4PUHA

Oxidized bola2 from arabidopsis thaliana
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
VTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and spectroscopic insights into BolA-glutaredoxin complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords At5g09830
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 4puhA00
2MM9A 4PUGA 3O2EA 2NCLA 2KZ0A 2DHMA 1XS3A 4PUIA 5LCIA 2MCQA 3TR3A 4PUHA 2KDNA 1V60A 2MMAB 1NY8A
chains in the Genus database with same CATH superfamily
4GKKC 5K85A 2Y4OA 4DCSA 3NI2A 4NDNA 1MD9A 1I94C 2P02A 3LGXA 1QWIA 2CXCA 3UEBA 2M5OA 2M5HA 2KDNA 5BUQA 3DLPX 1VEHA 5K8FA 5IFIA 4G1IA 3DHVA 2E8EA 4PZPA 5KEIA 4DV7C 3CQ1A 4JI0C 3RG2A 5AE1A 1XS3A 2PN2A 2P20A 4K0KC 2ZZMA 3IEVA 1V60A 1V26A 1XMQC 2DHMA 4LF5C 5DV9A 3TUFA 3EQ6A 4BC9A 4JI4C 1N32C 1FJGC 2Y4NA 4DCTA 1BA3A 2ASBA 1P4EA 3TR3A 4RVNA 1XMOC 3E7XA 1XNQC 1TH5A 1MDBA 4JI7C 1ULTA 4LFBC 4XX2A 3N2QA 4PUHA 2XR1A 1P7LA 3J81D 4MH4A 3GKUA 4NXNC 3PBKA 3L95X 5JRHA 2QVYX 4LE5A 4YHHC 1N2FA 4IR7A 1M6XC 3KXWA 1T5DX 1O92A 3CW9A 4PUGA 4RLFA 1XHJA 4GXRA 3N54B 4HPVA 3IMLA 3R9WA 4B3RC 4LF6C 4OYCA 3FCCA 4X65C 1UWDA 4K0BA 1O93A 1HH2P 5GTDA 1XRCA 1PA4A 4R0MA 5CZXA 2QW0X 2YCBA 2PT7G 4DG9A 4LF8C 1MKYA 3A4IA 2MCQA 4KHPC 1IBMC 2CU6A 3PROC 2ATWA 1XRBA 4G36A 5A1IA 1USPB 1ZB9A 2JMPA 4RMNA 2MM9A 3OTOC 4R1LA 4DCUA 5T8TA 4YY3C 4D57A 2D1TA 5H9UA 3UOWA 4DV1C 4DUYC 4LF4C 2CY1A 2UXBC 4FUTA 1WF3A 4GS5A 2F4VC 1HNZC 4DG8A 4RVOA 2DYJA 2ZM6C 2OO4A 3JAMD 5E7QA 5A1GA 1L2FA 2UXDC 3RV2A 3K6RA 4DUZC 4B3MC 3NPDA 3SO4A 2HJGA 4KTVA 3GR1A 1MXCA 1MXAA 3CW8X 2MMAB 4DV0C 4DR1C 4KTTA 4RLQA 2D28C 3A9UA 4RM2A 4DR3C 3VNQA 4ISBA 4JI2C 4GKJC 2D1QA 2EGTA 2Z51A 1IB8A 1NY8A 2NCLA 3A9VA 4BBYA 2OBVA 5AE2A 1XNRC 2D1RA 4D4GA 4DV6C 4BCAA 5A19A 4PROC 5ADZA 2QL8A 3AF5A 2E8CA 3I07A 5A2QD 1VLAA 4DR2C 5BSRA 3R9XA 4WV3A 4AQYC 3IPLA 3E7WA 4JM1A 3VNRA 3ETOA 3DAYA 3NYRA 3GR0A 2OPLA 2WD9A 2D27A 2WP0C 1T5HX 5IWAC 3I08A 4RM3A 5LMNC 1QM4A 4OXIA 2PROA 1MDFA 1MXBA 4B3TC 4LFCC 2QVZX 1LCIA 3GPCA 4OX9C 1YJ7A 5IT9D 4JI8C 4LF7C 4LFAC 2KZ0A 2UUBC 2UU9C 2QVXX 3VNSA 2DPLA 4GXQA 2P2QA 1N33C 3LUSA 3ETCA 1HR0C 4IZ6A 4DR6C 5BSMA 3LNOA 4TPSB 4NXMC 1USPA 4JI1C 4L2ZA 1EGAA 2E5LC 5T8SA 3C5EA 2VZEA 2KZFA 2V7BA 1JOSA 1P4EC 1ML8A 4X66C 4WS9A 1N34C 4BSZA 4G37A 4DV3C 2D7VA 5BR8C 2D1SA 3R44A 5BURA 4ODJA 5LMUC 4JYAC 1HNWC 1LQLA 4LF9C 4L4QA 3IEUA 4B3SC 1V25A 1KKGA 2VSQA 3PESA 4DR7C 3A26A 2VQEC 1IBKC 2AYAA 5LCIA 3G7SA 2UUAC 1RY2A 3CQ2A 2E7GA 2JNVA 3H2TA 2YX1A 1GPMA 5FLXD 5KYTA 5BSWA 5BSUA 1UKKA 1RG9A 3B7WA 2UXCC 1PU1A 3TQIA 5BSVA 2P2JA 1WCJA 2ZZNA 4FTFA 4X62C 4JV5C 1ZB8A 3LAXA 2P2BA 2BJOA 4R1MA 1WH9A 4DCVA 3UX2A 4PHTA 4JI6C 3UZ0A 3AY0A 2Y27A 5BSTA 3L8CA 2HHHC 2UUCC 3CJEA 2OPLB 4JI3C 2YWBA 1PG4A 1N36C 1O9TA 3AF6A 4DV5C 4BC7A 3J80D 4I9FA 4FUQA 4I9GA 5BUSA 4DV2C 4D4IA 1HNXC 1FLOA 4JI5C 4EATA 2E8FA 3O2EA 4MTNA 3TDEA 4NOZA 2E0GA 2BH1X 1XRAA 5CZVA 4DR4C 4X64C 4U5YD 4DR5C 1O90A 2P2MA 4PUIA 2YWCA 3T1YC 4DV4C 3EERA 4ZJZA 2VQFC 1K0RA 3S82A 3NYQA 4L7IA 3LNVA 1M6XA 3CQ3A 3FCEA 1J5EC 2ONFA 1PG3A 3A25A 3T1HC 1NYEA 1AMUA 5KYVA 1FUGA 2P2FA 5AE3A 4D56A 1IBLC 4ZLPA 3UX3A
chains in the Genus database with same CATH topology
2MM9A 4PUGA 3O2EA 2NCLA 2KZ0A 2DHMA 1XS3A 4PUIA 5LCIA 2MCQA 3TR3A 4PUHA 2KDNA 1V60A 2MMAB 1NY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MM9 A;  4PUG A;  3O2E A;  2NCL A;  2KZ0 A;  2DHM A;  1XS3 A;  4PUI A;  5LCI A;  2MCQ A;  3TR3 A;  4PUH A;  2KDN A;  1V60 A;  2MMA B;  1NY8 A; 
#chains in the Genus database with same CATH topology
 4GKK C;  5K85 A;  2Y4O A;  4DCS A;  3NI2 A;  4NDN A;  1MD9 A;  1I94 C;  2P02 A;  3LGX A;  1QWI A;  2CXC A;  3UEB A;  2M5O A;  2M5H A;  2KDN A;  5BUQ A;  3DLP X;  1VEH A;  5K8F A;  5IFI A;  4G1I A;  3DHV A;  2E8E A;  4PZP A;  5KEI A;  4DV7 C;  3CQ1 A;  4JI0 C;  3RG2 A;  5AE1 A;  1XS3 A;  2PN2 A;  2P20 A;  4K0K C;  2ZZM A;  3IEV A;  1V60 A;  1V26 A;  1XMQ C;  2DHM A;  4LF5 C;  5DV9 A;  3TUF A;  3EQ6 A;  4BC9 A;  4JI4 C;  1N32 C;  1FJG C;  2Y4N A;  4DCT A;  1BA3 A;  2ASB A;  1P4E A;  3TR3 A;  4RVN A;  1XMO C;  3E7X A;  1XNQ C;  1TH5 A;  1MDB A;  4JI7 C;  1ULT A;  4LFB C;  4XX2 A;  3N2Q A;  4PUH A;  2XR1 A;  1P7L A;  3J81 D;  4MH4 A;  3GKU A;  4NXN C;  3PBK A;  3L95 X;  5JRH A;  2QVY X;  4LE5 A;  4YHH C;  1N2F A;  4IR7 A;  1M6X C;  3KXW A;  1T5D X;  1O92 A;  3CW9 A;  4PUG A;  4RLF A;  1XHJ A;  4GXR A;  3N54 B;  4HPV A;  3IML A;  3R9W A;  4B3R C;  4LF6 C;  4OYC A;  3FCC A;  4X65 C;  1UWD A;  4K0B A;  1O93 A;  1HH2 P;  5GTD A;  1XRC A;  1PA4 A;  4R0M A;  5CZX A;  2QW0 X;  2YCB A;  2PT7 G;  4DG9 A;  4LF8 C;  1MKY A;  3A4I A;  2MCQ A;  4KHP C;  1IBM C;  2CU6 A;  3PRO C;  2ATW A;  1XRB A;  4G36 A;  5A1I A;  1USP B;  1ZB9 A;  2JMP A;  4RMN A;  2MM9 A;  3OTO C;  4R1L A;  4DCU A;  5T8T A;  4YY3 C;  4D57 A;  2D1T A;  5H9U A;  3UOW A;  4DV1 C;  4DUY C;  4LF4 C;  2CY1 A;  2UXB C;  4FUT A;  1WF3 A;  4GS5 A;  2F4V C;  1HNZ C;  4DG8 A;  4RVO A;  2DYJ A;  2ZM6 C;  2OO4 A;  3JAM D;  5E7Q A;  5A1G A;  1L2F A;  2UXD C;  3RV2 A;  3K6R A;  4DUZ C;  4B3M C;  3NPD A;  3SO4 A;  2HJG A;  4KTV A;  3GR1 A;  1MXC A;  1MXA A;  3CW8 X;  2MMA B;  4DV0 C;  4DR1 C;  4KTT A;  4RLQ A;  2D28 C;  3A9U A;  4RM2 A;  4DR3 C;  3VNQ A;  4ISB A;  4JI2 C;  4GKJ C;  2D1Q A;  2EGT A;  2Z51 A;  1IB8 A;  1NY8 A;  2NCL A;  3A9V A;  4BBY A;  2OBV A;  5AE2 A;  1XNR C;  2D1R A;  4D4G A;  4DV6 C;  4BCA A;  5A19 A;  4PRO C;  5ADZ A;  2QL8 A;  3AF5 A;  2E8C A;  3I07 A;  5A2Q D;  1VLA A;  4DR2 C;  5BSR A;  3R9X A;  4WV3 A;  4AQY C;  3IPL A;  3E7W A;  4JM1 A;  3VNR A;  3ETO A;  3DAY A;  3NYR A;  3GR0 A;  2OPL A;  2WD9 A;  2D27 A;  2WP0 C;  1T5H X;  5IWA C;  3I08 A;  4RM3 A;  5LMN C;  1QM4 A;  4OXI A;  2PRO A;  1MDF A;  1MXB A;  4B3T C;  4LFC C;  2QVZ X;  1LCI A;  3GPC A;  4OX9 C;  1YJ7 A;  5IT9 D;  4JI8 C;  4LF7 C;  4LFA C;  2KZ0 A;  2UUB C;  2UU9 C;  2QVX X;  3VNS A;  2DPL A;  4GXQ A;  2P2Q A;  1N33 C;  3LUS A;  3ETC A;  1HR0 C;  4IZ6 A;  4DR6 C;  5BSM A;  3LNO A;  4TPS B;  4NXM C;  1USP A;  4JI1 C;  4L2Z A;  1EGA A;  2E5L C;  5T8S A;  3C5E A;  2VZE A;  2KZF A;  2V7B A;  1JOS A;  1P4E C;  1ML8 A;  4X66 C;  4WS9 A;  1N34 C;  4BSZ A;  4G37 A;  4DV3 C;  2D7V A;  5BR8 C;  2D1S A;  3R44 A;  5BUR A;  4ODJ A;  5LMU C;  4JYA C;  1HNW C;  1LQL A;  4LF9 C;  4L4Q A;  3IEU A;  4B3S C;  1V25 A;  1KKG A;  2VSQ A;  3PES A;  4DR7 C;  3A26 A;  2VQE C;  1IBK C;  2AYA A;  5LCI A;  3G7S A;  2UUA C;  1RY2 A;  3CQ2 A;  2E7G A;  2JNV A;  3H2T A;  2YX1 A;  1GPM A;  5FLX D;  5KYT A;  5BSW A;  5BSU A;  1UKK A;  1RG9 A;  3B7W A;  2UXC C;  1PU1 A;  3TQI A;  5BSV A;  2P2J A;  1WCJ A;  2ZZN A;  4FTF A;  4X62 C;  4JV5 C;  1ZB8 A;  3LAX A;  2P2B A;  2BJO A;  4R1M A;  1WH9 A;  4DCV A;  3UX2 A;  4PHT A;  4JI6 C;  3UZ0 A;  3AY0 A;  2Y27 A;  5BST A;  3L8C A;  2HHH C;  2UUC C;  3CJE A;  2OPL B;  4JI3 C;  2YWB A;  1PG4 A;  1N36 C;  1O9T A;  3AF6 A;  4DV5 C;  4BC7 A;  3J80 D;  4I9F A;  4FUQ A;  4I9G A;  5BUS A;  4DV2 C;  4D4I A;  1HNX C;  1FLO A;  4JI5 C;  4EAT A;  2E8F A;  3O2E A;  4MTN A;  3TDE A;  4NOZ A;  2E0G A;  2BH1 X;  1XRA A;  5CZV A;  4DR4 C;  4X64 C;  4U5Y D;  4DR5 C;  1O90 A;  2P2M A;  4PUI A;  2YWC A;  3T1Y C;  4DV4 C;  3EER A;  4ZJZ A;  2VQF C;  1K0R A;  3S82 A;  3NYQ A;  4L7I A;  3LNV A;  1M6X A;  3CQ3 A;  3FCE A;  1J5E C;  2ONF A;  1PG3 A;  3A25 A;  3T1H C;  1NYE A;  1AMU A;  5KYV A;  1FUG A;  2P2F A;  5AE3 A;  4D56 A;  1IBL C;  4ZLP A;  3UX3 A; 
#chains in the Genus database with same CATH homology
 2MM9 A;  4PUG A;  3O2E A;  2NCL A;  2KZ0 A;  2DHM A;  1XS3 A;  4PUI A;  5LCI A;  2MCQ A;  3TR3 A;  4PUH A;  2KDN A;  1V60 A;  2MMA B;  1NY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...