBA 4DV7C 3CCQ1 3AF5A 3I561 4DR3C 3MZLB 3L8CA 5BSTA 4NBBA 3CCV1 4DUZC 2Q51A 1AMUA 1WCMI 1MXBA 3N54B 2ZAEB 2Q4ZA 2E2HI 4JI4C 5IT9D 3J81b 4X6AI 3I56Z 3NFZA 1Q811 4BSZA 4DCSA 1VQM1 1GPMA 4KTVA 1KKGA 2ATWA 4BBYA 2OPLA 4RS4A 4BBRI 4Y52I 2DE7A 3CXCY 4ISBA 3J7A4 2E2II 2UUAC 2OTJZ 1QVFY 4LE5A 3CXCZ 4KTTA 1WH9A 1PA4A 4DR5C 1MDFA 4MTNA 5C4XI 1QVFZ 4XX2A 4NH1C 4E30A 1NYEA 1N32C 3NH5A 2P2MA 3C5EA 2O53A 1XNRC 1X0TA 1MXCA 3IX0A 1KD12 3BG0B 1N2FA 1YJW1 2P2FA 4YY3C 4G37A 4JI3C 1RLYA 4D56A 4A3GI 1KRLA 1TWGI 4NB8A 2I3CA 2OZKA 3CC4Z 1N33C 1YJWZ 2R7ZI 4LFCC 1KQSY 3VMIA 1YUKA 4FUTA 4A3II 4G1IA 4JV5C 2UU9C 5IT9f 3GR0A 1KQSZ 1O92A 1JOSA 2D7VA 1VQ81 5K85A 1Q862 1N8R2 3LGXA 4S1TA 3RG2A 2QEX1 3FCCA 2PMZA 5AE2A 2V8KA 3HOUI 1I50I 2P20A 2PM9A 1XRBA 3LNVA 2RHBA 3NYRA 4FTFA 2QREB 4NFRA 3M3YI 4MH4A 4FUQA 3I08A 2KI7B 2QEXZ 4A3BI 5BSWA 1K9M1 1TWHI 4RM2A 4B3SC 1VQ91 3JAMb 3HOXI 3N2QA 3I07A 3HKZA 3NDJA 4ZLPA 3GCFA 1VQ71 3LUSA 4AQYC 2AKLA 3FKII 4Y7NI 1VQ51 4HPVA 1VQ9Z 4OXIA 1I3QI 1JJ2Y 1L1OC 3IFUA 1Z01A 1VQ7Z 3CD61 3Q87A 5LMUC 4DCTA 1USPB 3VB9A 5BSRA 1JJ2Z 1WIIA 1K9M2 3VNSA 3CD6Z 1NUIA 5BUQA 4A3EI 3S2HI 2W03A 1RY2A 4DV0C 2HJGA 5IP7I 4JM1A 2G2KA 3NH4A 3ETOA 2NVQI 4A3LI 2V8IA 2E2JI 5LL6f 4HH4A 3CMA1 3FQMA 2PT7G 4E33A 2VF1A 2QR1B 5C44I 3E7XA 3EQ6A 3CMAZ 4BY7I 2D1RA 3CQZI 1P7LA 4LF6C 2D28C 3KIHA 2XR1A 3CCL1 5BSMA 5IFIA 3EEDA 1X3ZA 3A4IA 3S2DI 2IZ4A 2VUGA 4RVDA 2LFUA 3DAYA 4L4QA 3PO3S 2YWCA 3LAXA 4E31A 5BSUA 4DGLA 3J80b 3CCJZ 4DUYC 4ZJZA 2P3YA 5C3EI 2OTL1 1WW9A 2VUMI 3PESA 2O4HA 2CY1A 5E7QA 1M902 4MD8A 5A2QD 4WV3A 3T1YC 3S14I 1V25A 4GXRA 4HGZA 2OTLZ 5CZXA 1YJN1 1SFOI 5FLXD 3CCEZ 3M4OI 1ZB8A 1L2FA 4TPSB 4LFAC 2OTJ1 2D1QA 2NVXI 3U50C 2HU9A 1EGAA 2ZM6C 1YJNZ 4NBGA 2ONFA 3HOZI 5D1OA 1VQP1 5A1GA 2D1SA 5ADZA 4DG9A 4R1MA 3D9XA 4NBFA 3R9WA 4YHHC 4QTUA 3HOYI 1Y1WI 2GU2A 2JMOA 5A19A 1XRAA 2E8EA 2E7GA 2Y0SA 5KEIA 3GKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWI A;  3AF6 A;  1UKK A;  4LF4 C;  3S15 I;  3OTO C;  2NVY I;  2E8F A;  2OPL B;  2DE6 A;  4BY1 I;  3PO3 I;  2E5L C;  2JMP A;  1LQL A;  3IEU A;  1TWF I;  2CXC A;  4DR2 C;  4QTT A;  3I4M I;  3EER A;  2JA6 I;  5C4J I;  2PN2 A;  4DCV A;  5BR8 C;  4JI0 C;  3J81 D;  3D6W A;  2YCB A;  4B3M C;  2E8C A;  2R92 I;  1ZB9 A;  3S16 I;  2ASB A;  3S1N I;  4LF5 C;  4DV6 C;  3H3V J;  4GKK C;  1K0R A;  1MKY A;  3GTK I;  3T1H C;  4A3D I;  1XMO C;  4NBE A;  4GKJ C;  2VQF C;  4BBS I;  1Y1V S;  1K83 I;  5FLM I;  4DV5 C;  3PO2 I;  4JYA C;  4NOZ A;  4NBH A;  4LFB C;  1N36 C;  3S1R I;  2RBL A;  4DR1 C;  2K5R A;  4B3R C;  3GTG I;  4NB9 A;  2NVT I;  4X62 C;  3HOV I;  4A3M I;  4JI6 C;  4A3J I;  4JI7 C;  4A3K I;  3JAM D;  4JI8 C;  2JA5 I;  2JA7 I;  2F4O A;  1HNW C;  4JI5 C;  4NBA A;  4JI2 C;  3GTM I;  4OX9 C;  2JNY A;  1N34 C;  3IEV A;  1XNQ C;  1HH2 P;  2QL8 A;  1I6H I;  2JA8 I;  5CM2 M;  1I94 C;  2KPI A;  1Y1V I;  3GTL I;  1IBL C;  4A3F I;  4X66 C;  4B3T C;  4DV2 C;  3RZD I;  4DCU A;  1TWC I;  5IP9 I;  2PK7 A;  1PFT A;  2UUB C;  2VQE C;  1TFI A;  1R9T I;  4BXX I;  3J80 D;  3S1M I;  2F4M A;  4X64 C;  4NXM C;  2UXD C;  4DV3 C;  1WF3 A;  2EGT A;  1HNX C;  1VLA A;  3K7A I;  1YUA A;  2B63 I;  3S1Q I;  1USP A;  2UXC C;  2JS4 A;  4A3C I;  1QYP A;  2UXB C;  1ML8 A;  3GTM S;  2F4V C;  3H0G I;  2DYJ A;  3R9X A;  1TWA I;  4DV1 C;  3GTJ I;  3ESW A;  3GTP I;  3CJE A;  3GTO I;  1IBK C;  3S17 I;  3GKU A;  4K0K C;  4DR7 C;  1X3W A;  2JR6 A;  4A93 I;  2R93 I;  4LF8 C;  2UUC C;  2BJO A;  2YU9 I;  3GTQ I;  2HHH C;  2DE5 A;  3HOW I;  4DV4 C;  5LMN C;  4KHP C;  1FJG C;  5IWA C;  4LF9 C;  3I4N I;  2HF1 A;  3RZO I;  4NXN C;  4LF7 C;  1XMQ C;  4DR6 C;  3VMG A;  4NBD A;  4DR4 C;  4JI1 C;  1HR0 C;  1HNZ C;  1RO4 A;  1IBM C;  2KZF A;  1J5E C;  3VMH A;  2J6A A;  4NBC A;  1DL6 A;  4X65 C;  4DV7 C;  3AF5 A;  4DR3 C;  4NBB A;  4DUZ C;  1WCM I;  4JI4 C;  2E2H I;  5IT9 D;  4X6A I;  4DCS A;  4BSZ A;  1KKG A;  2ATW A;  2OPL A;  4BBR I;  4Y52 I;  2DE7 A;  2E2I I;  2UUA C;  1WH9 A;  1PA4 A;  4DR5 C;  4MTN A;  5C4X I;  4XX2 A;  1NYE A;  1N32 C;  1XNR C;  1N2F A;  4YY3 C;  4JI3 C;  1RLY A;  4A3G I;  1TWG I;  4NB8 A;  1N33 C;  2R7Z I;  4LFC C;  3VMI A;  4A3I I;  4JV5 C;  2UU9 C;  1JOS A;  2D7V A;  3HOU I;  1I50 I;  3M3Y I;  4MH4 A;  4A3B I;  1TWH I;  4B3S C;  3HOX I;  3I07 A;  3GCF A;  3LUS A;  4AQY C;  2AKL A;  3FKI I;  4Y7N I;  1I3Q I;  1L1O C;  3Q87 A;  5LMU C;  4DCT A;  1USP B;  3VB9 A;  1NUI A;  4A3E I;  3S2H I;  4DV0 C;  2HJG A;  5IP7 I;  2NVQ I;  4A3L I;  2E2J I;  2PT7 G;  5C44 I;  4BY7 I;  3CQZ I;  4LF6 C;  2XR1 A;  1X3Z A;  3S2D I;  3PO3 S;  4DUY C;  2P3Y A;  5C3E I;  1WW9 A;  2VUM I;  2CY1 A;  5A2Q D;  3T1Y C;  3S14 I;  1SFO I;  5FLX D;  3M4O I;  1L2F A;  1ZB8 A;  4LFA C;  2NVX I;  3U50 C;  1EGA A;  2ZM6 C;  4NBG A;  2ONF A;  3HOZ I;  3R9W A;  4NBF A;  4YHH C;  4QTU A;  3HOY I;  1Y1W I;  2E8E A;  2E7G A;  3GKQ A; 
#chains in the Genus database with same CATH topology
 3VTN A;  3CCM Z;  2JIO A;  4K0B A;  1QWI A;  1QF8 A;  5H9U A;  5KYT A;  2K3R A;  2KZ0 A;  3CME 1;  4DG8 A;  4EAT A;  1UKK A;  3AF6 A;  4CL1 A;  2VSQ A;  2M6N A;  1Q81 2;  1IB8 A;  3CC4 1;  2NAP A;  2Y27 A;  4LF4 C;  1T5H X;  3S15 I;  2P02 A;  4IZ6 A;  1RO0 A;  4WS9 A;  3OTO C;  3CME Z;  4IR7 A;  2NVY I;  2IV2 X;  3L95 X;  5A1I A;  1SIW A;  4DK1 A;  5T8T A;  3ETC A;  1K73 1;  3A9V A;  1FDI A;  1MDB A;  5GTD A;  3DHV A;  2E8F A;  5BUR A;  4RMN A;  2OPL B;  3FQQ A;  5A2Q f;  2DE6 A;  4BY1 I;  3PO3 I;  1WJ2 A;  2M5O A;  2E5L C;  1ZH1 A;  2JMP A;  5KYV A;  3PRO C;  1LQL A;  3IEU A;  1TWF I;  2CXC A;  4DR2 C;  1YIJ 1;  4QTT A;  2IZ3 A;  5FLX f;  3I4M I;  3TDE A;  2E7Z A;  3EER A;  3UZ0 A;  2JA6 I;  5C4J I;  3GR1 A;  1V26 A;  2OOY B;  2PN2 A;  4DCV A;  5BR8 C;  4JI0 C;  3NI2 A;  1YIJ Z;  3J81 D;  3D6W A;  2D1T A;  2YCB A;  1VQK 1;  4B3M C;  1O9T A;  4MRI A;  2Y4O A;  2E8C A;  3BG1 B;  2R92 I;  1FUG A;  4NDN A;  1NJI 1;  1ZB9 A;  3KIF A;  3D2L A;  1T5D X;  1VQK Z;  1Q82 1;  2DHM A;  3S16 I;  5CZV A;  2ASB A;  3F3F C;  3G4S 1;  2QVZ X;  1V60 A;  3S1N I;  3UOW A;  4GS5 A;  1P4E C;  4LF5 C;  4DV6 C;  3H3V J;  4GKK C;  1K0R A;  3T4N B;  1MKY A;  2WP0 C;  4E32 A;  3G4S Z;  3GTK I;  3CCR Z;  2QKD A;  1KC8 1;  3T1H C;  4A3D I;  1XMO C;  4NBE A;  4GKJ C;  4D4G A;  2VQF C;  1Z03 A;  4BBS I;  2V7B A;  5K8F A;  1Y1V S;  4PHT A;  1K83 I;  5FLM I;  2P2B A;  4DV5 C;  3PO2 I;  4D4I A;  4JYA C;  1Q82 2;  4NOZ A;  2OOX B;  4NBH A;  1YHQ 1;  4LFB C;  5IT9 b;  2H85 A;  4L2Z A;  1N36 C;  3S1R I;  2RBL A;  1K8A 1;  1VQ4 Z;  4DR1 C;  3NH8 A;  2K5R A;  4B3R C;  3GTG I;  1WCJ A;  4EWC A;  1RG9 A;  1YHQ Z;  1KC8 2;  1Q7Y 1;  3UX2 A;  3J81 f;  2QVX X;  2RIQ A;  4NB9 A;  2NVT I;  4X62 C;  3CCJ 1;  3HOV I;  1YJ9 1;  2E9H A;  4A3M I;  4TNU A;  2P28 A;  3CC7 1;  2E0G A;  1BA3 A;  3DLP X;  4JI6 C;  4A3J I;  4MD9 A;  4JI7 C;  2QW0 X;  2GTI A;  3G6E 1;  4U5Y D;  1YJ9 Z;  3CC7 Z;  3TDH B;  2QA4 1;  4RVF A;  4A3K I;  3NDI A;  1VQL Z;  3JAM D;  3IR7 A;  4G36 A;  1O93 A;  3MON A;  4JI8 C;  2JUB A;  1PG4 A;  3CCE 1;  3IF8 A;  3G6E Z;  2JA5 I;  3CCS 1;  1VQ6 1;  2JA7 I;  2F4O A;  4HGY A;  1HNW C;  1S72 Z;  4JI5 C;  2QA4 Z;  4E2Y A;  4RVO A;  5AE1 A;  2OBV A;  1QVG Y;  4NBA A;  4JI2 C;  3GTM I;  4OX9 C;  2JNY A;  3CCS Z;  4DQY B;  1VQ6 Z;  1N34 C;  2M5H A;  5JRH A;  3IEV A;  1XNQ C;  1PG3 A;  1QVG Z;  1HH2 P;  2QL8 A;  4RVN A;  1I6H I;  5DV9 A;  2JA8 I;  5BUS A;  5CM2 M;  3CCM 1;  1I94 C;  2AYD A;  3TUF A;  3SO4 A;  2KPI A;  1Y1V I;  3PBK A;  1Y8C A;  3G71 Z;  2P2Q A;  5BSV A;  2V8J A;  4PUH A;  3GTL I;  1UWD A;  3CCU Z;  1Z02 A;  5T6B A;  3CCQ Z;  3CW9 A;  3NPD A;  1IBL C;  3E7W A;  2D27 A;  4A3F I;  4BCA A;  3CCV Z;  1KD1 1;  4X66 C;  1NP6 A;  2YWB A;  1JWH C;  4DV2 C;  3RZD I;  4B3T C;  1MXA A;  3I55 1;  3CC2 1;  4DCU A;  1TWC I;  5T8S A;  5IP9 I;  2BH1 X;  2PK7 A;  1PFT A;  2M48 A;  2OO4 A;  2VQE C;  2UUB C;  1VQM Z;  3JAM f;  3I55 Z;  3CC2 Z;  3H2T A;  1S7M A;  1QM4 A;  3NYQ A;  1TFI A;  1R9T I;  4BXX I;  1VQP Z;  5D1O B;  2MM9 A;  1QXF A;  4PZP A;  3J80 D;  3IML A;  3S1M I;  1VEH A;  3QWU A;  4OYC A;  2F4M A;  1O90 A;  1Q86 1;  1N8R 1;  4X64 C;  1LCI A;  2QRC B;  2WD9 A;  4RV9 A;  2AYA A;  4E2X A;  3G7S A;  4NXM C;  1K73 2;  3CQ1 A;  2UXD C;  4GXQ A;  2V45 A;  2Y4N A;  4R1L A;  1WF3 A;  4DV3 C;  3VNR A;  3B7W A;  2MCQ A;  2EGT A;  2VPW A;  1PU1 A;  4PRO C;  1HNX C;  2ZZM A;  1VLA A;  3K7A I;  4BC9 A;  1YUA A;  2B63 I;  2VZE A;  3S1Q I;  4I9F A;  1USP A;  2UXC C;  3CCR 1;  2JS4 A;  1MD9 A;  1TH5 A;  4BC7 A;  4A3C I;  1QYP A;  1VQN 1;  3GPC A;  2UXB C;  1YJ7 A;  4I9G A;  3CW8 X;  1ML8 A;  3GTM S;  4RVH A;  3A25 A;  2F4V C;  2RPR A;  3H0G I;  4R0M A;  1XS3 A;  2DYJ A;  1YIT 1;  1VQ8 Z;  2YX1 A;  3R9X A;  3TE5 B;  1VQN Z;  1M6X A;  5T64 A;  1TWA I;  4DV1 C;  3GTJ I;  3ESW A;  5AN9 F;  3GTP I;  3CJE A;  3S82 A;  1VQ4 1;  3GTO I;  3VNQ A;  3AY0 A;  1NJI 2;  5A2Q b;  1YIT Z;  3IPL A;  3J80 f;  3UX3 A;  3OW2 Y;  3LNO A;  4D57 A;  1VQO 1;  2QRD B;  2GTH A;  4RVG A;  1RQF A;  5FLX b;  2P2J A;  1IBK C;  2RT9 A;  3OW2 Z;  3S17 I;  2LEX A;  4E2W A;  1M1K 1;  2KDN A;  2QVY X;  3A9U A;  3KXW A;  1VQO Z;  3GKU A;  4K0K C;  1VQ5 Z;  2QLV B;  4DR7 C;  1X3W A;  2JR6 A;  3MZK B;  4A93 I;  2R93 I;  1P9N A;  4LF8 C;  2UUC C;  4RLF A;  2BJO A;  2YU9 I;  3F3P C;  3GTQ I;  4MD7 A;  2YAD A;  4L7I A;  2HHH C;  1RO2 A;  2DE5 A;  1VQL 1;  5D1P A;  3HOW I;  4DV4 C;  1W2B Y;  5LMN C;  2WB1 A;  3RV2 A;  5AE3 A;  4KHP C;  2WAQ A;  3R44 A;  4JI1 C;  2DPL A;  1FJG C;  5IWA C;  1YI2 1;  1K8A 2;  3FCE A;  3TQI A;  1RNI A;  1S72 1;  3I4N I;  1W2B Z;  4LF9 C;  4E2Z A;  1M1K 2;  2HF1 A;  1M90 1;  3RZO I;  1ULT A;  4NXN C;  1Q7Y 2;  1XRC A;  4MON A;  4LF7 C;  1YI2 Z;  4MXU A;  1XMQ C;  4DR6 C;  3VMG A;  1NY8 A;  4NBD A;  3CPW Y;  4DR4 C;  2JIQ A;  2R6M A;  3P5J B;  2PRO A;  1HR0 C;  3G71 1;  2Z51 A;  1RO4 A;  1HNZ C;  1IBM C;  2KZF A;  4RLQ A;  2CU6 A;  2LIY A;  4ODJ A;  1J5E C;  1FDO A;  4RM3 A;  3VMH A;  3CPW Z;  2J6A A;  2W04 A;  4NBC A;  3CCL Z;  3CCU 1;  1DL6 A;  4X65 C;  5T67 A;  4AYB A;  4DV7 C;  3CCQ 1;  3AF5 A;  3I56 1;  4DR3 C;  3MZL B;  3L8C A;  5BST A;  4NBB A;  3CCV 1;  4DUZ C;  2Q51 A;  1M6X C;  2VPX A;  1AMU A;  1WCM I;  1MXB A;  3N54 B;  2ZAE B;  2Q4Z A;  2E2H I;  4JI4 C;  5IT9 D;  3J81 b;  4X6A I;  3I56 Z;  3NFZ A;  3K6R A;  1Q81 1;  4BSZ A;  4DCS A;  1VQM 1;  1GPM A;  4KTV A;  1XHJ A;  1KKG A;  2ATW A;  4BBY A;  2OPL A;  4RS4 A;  4BBR I;  4Y52 I;  2DE7 A;  3CXC Y;  4ISB A;  2V3V A;  2E2I I;  3J7A 4;  2UUA C;  2OTJ Z;  1QVF Y;  4LE5 A;  3CXC Z;  2VPZ A;  4KTT A;  1WH9 A;  1PA4 A;  4DR5 C;  1MDF A;  4MTN A;  3A26 A;  5C4X I;  1QVF Z;  4XX2 A;  4NH1 C;  4E30 A;  1NYE A;  1N32 C;  3NH5 A;  2P2M A;  3C5E A;  2O53 A;  1XNR C;  1X0T A;  1MXC A;  3IX0 A;  3CQ2 A;  1KD1 2;  3BG0 B;  1N2F A;  1YJW 1;  2P2F A;  4YY3 C;  4G37 A;  4JI3 C;  1RLY A;  4D56 A;  4A3G I;  1KRL A;  1TWG I;  4NB8 A;  2I3C A;  2OZK A;  3CC4 Z;  1N33 C;  1YJW Z;  2R7Z I;  5LCI A;  4LFC C;  1KQS Y;  3VMI A;  1YUK A;  4FUT A;  4A3I I;  3TR3 A;  4G1I A;  4JV5 C;  2UU9 C;  5IT9 f;  3GR0 A;  1KQS Z;  1O92 A;  1JOS A;  2D7V A;  1VQ8 1;  5K85 A;  1Q86 2;  1N8R 2;  3LGX A;  4S1T A;  3RG2 A;  2QEX 1;  3FCC A;  2PMZ A;  5AE2 A;  2V8K A;  3HOU I;  1I50 I;  2P20 A;  2PM9 A;  1XRB A;  3LNV A;  1WZN A;  2RHB A;  3NYR A;  4FTF A;  2QRE B;  4NFR A;  3M3Y I;  2JIM A;  4MH4 A;  4FUQ A;  3I08 A;  2KI7 B;  2QEX Z;  4A3B I;  5BSW A;  1K9M 1;  1TWH I;  4RM2 A;  4B3S C;  1VQ9 1;  3JAM b;  3HOX I;  3N2Q A;  3I07 A;  3HKZ A;  3NDJ A;  4ZLP A;  3GCF A;  1VQ7 1;  3LUS A;  4AQY C;  2AKL A;  3FKI I;  4Y7N I;  1VQ5 1;  4HPV A;  1VQ9 Z;  3CQ3 A;  2NCL A;  4OXI A;  1I3Q I;  1JJ2 Y;  1L1O C;  3IFU A;  1Z01 A;  1VQ7 Z;  3CD6 1;  3Q87 A;  5LMU C;  4DCT A;  1USP B;  3VB9 A;  5BSR A;  1JJ2 Z;  1WII A;  1K9M 2;  3VNS A;  3CD6 Z;  1NUI A;  5BUQ A;  4A3E I;  3S2H I;  2W03 A;  1RY2 A;  4DV0 C;  2HJG A;  5IP7 I;  4JM1 A;  2G2K A;  3NH4 A;  3ETO A;  2MMA B;  2NVQ I;  4A3L I;  2V8I A;  2E2J I;  2JIR A;  5LL6 f;  4HH4 A;  3CMA 1;  4PUG A;  3FQM A;  2PT7 G;  4E33 A;  2VF1 A;  2QR1 B;  5C44 I;  1FLO A;  3E7X A;  3EQ6 A;  3CMA Z;  4BY7 I;  2D1R A;  3CQZ I;  1P7L A;  4LF6 C;  2D28 C;  3KIH A;  2XR1 A;  3CCL 1;  5BSM A;  5IFI A;  3EED A;  1X3Z A;  3A4I A;  2VPY A;  2IZ4 A;  2VUG A;  4RVD A;  2LFU A;  3S2D I;  3DAY A;  3PO3 S;  2YWC A;  3LAX A;  4E31 A;  4L4Q A;  5BSU A;  4DGL A;  3J80 b;  3CCJ Z;  4DUY C;  4ZJZ A;  2P3Y A;  5C3E I;  2JIP A;  2OTL 1;  1WW9 A;  2VUM I;  3PES A;  2O4H A;  2CY1 A;  5E7Q A;  1M90 2;  4MD8 A;  5A2Q D;  3O2E A;  4WV3 A;  3T1Y C;  3S14 I;  1V25 A;  4GXR A;  4PUI A;  4HGZ A;  2OTL Z;  5CZX A;  1YJN 1;  1SFO I;  5FLX D;  3CCE Z;  3M4O I;  1ZB8 A;  1L2F A;  4TPS B;  4LFA C;  3UEB A;  2OTJ 1;  1AA6 A;  2D1Q A;  2NVX I;  3U50 C;  2HU9 A;  1P4E A;  1EGA A;  2ZZN A;  2ZM6 C;  1YJN Z;  4NBG A;  2ONF A;  3HOZ I;  5D1O A;  1VQP 1;  5A1G A;  2D1S A;  5ADZ A;  2JNV A;  4DG9 A;  4R1M A;  3D9X A;  4NBF A;  3R9W A;  4YHH C;  4QTU A;  3HOY I;  1Q16 A;  1Y1W I;  2GU2 A;  2JMO A;  5A19 A;  1XRA A;  2E8E A;  2E7G A;  2Y0S A;  5KEI A;  3GKQ A; 
#chains in the Genus database with same CATH homology
 3VTN A;  3CCM Z;  4K0B A;  1QWI A;  1QF8 A;  5H9U A;  5KYT A;  2K3R A;  3CME 1;  4DG8 A;  4EAT A;  1UKK A;  3AF6 A;  4CL1 A;  2VSQ A;  2M6N A;  1Q81 2;  3CC4 1;  2Y27 A;  4LF4 C;  1T5H X;  3S15 I;  2P02 A;  4IZ6 A;  1RO0 A;  4WS9 A;  3OTO C;  3CME Z;  4IR7 A;  2NVY I;  3L95 X;  5A1I A;  4DK1 A;  5T8T A;  3ETC A;  1K73 1;  3A9V A;  1MDB A;  5GTD A;  3DHV A;  2E8F A;  5BUR A;  4RMN A;  2OPL B;  3FQQ A;  5A2Q f;  2DE6 A;  4BY1 I;  3PO3 I;  2E5L C;  1ZH1 A;  2JMP A;  5KYV A;  3PRO C;  1LQL A;  3IEU A;  1TWF I;  2CXC A;  4DR2 C;  1YIJ 1;  4QTT A;  2IZ3 A;  5FLX f;  3I4M I;  3TDE A;  3EER A;  3UZ0 A;  2JA6 I;  5C4J I;  3GR1 A;  1V26 A;  2OOY B;  2PN2 A;  4DCV A;  5BR8 C;  4JI0 C;  3NI2 A;  1YIJ Z;  3J81 D;  3D6W A;  2D1T A;  2YCB A;  1VQK 1;  4B3M C;  1O9T A;  4MRI A;  2Y4O A;  2E8C A;  3BG1 B;  2R92 I;  1FUG A;  4NDN A;  1NJI 1;  1ZB9 A;  3KIF A;  1T5D X;  1VQK Z;  1Q82 1;  5CZV A;  3S16 I;  2ASB A;  3F3F C;  3G4S 1;  2QVZ X;  3S1N I;  3UOW A;  4GS5 A;  4LF5 C;  4DV6 C;  3H3V J;  4GKK C;  1K0R A;  3T4N B;  1MKY A;  2WP0 C;  4E32 A;  3G4S Z;  3GTK I;  3CCR Z;  2QKD A;  1KC8 1;  3T1H C;  4A3D I;  1XMO C;  4NBE A;  4GKJ C;  4D4G A;  2VQF C;  1Z03 A;  4BBS I;  2V7B A;  5K8F A;  1Y1V S;  4PHT A;  1K83 I;  5FLM I;  2P2B A;  4DV5 C;  3PO2 I;  4D4I A;  4JYA C;  1Q82 2;  4NOZ A;  2OOX B;  4NBH A;  1YHQ 1;  4LFB C;  5IT9 b;  2H85 A;  4L2Z A;  1N36 C;  3S1R I;  2RBL A;  1K8A 1;  1VQ4 Z;  4DR1 C;  3NH8 A;  2K5R A;  4B3R C;  3GTG I;  4EWC A;  1RG9 A;  1YHQ Z;  1KC8 2;  1Q7Y 1;  3J81 f;  2QVX X;  2RIQ A;  4NB9 A;  2NVT I;  4X62 C;  3CCJ 1;  3HOV I;  1YJ9 1;  4A3M I;  2E9H A;  4TNU A;  2P28 A;  3CC7 1;  2E0G A;  1BA3 A;  3DLP X;  4JI6 C;  4A3J I;  4MD9 A;  4JI7 C;  2QW0 X;  2GTI A;  3G6E 1;  4U5Y D;  1YJ9 Z;  3CC7 Z;  3TDH B;  2QA4 1;  4RVF A;  4A3K I;  3NDI A;  1VQL Z;  3JAM D;  4G36 A;  1O93 A;  3MON A;  4JI8 C;  2JUB A;  1PG4 A;  3CCE 1;  3IF8 A;  3G6E Z;  2JA5 I;  3CCS 1;  1VQ6 1;  2JA7 I;  2F4O A;  4HGY A;  1HNW C;  1S72 Z;  4JI5 C;  2QA4 Z;  4E2Y A;  4RVO A;  5AE1 A;  2OBV A;  1QVG Y;  4NBA A;  4JI2 C;  3GTM I;  4OX9 C;  2JNY A;  3CCS Z;  4DQY B;  1VQ6 Z;  1N34 C;  5JRH A;  3IEV A;  1XNQ C;  1PG3 A;  1QVG Z;  1HH2 P;  2QL8 A;  4RVN A;  1I6H I;  5DV9 A;  2JA8 I;  5BUS A;  5CM2 M;  3CCM 1;  1I94 C;  3TUF A;  3SO4 A;  2KPI A;  1Y1V I;  3PBK A;  3G71 Z;  2P2Q A;  5BSV A;  2V8J A;  3GTL I;  3CCU Z;  1Z02 A;  5T6B A;  3CCQ Z;  3CW9 A;  3NPD A;  1IBL C;  3E7W A;  2D27 A;  4A3F I;  4BCA A;  3CCV Z;  1KD1 1;  4X66 C;  1NP6 A;  2YWB A;  1JWH C;  4DV2 C;  3RZD I;  4B3T C;  1MXA A;  3I55 1;  3CC2 1;  4DCU A;  1TWC I;  5T8S A;  5IP9 I;  2BH1 X;  2PK7 A;  1PFT A;  2M48 A;  2OO4 A;  2VQE C;  2UUB C;  1VQM Z;  3JAM f;  3I55 Z;  3CC2 Z;  3H2T A;  1S7M A;  1QM4 A;  3NYQ A;  1TFI A;  1R9T I;  4BXX I;  1VQP Z;  5D1O B;  4PZP A;  3J80 D;  3IML A;  3S1M I;  3QWU A;  4OYC A;  2F4M A;  1O90 A;  1Q86 1;  1N8R 1;  4X64 C;  1LCI A;  2QRC B;  2WD9 A;  4RV9 A;  2AYA A;  4E2X A;  3G7S A;  4NXM C;  1K73 2;  2UXD C;  4GXQ A;  2Y4N A;  4R1L A;  1WF3 A;  4DV3 C;  3VNR A;  3B7W A;  2EGT A;  1HNX C;  4PRO C;  1VLA A;  3K7A I;  4BC9 A;  1YUA A;  2B63 I;  2VZE A;  3S1Q I;  4I9F A;  1USP A;  2UXC C;  3CCR 1;  2JS4 A;  1MD9 A;  4BC7 A;  4A3C I;  1QYP A;  1VQN 1;  3GPC A;  2UXB C;  1YJ7 A;  4I9G A;  3CW8 X;  1ML8 A;  3GTM S;  4RVH A;  2F4V C;  2RPR A;  3H0G I;  4R0M A;  2DYJ A;  1YIT 1;  1VQ8 Z;  3R9X A;  3TE5 B;  1VQN Z;  5T64 A;  1TWA I;  4DV1 C;  3GTJ I;  3ESW A;  5AN9 F;  3GTP I;  3CJE A;  3S82 A;  1VQ4 1;  3GTO I;  3VNQ A;  1NJI 2;  5A2Q b;  1YIT Z;  3IPL A;  3J80 f;  3OW2 Y;  4D57 A;  1VQO 1;  2QRD B;  2GTH A;  4RVG A;  1RQF A;  5FLX b;  2P2J A;  1IBK C;  2RT9 A;  3OW2 Z;  3S17 I;  1M1K 1;  4E2W A;  3A9U A;  2QVY X;  3KXW A;  1VQO Z;  3GKU A;  4K0K C;  1VQ5 Z;  2QLV B;  4DR7 C;  1X3W A;  2JR6 A;  3MZK B;  4A93 I;  2R93 I;  1P9N A;  4LF8 C;  2UUC C;  4RLF A;  2BJO A;  2YU9 I;  3F3P C;  3GTQ I;  4MD7 A;  2YAD A;  4L7I A;  2HHH C;  1RO2 A;  2DE5 A;  1VQL 1;  5D1P A;  3HOW I;  4DV4 C;  1W2B Y;  5LMN C;  2WB1 A;  3RV2 A;  5AE3 A;  4KHP C;  2WAQ A;  3R44 A;  2DPL A;  1FJG C;  5IWA C;  1YI2 1;  1K8A 2;  3FCE A;  3TQI A;  1RNI A;  1S72 1;  3I4N I;  1W2B Z;  4LF9 C;  4E2Z A;  1M1K 2;  2HF1 A;  1M90 1;  3RZO I;  1ULT A;  4NXN C;  1Q7Y 2;  1XRC A;  4MON A;  4LF7 C;  1YI2 Z;  4MXU A;  1XMQ C;  4DR6 C;  3VMG A;  4NBD A;  3CPW Y;  4DR4 C;  2R6M A;  3P5J B;  2PRO A;  1HR0 C;  3G71 1;  1HNZ C;  1RO4 A;  1IBM C;  4JI1 C;  2KZF A;  4RLQ A;  2LIY A;  4ODJ A;  1J5E C;  4RM3 A;  3VMH A;  3CPW Z;  2J6A A;  2W04 A;  4NBC A;  3CCL Z;  3CCU 1;  1DL6 A;  4X65 C;  5T67 A;  4AYB A;  4DV7 C;  3CCQ 1;  3AF5 A;  3I56 1;  4DR3 C;  3MZL B;  3L8C A;  5BST A;  4NBB A;  3CCV 1;  4DUZ C;  2Q51 A;  1AMU A;  1WCM I;  1MXB A;  3N54 B;  2ZAE B;  2Q4Z A;  2E2H I;  4JI4 C;  5IT9 D;  3J81 b;  4X6A I;  3I56 Z;  3NFZ A;  1Q81 1;  4BSZ A;  4DCS A;  1VQM 1;  1GPM A;  4KTV A;  1KKG A;  2ATW A;  4BBY A;  2OPL A;  4RS4 A;  4BBR I;  4Y52 I;  2DE7 A;  3CXC Y;  4ISB A;  3J7A 4;  2E2I I;  2UUA C;  2OTJ Z;  1QVF Y;  4LE5 A;  3CXC Z;  4KTT A;  1WH9 A;  1PA4 A;  4DR5 C;  1MDF A;  4MTN A;  5C4X I;  1QVF Z;  4XX2 A;  4NH1 C;  4E30 A;  1NYE A;  1N32 C;  3NH5 A;  2P2M A;  3C5E A;  2O53 A;  1XNR C;  1X0T A;  1MXC A;  3IX0 A;  1KD1 2;  3BG0 B;  1N2F A;  1YJW 1;  2P2F A;  4YY3 C;  4G37 A;  4JI3 C;  1RLY A;  4D56 A;  4A3G I;  1KRL A;  1TWG I;  4NB8 A;  2I3C A;  2OZK A;  3CC4 Z;  1N33 C;  1YJW Z;  2R7Z I;  4LFC C;  1KQS Y;  3VMI A;  1YUK A;  4FUT A;  4A3I I;  4G1I A;  4JV5 C;  2UU9 C;  5IT9 f;  3GR0 A;  1KQS Z;  1O92 A;  1JOS A;  2D7V A;  1VQ8 1;  5K85 A;  1Q86 2;  1N8R 2;  3LGX A;  4S1T A;  3RG2 A;  2QEX 1;  3FCC A;  2PMZ A;  5AE2 A;  2V8K A;  3HOU I;  1I50 I;  2P20 A;  2PM9 A;  1XRB A;  3LNV A;  2RHB A;  3NYR A;  4FTF A;  2QRE B;  4NFR A;  3M3Y I;  4MH4 A;  4FUQ A;  3I08 A;  2KI7 B;  2QEX Z;  4A3B I;  5BSW A;  1K9M 1;  1TWH I;  4RM2 A;  4B3S C;  1VQ9 1;  3JAM b;  3HOX I;  3N2Q A;  3I07 A;  3HKZ A;  3NDJ A;  4ZLP A;  3GCF A;  1VQ7 1;  3LUS A;  4AQY C;  2AKL A;  3FKI I;  4Y7N I;  1VQ5 1;  4HPV A;  1VQ9 Z;  4OXI A;  1I3Q I;  1JJ2 Y;  1L1O C;  3IFU A;  1Z01 A;  1VQ7 Z;  3CD6 1;  3Q87 A;  5LMU C;  4DCT A;  1USP B;  3VB9 A;  5BSR A;  1JJ2 Z;  1WII A;  1K9M 2;  3VNS A;  3CD6 Z;  1NUI A;  5BUQ A;  4A3E I;  3S2H I;  2W03 A;  1RY2 A;  4DV0 C;  2HJG A;  5IP7 I;  4JM1 A;  2G2K A;  3NH4 A;  3ETO A;  2NVQ I;  4A3L I;  2V8I A;  2E2J I;  5LL6 f;  4HH4 A;  3CMA 1;  3FQM A;  2PT7 G;  4E33 A;  2VF1 A;  2QR1 B;  5C44 I;  3E7X A;  3EQ6 A;  3CMA Z;  4BY7 I;  2D1R A;  3CQZ I;  1P7L A;  4LF6 C;  2D28 C;  3KIH A;  2XR1 A;  3CCL 1;  5BSM A;  5IFI A;  3EED A;  1X3Z A;  3A4I A;  3S2D I;  2IZ4 A;  2VUG A;  4RVD A;  2LFU A;  3DAY A;  4L4Q A;  3PO3 S;  2YWC A;  3LAX A;  4E31 A;  5BSU A;  4DGL A;  3J80 b;  3CCJ Z;  4DUY C;  4ZJZ A;  2P3Y A;  5C3E I;  2OTL 1;  1WW9 A;  2VUM I;  3PES A;  2O4H A;  2CY1 A;  5E7Q A;  1M90 2;  4MD8 A;  5A2Q D;  4WV3 A;  3T1Y C;  3S14 I;  1V25 A;  4GXR A;  4HGZ A;  2OTL Z;  5CZX A;  1YJN 1;  1SFO I;  5FLX D;  3CCE Z;  3M4O I;  1ZB8 A;  1L2F A;  4TPS B;  4LFA C;  2OTJ 1;  2D1Q A;  2NVX I;  3U50 C;  2HU9 A;  1EGA A;  2ZM6 C;  1YJN Z;  4NBG A;  2ONF A;  3HOZ I;  5D1O A;  1VQP 1;  5A1G A;  2D1S A;  5ADZ A;  4DG9 A;  4R1M A;  3D9X A;  4NBF A;  3R9W A;  4YHH C;  4QTU A;  3HOY I;  1Y1W I;  2GU2 A;  2JMO A;  5A19 A;  1XRA A;  2E8E A;  2E7G A;  2Y0S A;  5KEI A;  3GKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...