4PUHA

Oxidized bola2 from arabidopsis thaliana
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
81
structure length
81
Chain Sequence
VTKEQVEASLTSKLKPIHLEVIDISGGCGSSFEVEVVSEQFEGKRLLERHRMVNAALEEEMKEIHALSIKKAQTPQQWKPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords At5g09830
publication title Structural and spectroscopic insights into BolA-glutaredoxin complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 25
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 4puhA00
3O2EA 1XS3A 1V60A 1NY8A 4PUIA 2MCQA 4PUHA 2NCLA 2DHMA 5LCIA 2KZ0A 3TR3A 2MMAB 4PUGA 2MM9A 2KDNA
chains in the Genus database with same CATH superfamily
2UXCC 5BR8C 3GR0A 3NYRA 1O90A 3IEUA 1QWIA 1MXBA 1PA4A 4L4QA 4DV6C 4R0MA 4RVOA 3UOWA 4PUGA 3A4IA 1V60A 1L2FA 2D1SA 4LF8C 3A26A 1RY2A 3EERA 4GKJC 5BSRA 3N54B 4DUZC 1WF3A 2WD9A 1TH5A 3FCEA 1N34C 3E7WA 2E7GA 1T5HX 5GTDA 2OBVA 4U5YD 4DR5C 4DV0C 3IMLA 3DHVA 5LMUC 5BURA 1MXCA 2E8CA 4IZ6A 1JOSA 4GXQA 4LFAC 2D28C 1IBKC 4TPSB 4BBYA 1I94C 1MD9A 4K0KC 4JV5C 3LAXA 2UUBC 1LQLA 3AY0A 3DAYA 2KDNA 1T5DX 4NDNA 1USPA 1ZB8A 2VQEC 3SO4A 5KEIA 1FLOA 1XMOC 2UXBC 4KTTA 2D1RA 2BH1X 3CJEA 1NYEA 4DV2C 4LF5C 1MDBA 1UKKA 5BSMA 4RM2A 1PG4A 4GXRA 4B3MC 1PU1A 4B3RC 4ODJA 1QM4A 3GR1A 2VZEA 1V26A 2Y27A 5A1GA 3EQ6A 2D1TA 2HJGA 1KKGA 4G36A 2AYAA 3VNSA 1HNWC 3ETCA 3K6RA 1WCJA 3R44A 5KYVA 3IEVA 4BC7A 1HH2P 4DV1C 1VLAA 3A9UA 3L8CA 1IBLC 2ONFA 1FUGA 1EGAA 4JI4C 1HNXC 5CZVA 4LE5A 4DUYC 5DV9A 1MKYA 1HR0C 3LUSA 1YJ7A 1GPMA 1XNQC 4ISBA 1O92A 3GPCA 4LF9C 4RLFA 1BA3A 2DPLA 4WS9A 4XX2A 4DV5C 2OPLA 2CXCA 2QVXX 3UZ0A 2OPLB 5FLXD 2NCLA 2JNVA 2VQFC 4BSZA 2KZFA 2P20A 2OO4A 2ZZMA 3PESA 1XRBA 4NXNC 1HNZC 4DG9A 4LFCC 2ASBA 4PZPA 2E0GA 4JYAC 1O93A 3PBKA 1FJGC 3J81D 2MMAB 4WV3A 3A25A 1NY8A 4ZJZA 3H2TA 4DR1C 4OX9C 2PROA 1ML8A 2P2QA 5BUQA 2P2JA 3PROC 1XS3A 5IWAC 5BUSA 3TR3A 4DR4C 1J5EC 3T1HC 2ATWA 3FCCA 2KZ0A 4DV3C 4NOZA 3VNRA 4D56A 4JI8C 3L95X 2DHMA 1WH9A 4JM1A 4DCUA 3CW9A 3O2EA 5E7QA 4JI1C 1N32C 4KTVA 3NYQA 5CZXA 3J80D 4DV4C 2UU9C 3E7XA 4DR2C 4GKKC 5K85A 4DCTA 1P4EA 5A19A 4MH4A 2ZM6C 4MTNA 2D7VA 4HPVA 1MXAA 3UEBA 5AE1A 2UUCC 4YY3C 2XR1A 4X64C 1N36C 2BJOA 3NPDA 4X62C 4GS5A 4IR7A 4L7IA 2Z51A 3R9XA 4L2ZA 2P02A 4BC9A 3JAMD 3CQ2A 4LF7C 3I07A 4PROC 5K8FA 2YX1A 1LCIA 2VSQA 4YHHC 3T1YC 1RG9A 3I08A 2M5HA 4PUHA 1V25A 3LNOA 3AF6A 4I9FA 3NI2A 1MDFA 1UWDA 4R1MA 4FUQA 5LCIA 2ZZNA 5A1IA 4JI6C 1PG3A 5ADZA 5AE3A 3UX2A 3N2QA 4G1IA 2HHHC 3ETOA 3RV2A 3TUFA 2V7BA 4RVNA 5BSUA 2E8EA 2D1QA 4B3SC 2P2BA 4KHPC 2PN2A 5JRHA 2Y4OA 3AF5A 1P4EC 2F4VC 2E8FA 3C5EA 1M6XA 4FUTA 3R9WA 3LNVA 2QVZX 4D4GA 5H9UA 1K0RA 1IBMC 4DR3C 1XMQC 1XNRC 2EGTA 4RM3A 3G7SA 1ZB9A 4X66C 4BCAA 4DCSA 4EATA 3VNQA 4X65C 3GKUA 4NXMC 5T8TA 4RMNA 1IB8A 4JI0C 2YCBA 4PHTA 3KXWA 5KYTA 1N33C 3CQ1A 1ULTA 1N2FA 4D4IA 1USPB 4OXIA 4LF6C 4JI7C 3RG2A 4LFBC 4DR6C 5IFIA 4DCVA 5A2QD 3UX3A 2UUAC 5AE2A 1XRCA 4OYCA 3OTOC 2MM9A 4RLQA 2MCQA 4ZLPA 2UXDC 2E5LC 2CY1A 2JMPA 2WP0C 4B3TC 2PT7G 5BSVA 2M5OA 3A9VA 4DV7C 2YWBA 4K0BA 1VEHA 3B7WA 4I9GA 3S82A 5T8SA 2DYJA 3CW8X 2QL8A 1M6XC 4JI5C 1O9TA 1XHJA 4LF4C 3TQIA 2YWCA 4JI2C 2P2MA 4JI3C 2P2FA 5LMNC 5IT9D 5BSTA 4FTFA 1XRAA 4D57A 1P7LA 3CQ3A 4PUIA 2CU6A 4DR7C 2QW0X 3DLPX 5BSWA 4R1LA 3TDEA 4DG8A 1AMUA 4G37A 4AQYC 2QVYX 3IPLA 2D27A 2Y4NA 3LGXA
chains in the Genus database with same CATH topology
3O2EA 1XS3A 1V60A 1NY8A 4PUIA 2MCQA 4PUHA 2NCLA 2DHMA 5LCIA 2KZ0A 3TR3A 2MMAB 4PUGA 2MM9A 2KDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2E A;  1XS3 A;  1V60 A;  1NY8 A;  4PUI A;  2MCQ A;  4PUH A;  2NCL A;  2DHM A;  5LCI A;  2KZ0 A;  3TR3 A;  2MMA B;  4PUG A;  2MM9 A;  2KDN A; 
#chains in the Genus database with same CATH topology
 2UXC C;  5BR8 C;  3GR0 A;  3NYR A;  1O90 A;  3IEU A;  1QWI A;  1MXB A;  1PA4 A;  4L4Q A;  4DV6 C;  4R0M A;  4RVO A;  3UOW A;  4PUG A;  3A4I A;  1V60 A;  1L2F A;  2D1S A;  4LF8 C;  3A26 A;  1RY2 A;  3EER A;  4GKJ C;  5BSR A;  3N54 B;  4DUZ C;  1WF3 A;  2WD9 A;  1TH5 A;  3FCE A;  1N34 C;  3E7W A;  2E7G A;  1T5H X;  5GTD A;  2OBV A;  4U5Y D;  4DR5 C;  4DV0 C;  3IML A;  3DHV A;  5LMU C;  5BUR A;  1MXC A;  2E8C A;  4IZ6 A;  1JOS A;  4GXQ A;  4LFA C;  2D28 C;  1IBK C;  4TPS B;  4BBY A;  1I94 C;  1MD9 A;  4K0K C;  4JV5 C;  3LAX A;  2UUB C;  1LQL A;  3AY0 A;  3DAY A;  2KDN A;  1T5D X;  4NDN A;  1USP A;  1ZB8 A;  2VQE C;  3SO4 A;  5KEI A;  1FLO A;  1XMO C;  2UXB C;  4KTT A;  2D1R A;  2BH1 X;  3CJE A;  1NYE A;  4DV2 C;  4LF5 C;  1MDB A;  1UKK A;  5BSM A;  4RM2 A;  1PG4 A;  4GXR A;  4B3M C;  1PU1 A;  4B3R C;  4ODJ A;  1QM4 A;  3GR1 A;  2VZE A;  1V26 A;  2Y27 A;  5A1G A;  3EQ6 A;  2D1T A;  2HJG A;  1KKG A;  4G36 A;  2AYA A;  3VNS A;  1HNW C;  3ETC A;  3K6R A;  1WCJ A;  3R44 A;  5KYV A;  3IEV A;  4BC7 A;  1HH2 P;  4DV1 C;  1VLA A;  3A9U A;  3L8C A;  1IBL C;  2ONF A;  1FUG A;  1EGA A;  4JI4 C;  1HNX C;  5CZV A;  4LE5 A;  4DUY C;  5DV9 A;  1MKY A;  1HR0 C;  3LUS A;  1YJ7 A;  1GPM A;  1XNQ C;  4ISB A;  1O92 A;  3GPC A;  4LF9 C;  4RLF A;  1BA3 A;  2DPL A;  4WS9 A;  4XX2 A;  4DV5 C;  2OPL A;  2CXC A;  2QVX X;  3UZ0 A;  2OPL B;  5FLX D;  2NCL A;  2JNV A;  2VQF C;  4BSZ A;  2KZF A;  2P20 A;  2OO4 A;  2ZZM A;  3PES A;  1XRB A;  4NXN C;  1HNZ C;  4DG9 A;  4LFC C;  2ASB A;  4PZP A;  2E0G A;  4JYA C;  1O93 A;  3PBK A;  1FJG C;  3J81 D;  2MMA B;  4WV3 A;  3A25 A;  1NY8 A;  4ZJZ A;  3H2T A;  4DR1 C;  4OX9 C;  2PRO A;  1ML8 A;  2P2Q A;  5BUQ A;  2P2J A;  3PRO C;  1XS3 A;  5IWA C;  5BUS A;  3TR3 A;  4DR4 C;  1J5E C;  3T1H C;  2ATW A;  3FCC A;  2KZ0 A;  4DV3 C;  4NOZ A;  3VNR A;  4D56 A;  4JI8 C;  3L95 X;  2DHM A;  1WH9 A;  4JM1 A;  4DCU A;  3CW9 A;  3O2E A;  5E7Q A;  4JI1 C;  1N32 C;  4KTV A;  3NYQ A;  5CZX A;  3J80 D;  4DV4 C;  2UU9 C;  3E7X A;  4DR2 C;  4GKK C;  5K85 A;  4DCT A;  1P4E A;  5A19 A;  4MH4 A;  2ZM6 C;  4MTN A;  2D7V A;  4HPV A;  1MXA A;  3UEB A;  5AE1 A;  2UUC C;  4YY3 C;  2XR1 A;  4X64 C;  1N36 C;  2BJO A;  3NPD A;  4X62 C;  4GS5 A;  4IR7 A;  4L7I A;  2Z51 A;  3R9X A;  4L2Z A;  2P02 A;  4BC9 A;  3JAM D;  3CQ2 A;  4LF7 C;  3I07 A;  4PRO C;  5K8F A;  2YX1 A;  1LCI A;  2VSQ A;  4YHH C;  3T1Y C;  1RG9 A;  3I08 A;  2M5H A;  4PUH A;  1V25 A;  3LNO A;  3AF6 A;  4I9F A;  3NI2 A;  1MDF A;  1UWD A;  4R1M A;  4FUQ A;  5LCI A;  2ZZN A;  5A1I A;  4JI6 C;  1PG3 A;  5ADZ A;  5AE3 A;  3UX2 A;  3N2Q A;  4G1I A;  2HHH C;  3ETO A;  3RV2 A;  3TUF A;  2V7B A;  4RVN A;  5BSU A;  2E8E A;  2D1Q A;  4B3S C;  2P2B A;  4KHP C;  2PN2 A;  5JRH A;  2Y4O A;  3AF5 A;  1P4E C;  2F4V C;  2E8F A;  3C5E A;  1M6X A;  4FUT A;  3R9W A;  3LNV A;  2QVZ X;  4D4G A;  5H9U A;  1K0R A;  1IBM C;  4DR3 C;  1XMQ C;  1XNR C;  2EGT A;  4RM3 A;  3G7S A;  1ZB9 A;  4X66 C;  4BCA A;  4DCS A;  4EAT A;  3VNQ A;  4X65 C;  3GKU A;  4NXM C;  5T8T A;  4RMN A;  1IB8 A;  4JI0 C;  2YCB A;  4PHT A;  3KXW A;  5KYT A;  1N33 C;  3CQ1 A;  1ULT A;  1N2F A;  4D4I A;  1USP B;  4OXI A;  4LF6 C;  4JI7 C;  3RG2 A;  4LFB C;  4DR6 C;  5IFI A;  4DCV A;  5A2Q D;  3UX3 A;  2UUA C;  5AE2 A;  1XRC A;  4OYC A;  3OTO C;  2MM9 A;  4RLQ A;  2MCQ A;  4ZLP A;  2UXD C;  2E5L C;  2CY1 A;  2JMP A;  2WP0 C;  4B3T C;  2PT7 G;  5BSV A;  2M5O A;  3A9V A;  4DV7 C;  2YWB A;  4K0B A;  1VEH A;  3B7W A;  4I9G A;  3S82 A;  5T8S A;  2DYJ A;  3CW8 X;  2QL8 A;  1M6X C;  4JI5 C;  1O9T A;  1XHJ A;  4LF4 C;  3TQI A;  2YWC A;  4JI2 C;  2P2M A;  4JI3 C;  2P2F A;  5LMN C;  5IT9 D;  5BST A;  4FTF A;  1XRA A;  4D57 A;  1P7L A;  3CQ3 A;  4PUI A;  2CU6 A;  4DR7 C;  2QW0 X;  3DLP X;  5BSW A;  4R1L A;  3TDE A;  4DG8 A;  1AMU A;  4G37 A;  4AQY C;  2QVY X;  3IPL A;  2D27 A;  2Y4N A;  3LGX A; 
#chains in the Genus database with same CATH homology
 3O2E A;  1XS3 A;  1V60 A;  1NY8 A;  4PUI A;  2MCQ A;  4PUH A;  2NCL A;  2DHM A;  5LCI A;  2KZ0 A;  3TR3 A;  2MMA B;  4PUG A;  2MM9 A;  2KDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...