1MXAA

S-adenosylmethionine synthetase with ppi
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
Knots found
sequence length
383
structure length
377
Chain Sequence
AKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTSAWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDRADPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVGIDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGHFGREHFPWEKTDKAQLLRDAAGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords S-ADENOSYLMETHIONINE SYNTHETASE
publication title Structure and function of S-adenosylmethionine synthetase: crystal structures of S-adenosylmethionine synthetase with ADP, BrADP, and PPi at 28 angstroms resolution.
pubmed doi rcsb
total genus 124
structure length 377
sequence length 383
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1mxaA01
4LE5A 1RG9A 1FUGA 5A19A 1O92A 3RV2A 3S82A 3TQIA 4KTTA 5H9UA 4NDNA 1GPMA 3IMLA 1XRBA 5T8TA 1QM4A 1P7LA 2P02A 2YWBA 4KTVA 4L7IA 1O90A 5A1GA 1MXAA 3SO4A 3A4IA 1O9TA 2YWCA 3UOWA 1MXBA 4ODJA 2DPLA 1XRAA 1O93A 3TDEA 4K0BA 5A1IA 1MXCA 1XRCA 4L4QA 4HPVA 4WS9A 4L2ZA 5T8SA 2OBVA
chains in the Genus database with same CATH superfamily
4DG8A 1EGAA 5BUSA 4DV5C 1UKKA 2M5HA 2ZZNA 4LF9C 2D1RA 2CXCA 4RVOA 5IT9D 5AE1A 1WF3A 3EERA 4B3TC 1HNXC 4DR2C 1HH2P 4L2ZA 5AE3A 2D1QA 1T5HX 1USPA 3CQ1A 1P4EC 2M5OA 5AE2A 2D28C 4DV2C 1QM4A 1P7LA 4R0MA 5JRHA 1M6XA 1MXBA 5FLXD 1HNZC 2CU6A 2KZFA 4XX2A 3RG2A 2UUBC 3CW9A 3GR0A 3NYRA 3ETCA 4U5YD 2P2JA 2VQFC 3T1YC 2QVZX 2DYJA 2PROA 5T8TA 3AF6A 4RM2A 4R1LA 1IBLC 4G1IA 5K8FA 4X65C 4RLFA 3DLPX 4OYCA 1PA4A 2D1SA 2YCBA 4LF8C 4LFCC 3TQIA 3GPCA 2HHHC 3B7WA 3R9WA 2P02A 1ML8A 5LMUC 3IEUA 4FUTA 2AYAA 3LNOA 3A9VA 2UXBC 4JI6C 3CJEA 3UX2A 4LE5A 5BSUA 1K0RA 3LNVA 4DV0C 3O2EA 4DR4C 4RM3A 1XNQC 1XRBA 2JMPA 4ISBA 2KDNA 2OPLB 1O9TA 4KHPC 4TPSB 4OX9C 4JI3C 4YY3C 1YJ7A 3NYQA 2JNVA 3N2QA 3GKUA 1PG3A 4JI7C 1FJGC 4BC9A 2D1TA 1FUGA 2E8FA 1MD9A 4GKJC 5KYVA 3DHVA 4KTVA 1O90A 4D56A 4DUZC 1IB8A 2P2FA 3E7XA 2UXCC 2OO4A 4BC7A 5IFIA 5BSTA 4LF4C 4EATA 3A25A 1MKYA 5DV9A 2P2BA 3EQ6A 3RV2A 2ATWA 2MM9A 3UX3A 4ZLPA 3FCCA 3G7SA 2OPLA 3UZ0A 1ULTA 1MXAA 3A4IA 5LCIA 5K85A 1XRAA 5E7QA 2D7VA 4DR3C 4JI4C 1AMUA 2XR1A 4OXIA 1XS3A 1NY8A 3KXWA 1JOSA 4G37A 3R9XA 3UEBA 1O92A 2ONFA 5H9UA 3A9UA 1GPMA 3T1HC 5IWAC 3FCEA 4D4GA 2E8CA 3UOWA 4ODJA 5GTDA 4FUQA 4B3MC 1T5DX 1O93A 3DAYA 2MMAB 4PHTA 2VZEA 2QW0X 5KYTA 4B3SC 4RVNA 3A26A 3JAMD 1PG4A 2P2QA 3L8CA 1N34C 2Y4NA 2WD9A 4NDNA 1ZB8A 4L7IA 2NCLA 2ZM6C 3GR1A 4K0BA 4JI1C 2EGTA 2E5LC 4WS9A 4X66C 2OBVA 4B3RC 3LGXA 4G36A 2VQEC 1L2FA 3L95X 1QWIA 4KTTA 1NYEA 2Z51A 2HJGA 1PU1A 4RMNA 4DR5C 4ZJZA 2ZZMA 4PUGA 1J5EC 4NXNC 2PT7G 4MH4A 5BSMA 1XRCA 3VNQA 4K0KC 4FTFA 1FLOA 4DR6C 4NXMC 2V7BA 1RG9A 2E8EA 4DR1C 4X62C 4DV1C 4GKKC 1MDFA 4DCVA 5BURA 2UXDC 4AQYC 1XHJA 4DV3C 3SO4A 1IBKC 4PROC 4DCUA 1V60A 2DPLA 2BH1X 1IBMC 4L4QA 1V25A 2BJOA 4HPVA 4DCSA 4BBYA 2WP0C 4R1MA 4WV3A 2YX1A 2QVYX 3VNSA 1VLAA 4I9GA 4DR7C 1XMQC 1ZB9A 2YWBA 1LCIA 1WCJA 4JI5C 5BSRA 5CZVA 2P20A 5A2QD 3H2TA 1N32C 3TR3A 1VEHA 2UUAC 3VNRA 4LFAC 1M6XC 5BUQA 3CQ2A 3LAXA 4PUHA 1MDBA 5T8SA 3C5EA 1LQLA 4DV7C 1P4EA 1HNWC 2P2MA 1V26A 3S82A 1KKGA 1BA3A 3NPDA 4JM1A 4BSZA 3PESA 5LMNC 2VSQA 2F4VC 2ASBA 3AF5A 3CW8X 2KZ0A 3I08A 3LUSA 1XNRC 2Y27A 4LF5C 1MXCA 4DV6C 4JYAC 4PUIA 3PROC 4JI8C 3NI2A 1HR0C 1N36C 4JI2C 2MCQA 4DCTA 4DUYC 1UWDA 4BCAA 3IEVA 4JV5C 4D57A 3PBKA 5BR8C 4MTNA 4GXRA 4YHHC 3CQ3A 4RLQA 3TUFA 1TH5A 1N2FA 2QVXX 5BSVA 3ETOA 1XMOC 4GXQA 3I07A 5BSWA 4NOZA 4LFBC 2QL8A 1WH9A 2CY1A 4DG9A 4LF6C 2PN2A 2D27A 3TDEA 2DHMA 2Y4OA 4I9FA 2E0GA 5CZXA 3R44A 3E7WA 5ADZA 4X64C 5A19A 3AY0A 1N33C 3IPLA 3N54B 1USPB 3J80D 3IMLA 1I94C 5A1GA 4IR7A 3K6RA 2E7GA 2YWCA 4DV4C 2UUCC 2UU9C 5A1IA 4JI0C 4GS5A 3OTOC 4IZ6A 4D4IA 5KEIA 4LF7C 4PZPA 1RY2A 3J81D
chains in the Genus database with same CATH topology
4DG8A 1EGAA 5BUSA 4DV5C 1UKKA 4LF9C 2D1RA 2CXCA 4RVOA 5IT9D 5AE1A 1WF3A 3EERA 4B3TC 1HNXC 4DR2C 1HH2P 4L2ZA 5AE3A 2D1QA 1T5HX 1USPA 5AE2A 2D28C 4DV2C 1QM4A 1P7LA 4R0MA 5JRHA 1MXBA 5FLXD 1HNZC 2KZFA 4XX2A 3RG2A 2UUBC 3CW9A 3GR0A 3NYRA 3ETCA 4U5YD 2P2JA 2VQFC 3T1YC 2QVZX 2DYJA 2PROA 5T8TA 3AF6A 4RM2A 4R1LA 1IBLC 4G1IA 5K8FA 4X65C 4RLFA 3DLPX 4OYCA 1PA4A 2D1SA 2YCBA 4LF8C 4LFCC 3TQIA 3GPCA 2HHHC 3B7WA 3R9WA 2P02A 1ML8A 5LMUC 3IEUA 4FUTA 2AYAA 3A9VA 2UXBC 4JI6C 3CJEA 4LE5A 5BSUA 1K0RA 3LNVA 4DV0C 4DR4C 4RM3A 1XNQC 1XRBA 2JMPA 4ISBA 2OPLB 1O9TA 4KHPC 4TPSB 4OX9C 4JI3C 4YY3C 1YJ7A 3NYQA 3N2QA 3GKUA 1PG3A 4JI7C 1FJGC 4BC9A 2D1TA 1FUGA 2E8FA 1MD9A 4GKJC 5KYVA 3DHVA 4KTVA 1O90A 4D56A 4DUZC 2P2FA 3E7XA 2UXCC 2OO4A 4BC7A 5IFIA 5BSTA 4LF4C 4EATA 1MKYA 5DV9A 2P2BA 3EQ6A 3RV2A 2ATWA 4ZLPA 3FCCA 3G7SA 2OPLA 3UZ0A 1ULTA 1MXAA 3A4IA 5K85A 1XRAA 5E7QA 2D7VA 4DR3C 4JI4C 1AMUA 2XR1A 4OXIA 3KXWA 1JOSA 4G37A 3R9XA 1O92A 2ONFA 5H9UA 3A9UA 1GPMA 3T1HC 5IWAC 3FCEA 4D4GA 2E8CA 3UOWA 4ODJA 5GTDA 4FUQA 4B3MC 1T5DX 1O93A 3DAYA 4PHTA 2VZEA 2QW0X 5KYTA 4B3SC 4RVNA 3JAMD 1PG4A 2P2QA 3L8CA 1N34C 2Y4NA 2WD9A 4NDNA 1ZB8A 4L7IA 2ZM6C 3GR1A 4K0BA 4JI1C 2EGTA 2E5LC 4WS9A 4X66C 2OBVA 4B3RC 3LGXA 4G36A 2VQEC 1L2FA 3L95X 1QWIA 4KTTA 1NYEA 2HJGA 4RMNA 4DR5C 4ZJZA 1J5EC 4NXNC 2PT7G 4MH4A 5BSMA 1XRCA 3VNQA 4K0KC 4FTFA 4DR6C 4NXMC 2V7BA 1RG9A 2E8EA 4DR1C 4X62C 4DV1C 4GKKC 1MDFA 4DCVA 5BURA 2UXDC 4AQYC 4DV3C 3SO4A 1IBKC 4PROC 4DCUA 2DPLA 2BH1X 1IBMC 4L4QA 1V25A 2BJOA 4HPVA 4DCSA 4BBYA 2WP0C 4R1MA 4WV3A 2QVYX 3VNSA 1VLAA 4I9GA 4DR7C 1XMQC 1ZB9A 2YWBA 1LCIA 4JI5C 5BSRA 5CZVA 2P20A 5A2QD 3H2TA 1N32C 2UUAC 3VNRA 4LFAC 5BUQA 3LAXA 5T8SA 1MDBA 3C5EA 1LQLA 4DV7C 1HNWC 2P2MA 1V26A 3S82A 1KKGA 1BA3A 3NPDA 4JM1A 4BSZA 3PESA 5LMNC 2VSQA 2F4VC 2ASBA 3AF5A 3CW8X 3I08A 3LUSA 1XNRC 2Y27A 4LF5C 1MXCA 4DV6C 4JYAC 3PROC 4JI8C 3NI2A 1HR0C 1N36C 4JI2C 4DCTA 4DUYC 4BCAA 3IEVA 4JV5C 4D57A 3PBKA 5BR8C 4MTNA 4GXRA 4YHHC 4RLQA 3TUFA 1N2FA 2QVXX 5BSVA 3ETOA 1XMOC 4GXQA 3I07A 5BSWA 4NOZA 4LFBC 2QL8A 1WH9A 2CY1A 4DG9A 4LF6C 2PN2A 2D27A 3TDEA 2Y4OA 4I9FA 2E0GA 5CZXA 3R44A 3E7WA 5ADZA 4X64C 5A19A 1N33C 3IPLA 3N54B 1USPB 3J80D 3IMLA 1I94C 5A1GA 4IR7A 2E7GA 2YWCA 4DV4C 2UUCC 2UU9C 5A1IA 4JI0C 4GS5A 3OTOC 4IZ6A 4D4IA 5KEIA 4LF7C 4PZPA 1RY2A 3J81D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LE5 A;  1RG9 A;  1FUG A;  5A19 A;  1O92 A;  3RV2 A;  3S82 A;  3TQI A;  4KTT A;  5H9U A;  4NDN A;  1GPM A;  3IML A;  1XRB A;  5T8T A;  1QM4 A;  1P7L A;  2P02 A;  2YWB A;  4KTV A;  4L7I A;  1O90 A;  5A1G A;  1MXA A;  3SO4 A;  3A4I A;  1O9T A;  2YWC A;  3UOW A;  1MXB A;  4ODJ A;  2DPL A;  1XRA A;  1O93 A;  3TDE A;  4K0B A;  5A1I A;  1MXC A;  1XRC A;  4L4Q A;  4HPV A;  4WS9 A;  4L2Z A;  5T8S A;  2OBV A; 
#chains in the Genus database with same CATH topology
 4DG8 A;  1EGA A;  5BUS A;  4DV5 C;  1UKK A;  2M5H A;  2ZZN A;  4LF9 C;  2D1R A;  2CXC A;  4RVO A;  5IT9 D;  5AE1 A;  1WF3 A;  3EER A;  4B3T C;  1HNX C;  4DR2 C;  1HH2 P;  4L2Z A;  5AE3 A;  2D1Q A;  1T5H X;  1USP A;  3CQ1 A;  1P4E C;  2M5O A;  5AE2 A;  2D28 C;  4DV2 C;  1QM4 A;  1P7L A;  4R0M A;  5JRH A;  1M6X A;  1MXB A;  5FLX D;  1HNZ C;  2CU6 A;  2KZF A;  4XX2 A;  3RG2 A;  2UUB C;  3CW9 A;  3GR0 A;  3NYR A;  3ETC A;  4U5Y D;  2P2J A;  2VQF C;  3T1Y C;  2QVZ X;  2DYJ A;  2PRO A;  5T8T A;  3AF6 A;  4RM2 A;  4R1L A;  1IBL C;  4G1I A;  5K8F A;  4X65 C;  4RLF A;  3DLP X;  4OYC A;  1PA4 A;  2D1S A;  2YCB A;  4LF8 C;  4LFC C;  3TQI A;  3GPC A;  2HHH C;  3B7W A;  3R9W A;  2P02 A;  1ML8 A;  5LMU C;  3IEU A;  4FUT A;  2AYA A;  3LNO A;  3A9V A;  2UXB C;  4JI6 C;  3CJE A;  3UX2 A;  4LE5 A;  5BSU A;  1K0R A;  3LNV A;  4DV0 C;  3O2E A;  4DR4 C;  4RM3 A;  1XNQ C;  1XRB A;  2JMP A;  4ISB A;  2KDN A;  2OPL B;  1O9T A;  4KHP C;  4TPS B;  4OX9 C;  4JI3 C;  4YY3 C;  1YJ7 A;  3NYQ A;  2JNV A;  3N2Q A;  3GKU A;  1PG3 A;  4JI7 C;  1FJG C;  4BC9 A;  2D1T A;  1FUG A;  2E8F A;  1MD9 A;  4GKJ C;  5KYV A;  3DHV A;  4KTV A;  1O90 A;  4D56 A;  4DUZ C;  1IB8 A;  2P2F A;  3E7X A;  2UXC C;  2OO4 A;  4BC7 A;  5IFI A;  5BST A;  4LF4 C;  4EAT A;  3A25 A;  1MKY A;  5DV9 A;  2P2B A;  3EQ6 A;  3RV2 A;  2ATW A;  2MM9 A;  3UX3 A;  4ZLP A;  3FCC A;  3G7S A;  2OPL A;  3UZ0 A;  1ULT A;  1MXA A;  3A4I A;  5LCI A;  5K85 A;  1XRA A;  5E7Q A;  2D7V A;  4DR3 C;  4JI4 C;  1AMU A;  2XR1 A;  4OXI A;  1XS3 A;  1NY8 A;  3KXW A;  1JOS A;  4G37 A;  3R9X A;  3UEB A;  1O92 A;  2ONF A;  5H9U A;  3A9U A;  1GPM A;  3T1H C;  5IWA C;  3FCE A;  4D4G A;  2E8C A;  3UOW A;  4ODJ A;  5GTD A;  4FUQ A;  4B3M C;  1T5D X;  1O93 A;  3DAY A;  2MMA B;  4PHT A;  2VZE A;  2QW0 X;  5KYT A;  4B3S C;  4RVN A;  3A26 A;  3JAM D;  1PG4 A;  2P2Q A;  3L8C A;  1N34 C;  2Y4N A;  2WD9 A;  4NDN A;  1ZB8 A;  4L7I A;  2NCL A;  2ZM6 C;  3GR1 A;  4K0B A;  4JI1 C;  2EGT A;  2E5L C;  4WS9 A;  4X66 C;  2OBV A;  4B3R C;  3LGX A;  4G36 A;  2VQE C;  1L2F A;  3L95 X;  1QWI A;  4KTT A;  1NYE A;  2Z51 A;  2HJG A;  1PU1 A;  4RMN A;  4DR5 C;  4ZJZ A;  2ZZM A;  4PUG A;  1J5E C;  4NXN C;  2PT7 G;  4MH4 A;  5BSM A;  1XRC A;  3VNQ A;  4K0K C;  4FTF A;  1FLO A;  4DR6 C;  4NXM C;  2V7B A;  1RG9 A;  2E8E A;  4DR1 C;  4X62 C;  4DV1 C;  4GKK C;  1MDF A;  4DCV A;  5BUR A;  2UXD C;  4AQY C;  1XHJ A;  4DV3 C;  3SO4 A;  1IBK C;  4PRO C;  4DCU A;  1V60 A;  2DPL A;  2BH1 X;  1IBM C;  4L4Q A;  1V25 A;  2BJO A;  4HPV A;  4DCS A;  4BBY A;  2WP0 C;  4R1M A;  4WV3 A;  2YX1 A;  2QVY X;  3VNS A;  1VLA A;  4I9G A;  4DR7 C;  1XMQ C;  1ZB9 A;  2YWB A;  1LCI A;  1WCJ A;  4JI5 C;  5BSR A;  5CZV A;  2P20 A;  5A2Q D;  3H2T A;  1N32 C;  3TR3 A;  1VEH A;  2UUA C;  3VNR A;  4LFA C;  1M6X C;  5BUQ A;  3CQ2 A;  3LAX A;  4PUH A;  1MDB A;  5T8S A;  3C5E A;  1LQL A;  4DV7 C;  1P4E A;  1HNW C;  2P2M A;  1V26 A;  3S82 A;  1KKG A;  1BA3 A;  3NPD A;  4JM1 A;  4BSZ A;  3PES A;  5LMN C;  2VSQ A;  2F4V C;  2ASB A;  3AF5 A;  3CW8 X;  2KZ0 A;  3I08 A;  3LUS A;  1XNR C;  2Y27 A;  4LF5 C;  1MXC A;  4DV6 C;  4JYA C;  4PUI A;  3PRO C;  4JI8 C;  3NI2 A;  1HR0 C;  1N36 C;  4JI2 C;  2MCQ A;  4DCT A;  4DUY C;  1UWD A;  4BCA A;  3IEV A;  4JV5 C;  4D57 A;  3PBK A;  5BR8 C;  4MTN A;  4GXR A;  4YHH C;  3CQ3 A;  4RLQ A;  3TUF A;  1TH5 A;  1N2F A;  2QVX X;  5BSV A;  3ETO A;  1XMO C;  4GXQ A;  3I07 A;  5BSW A;  4NOZ A;  4LFB C;  2QL8 A;  1WH9 A;  2CY1 A;  4DG9 A;  4LF6 C;  2PN2 A;  2D27 A;  3TDE A;  2DHM A;  2Y4O A;  4I9F A;  2E0G A;  5CZX A;  3R44 A;  3E7W A;  5ADZ A;  4X64 C;  5A19 A;  3AY0 A;  1N33 C;  3IPL A;  3N54 B;  1USP B;  3J80 D;  3IML A;  1I94 C;  5A1G A;  4IR7 A;  3K6R A;  2E7G A;  2YWC A;  4DV4 C;  2UUC C;  2UU9 C;  5A1I A;  4JI0 C;  4GS5 A;  3OTO C;  4IZ6 A;  4D4I A;  5KEI A;  4LF7 C;  4PZP A;  1RY2 A;  3J81 D; 
#chains in the Genus database with same CATH homology
 4DG8 A;  1EGA A;  5BUS A;  4DV5 C;  1UKK A;  4LF9 C;  2D1R A;  2CXC A;  4RVO A;  5IT9 D;  5AE1 A;  1WF3 A;  3EER A;  4B3T C;  1HNX C;  4DR2 C;  1HH2 P;  4L2Z A;  5AE3 A;  2D1Q A;  1T5H X;  1USP A;  5AE2 A;  2D28 C;  4DV2 C;  1QM4 A;  1P7L A;  4R0M A;  5JRH A;  1MXB A;  5FLX D;  1HNZ C;  2KZF A;  4XX2 A;  3RG2 A;  2UUB C;  3CW9 A;  3GR0 A;  3NYR A;  3ETC A;  4U5Y D;  2P2J A;  2VQF C;  3T1Y C;  2QVZ X;  2DYJ A;  2PRO A;  5T8T A;  3AF6 A;  4RM2 A;  4R1L A;  1IBL C;  4G1I A;  5K8F A;  4X65 C;  4RLF A;  3DLP X;  4OYC A;  1PA4 A;  2D1S A;  2YCB A;  4LF8 C;  4LFC C;  3TQI A;  3GPC A;  2HHH C;  3B7W A;  3R9W A;  2P02 A;  1ML8 A;  5LMU C;  3IEU A;  4FUT A;  2AYA A;  3A9V A;  2UXB C;  4JI6 C;  3CJE A;  4LE5 A;  5BSU A;  1K0R A;  3LNV A;  4DV0 C;  4DR4 C;  4RM3 A;  1XNQ C;  1XRB A;  2JMP A;  4ISB A;  2OPL B;  1O9T A;  4KHP C;  4TPS B;  4OX9 C;  4JI3 C;  4YY3 C;  1YJ7 A;  3NYQ A;  3N2Q A;  3GKU A;  1PG3 A;  4JI7 C;  1FJG C;  4BC9 A;  2D1T A;  1FUG A;  2E8F A;  1MD9 A;  4GKJ C;  5KYV A;  3DHV A;  4KTV A;  1O90 A;  4D56 A;  4DUZ C;  2P2F A;  3E7X A;  2UXC C;  2OO4 A;  4BC7 A;  5IFI A;  5BST A;  4LF4 C;  4EAT A;  1MKY A;  5DV9 A;  2P2B A;  3EQ6 A;  3RV2 A;  2ATW A;  4ZLP A;  3FCC A;  3G7S A;  2OPL A;  3UZ0 A;  1ULT A;  1MXA A;  3A4I A;  5K85 A;  1XRA A;  5E7Q A;  2D7V A;  4DR3 C;  4JI4 C;  1AMU A;  2XR1 A;  4OXI A;  3KXW A;  1JOS A;  4G37 A;  3R9X A;  1O92 A;  2ONF A;  5H9U A;  3A9U A;  1GPM A;  3T1H C;  5IWA C;  3FCE A;  4D4G A;  2E8C A;  3UOW A;  4ODJ A;  5GTD A;  4FUQ A;  4B3M C;  1T5D X;  1O93 A;  3DAY A;  4PHT A;  2VZE A;  2QW0 X;  5KYT A;  4B3S C;  4RVN A;  3JAM D;  1PG4 A;  2P2Q A;  3L8C A;  1N34 C;  2Y4N A;  2WD9 A;  4NDN A;  1ZB8 A;  4L7I A;  2ZM6 C;  3GR1 A;  4K0B A;  4JI1 C;  2EGT A;  2E5L C;  4WS9 A;  4X66 C;  2OBV A;  4B3R C;  3LGX A;  4G36 A;  2VQE C;  1L2F A;  3L95 X;  1QWI A;  4KTT A;  1NYE A;  2HJG A;  4RMN A;  4DR5 C;  4ZJZ A;  1J5E C;  4NXN C;  2PT7 G;  4MH4 A;  5BSM A;  1XRC A;  3VNQ A;  4K0K C;  4FTF A;  4DR6 C;  4NXM C;  2V7B A;  1RG9 A;  2E8E A;  4DR1 C;  4X62 C;  4DV1 C;  4GKK C;  1MDF A;  4DCV A;  5BUR A;  2UXD C;  4AQY C;  4DV3 C;  3SO4 A;  1IBK C;  4PRO C;  4DCU A;  2DPL A;  2BH1 X;  1IBM C;  4L4Q A;  1V25 A;  2BJO A;  4HPV A;  4DCS A;  4BBY A;  2WP0 C;  4R1M A;  4WV3 A;  2QVY X;  3VNS A;  1VLA A;  4I9G A;  4DR7 C;  1XMQ C;  1ZB9 A;  2YWB A;  1LCI A;  4JI5 C;  5BSR A;  5CZV A;  2P20 A;  5A2Q D;  3H2T A;  1N32 C;  2UUA C;  3VNR A;  4LFA C;  5BUQ A;  3LAX A;  5T8S A;  1MDB A;  3C5E A;  1LQL A;  4DV7 C;  1HNW C;  2P2M A;  1V26 A;  3S82 A;  1KKG A;  1BA3 A;  3NPD A;  4JM1 A;  4BSZ A;  3PES A;  5LMN C;  2VSQ A;  2F4V C;  2ASB A;  3AF5 A;  3CW8 X;  3I08 A;  3LUS A;  1XNR C;  2Y27 A;  4LF5 C;  1MXC A;  4DV6 C;  4JYA C;  3PRO C;  4JI8 C;  3NI2 A;  1HR0 C;  1N36 C;  4JI2 C;  4DCT A;  4DUY C;  4BCA A;  3IEV A;  4JV5 C;  4D57 A;  3PBK A;  5BR8 C;  4MTN A;  4GXR A;  4YHH C;  4RLQ A;  3TUF A;  1N2F A;  2QVX X;  5BSV A;  3ETO A;  1XMO C;  4GXQ A;  3I07 A;  5BSW A;  4NOZ A;  4LFB C;  2QL8 A;  1WH9 A;  2CY1 A;  4DG9 A;  4LF6 C;  2PN2 A;  2D27 A;  3TDE A;  2Y4O A;  4I9F A;  2E0G A;  5CZX A;  3R44 A;  3E7W A;  5ADZ A;  4X64 C;  5A19 A;  1N33 C;  3IPL A;  3N54 B;  1USP B;  3J80 D;  3IML A;  1I94 C;  5A1G A;  4IR7 A;  2E7G A;  2YWC A;  4DV4 C;  2UUC C;  2UU9 C;  5A1I A;  4JI0 C;  4GS5 A;  3OTO C;  4IZ6 A;  4D4I A;  5KEI A;  4LF7 C;  4PZP A;  1RY2 A;  3J81 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...