1MXAA

S-adenosylmethionine synthetase with ppi
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
molecule tags Transferase
total genus 124
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA01
5A1GA 5T8TA 2P02A 4KTTA 1MXBA 1O90A 1XRBA 3UOWA 1MXCA 1XRAA 1O92A 4HPVA 3IMLA 2YWBA 4L7IA 3TDEA 5A19A 3SO4A 1XRCA 3RV2A 2OBVA 1GPMA 1FUGA 1O9TA 4L2ZA 2DPLA 4KTVA 4L4QA 3A4IA 4K0BA 3TQIA 1RG9A 5T8SA 1QM4A 2YWCA 5H9UA 3S82A 4ODJA 4WS9A 1P7LA 5A1IA 4NDNA 1MXAA 4LE5A 1O93A
chains in the Genus database with same CATH superfamily
5AE1A 1P4EC 4XX2A 5LMNC 4DG8A 4PROC 4JI6C 1N32C 4DR6C 4RVNA 4LF7C 1L2FA 5BUSA 2D27A 4BSZA 2OBVA 2VQFC 2UUBC 4RVOA 2JMPA 2DPLA 3B7WA 4FTFA 1WH9A 4KHPC 2VQEC 4GXQA 5K85A 2PN2A 4DV2C 2M5HA 1PA4A 4NDNA 2E7GA 3DAYA 1FLOA 4ZJZA 4DCTA 3ETCA 2MM9A 3IMLA 4BBYA 3CQ2A 2MCQA 4FUQA 2Z51A 4DG9A 4D4IA 1QM4A 2DHMA 3TR3A 4ODJA 2P2JA 3UX3A 4FUTA 3NYRA 3DLPX 3UOWA 4PUHA 1MDBA 1MDFA 1MKYA 1P4EA 5IT9D 5A19A 3NPDA 2UUAC 3UX2A 1XS3A 4D57A 1IBLC 4B3MC 5ADZA 2YX1A 4L2ZA 1N34C 3T1HC 3L95X 2F4VC 1KKGA 4LF5C 1T5HX 1XNRC 5A2QD 3A9VA 4LE5A 4D4GA 5AE3A 1AMUA 4LFCC 4LF6C 1XMQC 2QVZX 2QW0X 5BSRA 4DR5C 3CQ3A 2E8EA 2KZFA 3I08A 2ATWA 5LCIA 4K0KC 4DR7C 1ZB9A 1QWIA 3TQIA 3AF6A 3VNSA 2ASBA 4RLQA 4DR4C 1V25A 4DV3C 1PG3A 3CQ1A 2HJGA 4X66C 2PT7G 2UXDC 2KZ0A 4OYCA 1FJGC 4D56A 1XRCA 2ZM6C 1PU1A 2DYJA 1FUGA 2D7VA 4OX9C 5JRHA 4JI3C 2MMAB 2E8FA 3LNOA 5BSWA 1I94C 4I9GA 1HNWC 3ETOA 2D1QA 1MXBA 1MXCA 1XHJA 3OTOC 3LNVA 2YWBA 5KEIA 1UWDA 2HHHC 1VLAA 3LGXA 1ULTA 3AY0A 1V26A 3CJEA 1M6XC 1RG9A 2EGTA 1UKKA 1RY2A 4DR3C 5KYTA 4IR7A 4X64C 4GKKC 5A1GA 1EGAA 1O90A 3PBKA 2P2FA 3PESA 3L8CA 1LQLA 1JOSA 3LUSA 2AYAA 3VNQA 1GPMA 2ZZMA 3IEUA 3FCCA 4R0MA 1T5DX 4I9FA 5AE2A 1HH2P 4RM2A 1YJ7A 3EQ6A 1BA3A 3J81D 2CU6A 3N2QA 2P2BA 3UEBA 2Y4OA 4G37A 5BSMA 3RV2A 1IBKC 3PROC 4KTVA 4JI8C 5GTDA 1P7LA 1M6XA 2OPLA 3KXWA 4GS5A 1TH5A 5T8TA 5CZXA 4ZLPA 2UXBC 1V60A 4PZPA 3A25A 4JI1C 4DCUA 4YY3C 2Y4NA 4NOZA 4B3SC 3K6RA 4IZ6A 4BC9A 3JAMD 4AQYC 1O9TA 3NYQA 4LF8C 3A4IA 2BH1X 4NXNC 3G7SA 4DV4C 5A1IA 2XR1A 1N33C 2P20A 1XMOC 4DCSA 2QVXX 3FCEA 4MH4A 4PUGA 1MD9A 3A9UA 4TPSB 1USPA 2UU9C 2WP0C 3TDEA 2M5OA 2UXCC 4RLFA 2BJOA 1IB8A 4PUIA 1HR0C 2YWCA 4WV3A 4WS9A 2P2QA 4DUZC 1MXAA 3R9XA 4RMNA 2P02A 2CY1A 5BSUA 1O92A 3E7WA 4RM3A 4EATA 2UUCC 2QVYX 4ISBA 1ZB8A 2D28C 3H2TA 5IFIA 1NY8A 4JI4C 2E5LC 3S82A 3LAXA 2ONFA 5K8FA 5E7QA 1XRBA 1K0RA 3E7XA 2E0GA 4LF9C 1WCJA 4JYAC 4BC7A 3NI2A 3VNRA 5LMUC 1HNZC 3R9WA 3J80D 1IBMC 4DV5C 4JI5C 5H9UA 1LCIA 5CZVA 2PROA 2OO4A 3GR1A 5BSVA 3A26A 3N54B 4DR1C 4OXIA 2P2MA 4DUYC 3EERA 3IEVA 2E8CA 2JNVA 3I07A 3O2EA 3C5EA 4X62C 3SO4A 1N2FA 2VZEA 3TUFA 3T1YC 3CW9A 4L4QA 4NXMC 4DV0C 4LF4C 2KDNA 2WD9A 2QL8A 5FLXD 5KYVA 1XNQC 3DHVA 1WF3A 1XRAA 4JI7C 5DV9A 4DCVA 4BCAA 3GR0A 2YCBA 2Y27A 4JV5C 2OPLB 4K0BA 5T8SA 4PHTA 3GKUA 4JM1A 4GXRA 3UZ0A 4DV6C 4MTNA 4KTTA 4LFBC 4DV1C 4HPVA 4L7IA 4B3TC 1PG4A 4G36A 4R1MA 4R1LA 4X65C 1HNXC 2D1SA 4B3RC 3AF5A 4G1IA 5BURA 3RG2A 3CW8X 3IPLA 4DV7C 1ML8A 4JI0C 1N36C 2D1RA 2VSQA 4YHHC 1USPB 4LFAC 1O93A 2CXCA 5BSTA 1VEHA 2D1TA 4GKJC 1J5EC 5BR8C 4JI2C 5IWAC 5BUQA 2ZZNA 4U5YD 2NCLA 3GPCA 1NYEA 3R44A 4DR2C 2V7BA
chains in the Genus database with same CATH topology
5AE1A 4XX2A 5LMNC 4DG8A 4PROC 4JI6C 1N32C 4DR6C 4RVNA 4LF7C 1L2FA 5BUSA 2D27A 4BSZA 2OBVA 2VQFC 2UUBC 4RVOA 2JMPA 2DPLA 3B7WA 4FTFA 1WH9A 4KHPC 2VQEC 4GXQA 5K85A 2PN2A 4DV2C 1PA4A 4NDNA 2E7GA 3DAYA 4ZJZA 4DCTA 3ETCA 3IMLA 4BBYA 4FUQA 4DG9A 4D4IA 1QM4A 4ODJA 2P2JA 4FUTA 3NYRA 3DLPX 3UOWA 1MDBA 1MDFA 1MKYA 5IT9D 5A19A 3NPDA 2UUAC 4D57A 1IBLC 4B3MC 5ADZA 4L2ZA 1N34C 3T1HC 3L95X 2F4VC 1KKGA 4LF5C 1T5HX 1XNRC 5A2QD 3A9VA 4LE5A 4D4GA 5AE3A 1AMUA 4LFCC 4LF6C 1XMQC 2QVZX 2QW0X 5BSRA 4DR5C 2E8EA 2KZFA 3I08A 2ATWA 4K0KC 4DR7C 1ZB9A 1QWIA 3TQIA 3AF6A 3VNSA 2ASBA 4RLQA 4DR4C 1V25A 4DV3C 1PG3A 2HJGA 4X66C 2PT7G 2UXDC 4OYCA 1FJGC 4D56A 1XRCA 2ZM6C 2DYJA 1FUGA 2D7VA 4OX9C 5JRHA 4JI3C 2E8FA 5BSWA 1I94C 4I9GA 1HNWC 3ETOA 2D1QA 1MXBA 1MXCA 3OTOC 3LNVA 2YWBA 5KEIA 2HHHC 1VLAA 3LGXA 1ULTA 1V26A 3CJEA 1RG9A 2EGTA 1UKKA 1RY2A 4DR3C 5KYTA 4IR7A 4X64C 4GKKC 5A1GA 1EGAA 1O90A 3PBKA 2P2FA 3PESA 3L8CA 1LQLA 1JOSA 3LUSA 2AYAA 3VNQA 1GPMA 3IEUA 3FCCA 4R0MA 1T5DX 4I9FA 5AE2A 1HH2P 4RM2A 1YJ7A 3EQ6A 1BA3A 3J81D 3N2QA 2P2BA 2Y4OA 4G37A 5BSMA 3RV2A 1IBKC 3PROC 4KTVA 4JI8C 5GTDA 1P7LA 2OPLA 3KXWA 4GS5A 5T8TA 5CZXA 4ZLPA 2UXBC 4PZPA 4JI1C 4DCUA 4YY3C 2Y4NA 4NOZA 4B3SC 4IZ6A 4BC9A 3JAMD 4AQYC 1O9TA 3NYQA 4LF8C 3A4IA 2BH1X 4NXNC 3G7SA 4DV4C 5A1IA 2XR1A 1N33C 2P20A 1XMOC 4DCSA 2QVXX 3FCEA 4MH4A 1MD9A 3A9UA 4TPSB 1USPA 2UU9C 2WP0C 3TDEA 2UXCC 4RLFA 2BJOA 1HR0C 2YWCA 4WV3A 4WS9A 2P2QA 4DUZC 1MXAA 3R9XA 4RMNA 2P02A 2CY1A 5BSUA 1O92A 3E7WA 4RM3A 4EATA 2UUCC 2QVYX 4ISBA 1ZB8A 2D28C 3H2TA 5IFIA 4JI4C 2E5LC 3S82A 3LAXA 2ONFA 5K8FA 5E7QA 1XRBA 1K0RA 3E7XA 2E0GA 4LF9C 4JYAC 4BC7A 3NI2A 3VNRA 5LMUC 1HNZC 3R9WA 3J80D 1IBMC 4DV5C 4JI5C 5H9UA 1LCIA 5CZVA 2PROA 2OO4A 3GR1A 5BSVA 3N54B 4DR1C 4OXIA 2P2MA 4DUYC 3EERA 3IEVA 2E8CA 3I07A 3C5EA 4X62C 3SO4A 1N2FA 2VZEA 3TUFA 3T1YC 3CW9A 4L4QA 4NXMC 4DV0C 4LF4C 2WD9A 2QL8A 5FLXD 5KYVA 1XNQC 3DHVA 1WF3A 1XRAA 4JI7C 5DV9A 4DCVA 4BCAA 3GR0A 2YCBA 2Y27A 4JV5C 2OPLB 4K0BA 5T8SA 4PHTA 3GKUA 4JM1A 4GXRA 3UZ0A 4DV6C 4MTNA 4KTTA 4LFBC 4DV1C 4HPVA 4L7IA 4B3TC 1PG4A 4G36A 4R1MA 4R1LA 4X65C 1HNXC 2D1SA 4B3RC 3AF5A 4G1IA 5BURA 3RG2A 3CW8X 3IPLA 4DV7C 1ML8A 4JI0C 1N36C 2D1RA 2VSQA 4YHHC 1USPB 4LFAC 1O93A 2CXCA 5BSTA 2D1TA 4GKJC 1J5EC 5BR8C 4JI2C 5IWAC 5BUQA 4U5YD 3GPCA 1NYEA 3R44A 4DR2C 2V7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A1G A;  5T8T A;  2P02 A;  4KTT A;  1MXB A;  1O90 A;  1XRB A;  3UOW A;  1MXC A;  1XRA A;  1O92 A;  4HPV A;  3IML A;  2YWB A;  4L7I A;  3TDE A;  5A19 A;  3SO4 A;  1XRC A;  3RV2 A;  2OBV A;  1GPM A;  1FUG A;  1O9T A;  4L2Z A;  2DPL A;  4KTV A;  4L4Q A;  3A4I A;  4K0B A;  3TQI A;  1RG9 A;  5T8S A;  1QM4 A;  2YWC A;  5H9U A;  3S82 A;  4ODJ A;  4WS9 A;  1P7L A;  5A1I A;  4NDN A;  1MXA A;  4LE5 A;  1O93 A; 
#chains in the Genus database with same CATH topology
 5AE1 A;  1P4E C;  4XX2 A;  5LMN C;  4DG8 A;  4PRO C;  4JI6 C;  1N32 C;  4DR6 C;  4RVN A;  4LF7 C;  1L2F A;  5BUS A;  2D27 A;  4BSZ A;  2OBV A;  2VQF C;  2UUB C;  4RVO A;  2JMP A;  2DPL A;  3B7W A;  4FTF A;  1WH9 A;  4KHP C;  2VQE C;  4GXQ A;  5K85 A;  2PN2 A;  4DV2 C;  2M5H A;  1PA4 A;  4NDN A;  2E7G A;  3DAY A;  1FLO A;  4ZJZ A;  4DCT A;  3ETC A;  2MM9 A;  3IML A;  4BBY A;  3CQ2 A;  2MCQ A;  4FUQ A;  2Z51 A;  4DG9 A;  4D4I A;  1QM4 A;  2DHM A;  3TR3 A;  4ODJ A;  2P2J A;  3UX3 A;  4FUT A;  3NYR A;  3DLP X;  3UOW A;  4PUH A;  1MDB A;  1MDF A;  1MKY A;  1P4E A;  5IT9 D;  5A19 A;  3NPD A;  2UUA C;  3UX2 A;  1XS3 A;  4D57 A;  1IBL C;  4B3M C;  5ADZ A;  2YX1 A;  4L2Z A;  1N34 C;  3T1H C;  3L95 X;  2F4V C;  1KKG A;  4LF5 C;  1T5H X;  1XNR C;  5A2Q D;  3A9V A;  4LE5 A;  4D4G A;  5AE3 A;  1AMU A;  4LFC C;  4LF6 C;  1XMQ C;  2QVZ X;  2QW0 X;  5BSR A;  4DR5 C;  3CQ3 A;  2E8E A;  2KZF A;  3I08 A;  2ATW A;  5LCI A;  4K0K C;  4DR7 C;  1ZB9 A;  1QWI A;  3TQI A;  3AF6 A;  3VNS A;  2ASB A;  4RLQ A;  4DR4 C;  1V25 A;  4DV3 C;  1PG3 A;  3CQ1 A;  2HJG A;  4X66 C;  2PT7 G;  2UXD C;  2KZ0 A;  4OYC A;  1FJG C;  4D56 A;  1XRC A;  2ZM6 C;  1PU1 A;  2DYJ A;  1FUG A;  2D7V A;  4OX9 C;  5JRH A;  4JI3 C;  2MMA B;  2E8F A;  3LNO A;  5BSW A;  1I94 C;  4I9G A;  1HNW C;  3ETO A;  2D1Q A;  1MXB A;  1MXC A;  1XHJ A;  3OTO C;  3LNV A;  2YWB A;  5KEI A;  1UWD A;  2HHH C;  1VLA A;  3LGX A;  1ULT A;  3AY0 A;  1V26 A;  3CJE A;  1M6X C;  1RG9 A;  2EGT A;  1UKK A;  1RY2 A;  4DR3 C;  5KYT A;  4IR7 A;  4X64 C;  4GKK C;  5A1G A;  1EGA A;  1O90 A;  3PBK A;  2P2F A;  3PES A;  3L8C A;  1LQL A;  1JOS A;  3LUS A;  2AYA A;  3VNQ A;  1GPM A;  2ZZM A;  3IEU A;  3FCC A;  4R0M A;  1T5D X;  4I9F A;  5AE2 A;  1HH2 P;  4RM2 A;  1YJ7 A;  3EQ6 A;  1BA3 A;  3J81 D;  2CU6 A;  3N2Q A;  2P2B A;  3UEB A;  2Y4O A;  4G37 A;  5BSM A;  3RV2 A;  1IBK C;  3PRO C;  4KTV A;  4JI8 C;  5GTD A;  1P7L A;  1M6X A;  2OPL A;  3KXW A;  4GS5 A;  1TH5 A;  5T8T A;  5CZX A;  4ZLP A;  2UXB C;  1V60 A;  4PZP A;  3A25 A;  4JI1 C;  4DCU A;  4YY3 C;  2Y4N A;  4NOZ A;  4B3S C;  3K6R A;  4IZ6 A;  4BC9 A;  3JAM D;  4AQY C;  1O9T A;  3NYQ A;  4LF8 C;  3A4I A;  2BH1 X;  4NXN C;  3G7S A;  4DV4 C;  5A1I A;  2XR1 A;  1N33 C;  2P20 A;  1XMO C;  4DCS A;  2QVX X;  3FCE A;  4MH4 A;  4PUG A;  1MD9 A;  3A9U A;  4TPS B;  1USP A;  2UU9 C;  2WP0 C;  3TDE A;  2M5O A;  2UXC C;  4RLF A;  2BJO A;  1IB8 A;  4PUI A;  1HR0 C;  2YWC A;  4WV3 A;  4WS9 A;  2P2Q A;  4DUZ C;  1MXA A;  3R9X A;  4RMN A;  2P02 A;  2CY1 A;  5BSU A;  1O92 A;  3E7W A;  4RM3 A;  4EAT A;  2UUC C;  2QVY X;  4ISB A;  1ZB8 A;  2D28 C;  3H2T A;  5IFI A;  1NY8 A;  4JI4 C;  2E5L C;  3S82 A;  3LAX A;  2ONF A;  5K8F A;  5E7Q A;  1XRB A;  1K0R A;  3E7X A;  2E0G A;  4LF9 C;  1WCJ A;  4JYA C;  4BC7 A;  3NI2 A;  3VNR A;  5LMU C;  1HNZ C;  3R9W A;  3J80 D;  1IBM C;  4DV5 C;  4JI5 C;  5H9U A;  1LCI A;  5CZV A;  2PRO A;  2OO4 A;  3GR1 A;  5BSV A;  3A26 A;  3N54 B;  4DR1 C;  4OXI A;  2P2M A;  4DUY C;  3EER A;  3IEV A;  2E8C A;  2JNV A;  3I07 A;  3O2E A;  3C5E A;  4X62 C;  3SO4 A;  1N2F A;  2VZE A;  3TUF A;  3T1Y C;  3CW9 A;  4L4Q A;  4NXM C;  4DV0 C;  4LF4 C;  2KDN A;  2WD9 A;  2QL8 A;  5FLX D;  5KYV A;  1XNQ C;  3DHV A;  1WF3 A;  1XRA A;  4JI7 C;  5DV9 A;  4DCV A;  4BCA A;  3GR0 A;  2YCB A;  2Y27 A;  4JV5 C;  2OPL B;  4K0B A;  5T8S A;  4PHT A;  3GKU A;  4JM1 A;  4GXR A;  3UZ0 A;  4DV6 C;  4MTN A;  4KTT A;  4LFB C;  4DV1 C;  4HPV A;  4L7I A;  4B3T C;  1PG4 A;  4G36 A;  4R1M A;  4R1L A;  4X65 C;  1HNX C;  2D1S A;  4B3R C;  3AF5 A;  4G1I A;  5BUR A;  3RG2 A;  3CW8 X;  3IPL A;  4DV7 C;  1ML8 A;  4JI0 C;  1N36 C;  2D1R A;  2VSQ A;  4YHH C;  1USP B;  4LFA C;  1O93 A;  2CXC A;  5BST A;  1VEH A;  2D1T A;  4GKJ C;  1J5E C;  5BR8 C;  4JI2 C;  5IWA C;  5BUQ A;  2ZZN A;  4U5Y D;  2NCL A;  3GPC A;  1NYE A;  3R44 A;  4DR2 C;  2V7B A; 
#chains in the Genus database with same CATH homology
 5AE1 A;  4XX2 A;  5LMN C;  4DG8 A;  4PRO C;  4JI6 C;  1N32 C;  4DR6 C;  4RVN A;  4LF7 C;  1L2F A;  5BUS A;  2D27 A;  4BSZ A;  2OBV A;  2VQF C;  2UUB C;  4RVO A;  2JMP A;  2DPL A;  3B7W A;  4FTF A;  1WH9 A;  4KHP C;  2VQE C;  4GXQ A;  5K85 A;  2PN2 A;  4DV2 C;  1PA4 A;  4NDN A;  2E7G A;  3DAY A;  4ZJZ A;  4DCT A;  3ETC A;  3IML A;  4BBY A;  4FUQ A;  4DG9 A;  4D4I A;  1QM4 A;  4ODJ A;  2P2J A;  4FUT A;  3NYR A;  3DLP X;  3UOW A;  1MDB A;  1MDF A;  1MKY A;  5IT9 D;  5A19 A;  3NPD A;  2UUA C;  4D57 A;  1IBL C;  4B3M C;  5ADZ A;  4L2Z A;  1N34 C;  3T1H C;  3L95 X;  2F4V C;  1KKG A;  4LF5 C;  1T5H X;  1XNR C;  5A2Q D;  3A9V A;  4LE5 A;  4D4G A;  5AE3 A;  1AMU A;  4LFC C;  4LF6 C;  1XMQ C;  2QVZ X;  2QW0 X;  5BSR A;  4DR5 C;  2E8E A;  2KZF A;  3I08 A;  2ATW A;  4K0K C;  4DR7 C;  1ZB9 A;  1QWI A;  3TQI A;  3AF6 A;  3VNS A;  2ASB A;  4RLQ A;  4DR4 C;  1V25 A;  4DV3 C;  1PG3 A;  2HJG A;  4X66 C;  2PT7 G;  2UXD C;  4OYC A;  1FJG C;  4D56 A;  1XRC A;  2ZM6 C;  2DYJ A;  1FUG A;  2D7V A;  4OX9 C;  5JRH A;  4JI3 C;  2E8F A;  5BSW A;  1I94 C;  4I9G A;  1HNW C;  3ETO A;  2D1Q A;  1MXB A;  1MXC A;  3OTO C;  3LNV A;  2YWB A;  5KEI A;  2HHH C;  1VLA A;  3LGX A;  1ULT A;  1V26 A;  3CJE A;  1RG9 A;  2EGT A;  1UKK A;  1RY2 A;  4DR3 C;  5KYT A;  4IR7 A;  4X64 C;  4GKK C;  5A1G A;  1EGA A;  1O90 A;  3PBK A;  2P2F A;  3PES A;  3L8C A;  1LQL A;  1JOS A;  3LUS A;  2AYA A;  3VNQ A;  1GPM A;  3IEU A;  3FCC A;  4R0M A;  1T5D X;  4I9F A;  5AE2 A;  1HH2 P;  4RM2 A;  1YJ7 A;  3EQ6 A;  1BA3 A;  3J81 D;  3N2Q A;  2P2B A;  2Y4O A;  4G37 A;  5BSM A;  3RV2 A;  1IBK C;  3PRO C;  4KTV A;  4JI8 C;  5GTD A;  1P7L A;  2OPL A;  3KXW A;  4GS5 A;  5T8T A;  5CZX A;  4ZLP A;  2UXB C;  4PZP A;  4JI1 C;  4DCU A;  4YY3 C;  2Y4N A;  4NOZ A;  4B3S C;  4IZ6 A;  4BC9 A;  3JAM D;  4AQY C;  1O9T A;  3NYQ A;  4LF8 C;  3A4I A;  2BH1 X;  4NXN C;  3G7S A;  4DV4 C;  5A1I A;  2XR1 A;  1N33 C;  2P20 A;  1XMO C;  4DCS A;  2QVX X;  3FCE A;  4MH4 A;  1MD9 A;  3A9U A;  4TPS B;  1USP A;  2UU9 C;  2WP0 C;  3TDE A;  2UXC C;  4RLF A;  2BJO A;  1HR0 C;  2YWC A;  4WV3 A;  4WS9 A;  2P2Q A;  4DUZ C;  1MXA A;  3R9X A;  4RMN A;  2P02 A;  2CY1 A;  5BSU A;  1O92 A;  3E7W A;  4RM3 A;  4EAT A;  2UUC C;  2QVY X;  4ISB A;  1ZB8 A;  2D28 C;  3H2T A;  5IFI A;  4JI4 C;  2E5L C;  3S82 A;  3LAX A;  2ONF A;  5K8F A;  5E7Q A;  1XRB A;  1K0R A;  3E7X A;  2E0G A;  4LF9 C;  4JYA C;  4BC7 A;  3NI2 A;  3VNR A;  5LMU C;  1HNZ C;  3R9W A;  3J80 D;  1IBM C;  4DV5 C;  4JI5 C;  5H9U A;  1LCI A;  5CZV A;  2PRO A;  2OO4 A;  3GR1 A;  5BSV A;  3N54 B;  4DR1 C;  4OXI A;  2P2M A;  4DUY C;  3EER A;  3IEV A;  2E8C A;  3I07 A;  3C5E A;  4X62 C;  3SO4 A;  1N2F A;  2VZE A;  3TUF A;  3T1Y C;  3CW9 A;  4L4Q A;  4NXM C;  4DV0 C;  4LF4 C;  2WD9 A;  2QL8 A;  5FLX D;  5KYV A;  1XNQ C;  3DHV A;  1WF3 A;  1XRA A;  4JI7 C;  5DV9 A;  4DCV A;  4BCA A;  3GR0 A;  2YCB A;  2Y27 A;  4JV5 C;  2OPL B;  4K0B A;  5T8S A;  4PHT A;  3GKU A;  4JM1 A;  4GXR A;  3UZ0 A;  4DV6 C;  4MTN A;  4KTT A;  4LFB C;  4DV1 C;  4HPV A;  4L7I A;  4B3T C;  1PG4 A;  4G36 A;  4R1M A;  4R1L A;  4X65 C;  1HNX C;  2D1S A;  4B3R C;  3AF5 A;  4G1I A;  5BUR A;  3RG2 A;  3CW8 X;  3IPL A;  4DV7 C;  1ML8 A;  4JI0 C;  1N36 C;  2D1R A;  2VSQ A;  4YHH C;  1USP B;  4LFA C;  1O93 A;  2CXC A;  5BST A;  2D1T A;  4GKJ C;  1J5E C;  5BR8 C;  4JI2 C;  5IWA C;  5BUQ A;  4U5Y D;  3GPC A;  1NYE A;  3R44 A;  4DR2 C;  2V7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...