2EGTA

Crystal structure of hypothetical protein (aq1549) from aquifex aeolicus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Hypothetical protein (AQ1549) from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AQ_1549
total genus 42
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.300 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2egtA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2egtA02
4X66C 5A2QD 4DCUA 5FLXD 1USPB 1XMOC 4LF5C 2QL8A 4NXNC 2VQFC 2VQEC 1I94C 4NOZA 4DV7C 1ZB9A 4DR5C 1IBLC 4GKKC 4JI0C 2UUBC 2HHHC 4DV6C 5IWAC 4JV5C 4DV1C 4XX2A 4JI4C 2PT7G 4JI7C 4DV4C 4BSZA 4GKJC 1N32C 2ASBA 2BJOA 2OPLB 3T1YC 2DYJA 1FJGC 4DCVA 5LMUC 3J80D 1UKKA 4B3MC 4MTNA 4JYAC 1PA4A 2UXCC 1HNWC 1N34C 4X64C 3IEVA 4DV5C 2JMPA 1K0RA 3OTOC 1WH9A 4DV3C 4DUZC 3GKUA 4DR3C 3LUSA 3R9WA 1USPA 4DV0C 3EERA 2E8FA 2E8EA 4DCSA 3R9XA 2UXDC 2ATWA 1IBKC 4LF9C 1EGAA 1N33C 1IBMC 3AF6A 1JOSA 1HR0C 1ZB8A 3J81D 1NYEA 2CY1A 1HNZC 2UUCC 4B3RC 4JI6C 4JI5C 3I07A 2CXCA 2YCBA 2HJGA 5IT9D 4YY3C 4DR1C 2E5LC 4X62C 4DR7C 4LFCC 4AQYC 4LF6C 2UU9C 1XNRC 1XNQC 3JAMD 3AF5A 2ONFA 4DR2C 4LFAC 2PN2A 4B3SC 1L2FA 2EGTA 1VLAA 4LF8C 4NXMC 1LQLA 4MH4A 4DCTA 4OX9C 2E8CA 4JI3C 1MKYA 3CJEA 2E7GA 1N36C 4X65C 4JI1C 2D7VA 3IEUA 4K0KC 4KHPC 4LFBC 2KZFA 4JI2C 5BR8C 2OPLA 1J5EC 4DUYC 4DR6C 2UXBC 1N2FA 4JI8C 4LF7C 1ML8A 2XR1A 1HNXC 1QWIA 1KKGA 4DR4C 4YHHC 3T1HC 1HH2P 4LF4C 2ZM6C 5LMNC 2F4VC 1XMQC 1WF3A 2UUAC 4B3TC 4DV2C
chains in the Genus database with same CATH superfamily
3NH4A 2QW0X 1V25A 2JA7I 4MRIA 1S7MA 1VEHA 1DL6A 3C5EA 3D9XA 2KDNA 4RVOA 2AYDA 5T8SA 4DR5C 2WD9A 4DV1C 3CCEZ 2VPXA 3VMIA 3S1MI 4DV4C 2R93I 5BSRA 4BSZA 1VQ41 3P5JB 2OBVA 3CCM1 2JNVA 3AY0A 2RT9A 2QRCB 5A2Qb 1V60A 2JS4A 3DHVA 1Z02A 3UZ0A 3GTMS 4DG8A 1WIIA 1YJ91 1YJNZ 4FUTA 4A3KI 3A4IA 3VNQA 1QF8A 1JJ2Y 3CCRZ 2OZKA 3KIFA 1XHJA 3BG1B 4A93I 3KXWA 4B3MC 1K83I 4FTFA 1X3WA 4D57A 1TWCI 1R9TI 2HU9A 3IR7A 3L8CA 2OOYB 4HGYA 3CCE1 1VQPZ 1KD12 1VQLZ 3CMEZ 1L1OC 1JJ2Z 4RVDA 3CQ1A 3OTOC 3PO3S 4DV3C 3GTMI 2QLVB 1KQSY 1I3QI 3GKUA 2Y4OA 4NBGA 4R1MA 5A19A 5KEIA 4DR3C 1USPA 2E8EA 1V26A 1IBKC 1KQSZ 2M5OA 1QVFZ 3LNOA 1JOSA 1P7LA 2YWCA 1ZB8A 2Q51A 2W03A 4NBHA 1W2BY 1VQ5Z 3PESA 3VNSA 1Q7Y1 1NYEA 3UX2A 4D56A 2YU9I 3J81f 3VNRA 4JI6C 1ZH1A 4PROC 3I561 2RHBA 1QM4A 1VQ9Z 3I07A 3CC4Z 2M5HA 3I551 2QA41 5LL6f 2M6NA 3VMGA 2V8JA 4U5YD 4MD8A 1XNRC 1O90A 3CCUZ 4NBCA 4Y52I 5JRHA 1K9M1 4CL1A 3TE5B 4R1LA 3G711 4RVNA 4WV3A 3CMA1 3A25A 4PHTA 1L2FA 1RY2A 2JNYA 3HOVI 3H0GI 4NBAA 3SO4A 3CJEA 2JA6I 4E33A 1MDFA 2D7VA 3O2EA 3H3VJ 3BG0B 1K731 1YJ7A 1WZNA 1J5EC 4E2WA 3J80f 2RPRA 4MONA 1FUGA 1RNIA 2JR6A 4LF7C 1WJ2A 4JM1A 1Q822 2XR1A 3CQZI 1HNXC 1X0TA 1M901 1KKGA 4GXRA 3GTKI 5DV9A 4DR4C 3T1HC 4HH4A 1P9NA 2NAPA 1T5HX 4OXIA 5E7QA 2F4VC 3CC71 3A9VA 1VQ7Z 3HKZA 2E2JI 2OO4A 1YIJZ 3HOWI 1LCIA 5IP7I 3N54B 3CME1 3CPWZ 2OTJZ 4KTTA 1S721 5FLXD 4LF5C 1XMOC 5C3EI 2D1SA 2QEXZ 3CCQ1 2QL8A 1RO0A 2WP0C 3K6RA 4NXNC 4NDNA 1ZB9A 4A3DI 2HHHC 2IV2X 1Q811 4IR7A 5IWAC 4DV6C 4D4GA 5BSVA 1VQ71 3M4OI 3FQQA 3S1NI 3I4MI 3NH5A 4E31A 3FCCA 4GKJC 1IB8A 3S16I 2D1RA 5K8FA 3U50C 2R6MA 2OPLB 5D1PA 3GKQA 2OTLZ 2DYJA 1VQK1 1MDBA 4A3BI 4DCVA 3S1QI 5LMUC 2LEXA 1T5DX 1XRCA 2JIRA 2VZEA 1PA4A 1VQM1 1VQ51 4HPVA 3RV2A 1M6XA 4X64C 4RVFA 3CCJ1 3CXCY 5H9UA 3CCU1 4MXUA 2JMPA 4DV5C 1Q7Y2 1RG9A 4NBFA 2O4HA 3J81b 3KIHA 1TFIA 3CC41 4DUZC 2H85A 5D1OB 3ETOA 4NBBA 3IF8A 3UOWA 3LUSA 1VQKZ 2D1QA 5GTDA 2IZ3A 2E8FA 4DCSA 2UXDC 2PMZA 2DE5A 3JAMf 3CCVZ 4LF9C 5AE1A 3AF6A 4E32A 5C4JI 2CY1A 2UUCC 4B3RC 5AN9F 5A1IA 5CZXA 2IZ4A 4G36A 2QREB 1O92A 4K0BA 2YCBA 4BBYA 5IT9f 4BCAA 3MZLB 1N8R2 2PROA 4BXXI 4DR1C 4A3CI 4LE5A 4X62C 4DR7C 4EWCA 3HOXI 4LFCC 2WB1A 4A3GI 2PM9A 2JA5I 3PO2I 1P4EC 3AF5A 2ONFA 1Q861 2MM9A 5CM2M 3DLPX 4DR2C 1FLOA 3G4SZ 3GPCA 1YUKA 5AE3A 3IX0A 3OW2Y 3FKII 2D27A 1SIWA 2PN2A 1O9TA 5AE2A 4OYCA 2OTJ1 2V45A 4KTVA 4LF8C 3CC7Z 4NBEA 4BBSI 1LQLA 2Y27A 4JI3C 1NY8A 1Q812 3HOUI 2E7GA 3IEUA 4I9GA 3CQ3A 4L7IA 4LFBC 1RO2A 1Q16A 2VPWA 4L2ZA 1M1K1 2KZFA 5BR8C 4BY1I 4MD7A 4R0MA 1KRLA 4DR6C 1NP6A 1VQ91 3RZOI 3NFZA 2UXBC 4RLQA 1Y1WI 5C4XI 3QWUA 3UX3A 1Z03A 3S82A 3CMAZ 3A9UA 2F4MA 2I3CA 1YI21 4LF4C 5LMNC 1XMQC 1YJW1 4DV2C 1VQOZ 2RBLA 3GR1A 4A3FI 3EEDA 5FLXf 1TH5A 3I4NI 4I9FA 2Z51A 2QR1B 2VQFC 2KPIA 1I94C 4BC7A 4NOZA 3VB9A 1VQMZ 1IBLC 3F3PC 4QTUA 3G7SA 5LCIA 4JI0C 4E30A 1QXFA 5C44I 2UUBC 3TQIA 2K3RA 3PBKA 3MZKB 4JI4C 4ZJZA 4JI7C 1NJI1 1AMUA 2V8IA 4QTTA 4TPSB 2DE6A 1VQO1 3L95X 1N32C 1RQFA 4GXQA 1XS3A 5BUSA 1TWHI 2M48A 4TNUA 2ASBA 2BJOA 2JIMA 3TUFA 3TR3A 1YHQ1 3S15I 3I56Z 1K8A1 2E0GA 3UEBA 3GTJI 2YX1A 3NYQA 3Q87A 4BC9A 3GTLI 2DPLA 4RVHA 3NDJA 2VF1A 4PUGA 4JYAC 3NYRA 4NFRA 2UXCC 1HNWC 1N34C 1KC81 1VQN1 2NCLA 2YWBA 3IEVA 3S2DI 2BH1X 2GTIA 3E7XA 5BSMA 5BSUA 2ZZNA 3CD6Z 3G6EZ 1VQ81 3T4NB 1K0RA 1QVGZ 2VPZA 2E7ZA 2ZAEB 4D4IA 3GTGI 1WH9A 1YJN1 1YHQZ 2R92I 2KZ0A 1K9M2 1RO4A 5FLMI 3CW8X 2QRDB 2JIQA 3FQMA 3CCLZ 3EERA 4DV0C 3R9XA 3TDHB 3LAXA 2G2KA 2ATWA 1I6HI 1EGAA 1N33C 3M3YI 1VQ4Z 1IBMC 2P02A 5CZVA 1SFOI 3NPDA 4G1IA 3G71Z 3TDEA 3J81D 1HNZC 5T6BA 3B7WA 3CCJZ 1XRBA 4JI5C 3NI2A 1Q821 2CXCA 3J80b 1VQNZ 2HJGA 3IPLA 4YY3C 4LF6C 2Q4ZA 2AYAA 1QYPA 3CQ2A 3HOYI 2DHMA 4NBDA 3I08A 3R44A 3JAMD 4S1TA 4LFAC 4RMNA 5BUQA 1WW9A 4B3SC 1QVGY 5D1OA 4ZLPA 2EGTA 1VLAA 1M6XC 4NXMC 4MH4A 4DCTA 2O53A 3CCL1 5IT9b 4ODJA 4OX9C 1MKYA 5BSTA 4X65C 2NVTI 2J6AA 5T8TA 3EQ6A 5BURA 4DK1A 4K0KC 4KHPC 4WS9A 2LFUA 1UWDA 4JI2C 1YIJ1 2PK7A 4RVGA 5T64A 4NH1C 1QVFY 4PUHA 4DQYB 2HF1A 1N2FA 1Y1VS 4PUIA 4JI8C 2GU2A 4A3II 3CCSZ 1ML8A 1KD11 1QWIA 5KYTA 2Y0SA 3GTOI 2CU6A 3I55Z 4YHHC 3S17I 2P2BA 4L4QA 3N2QA 1PFTA 4RM2A 1Y8CA 4FUQA 1VQP1 2B63I 1MD9A 4RM3A 2VUGA 4AYBA 1XRAA 4X66C 5A2QD 4DCUA 3S1RI 4E2ZA 3GTPI 4DGLA 1YJ9Z 1USPB 1K8A2 1VQL1 3G4S1 3LGXA 4GS5A 2V3VA 1MXAA 1Y1VI 2LIYA 3CCS1 3HOZI 2VQEC 4DV7C 4GKKC 4JV5C 2JUBA 4XX2A 3GR0A 1Z01A 2PT7G 4G37A 2JIOA 4BY7I 1PG4A 3CW9A 3NDIA 4Y7NI 3VTNA 2NVYI 3G6E1 2WAQA 3T1YC 2QVZX 2DE7A 1FJGC 3PROC 1YUAA 2P28A 5KYVA 2JA8I 3J80D 1VQ61 1BA3A 1WCJA 1N8R1 5A2Qf 3H2TA 4MD9A 3CC2Z 1UKKA 2P20A 4MTNA 2NVXI 2MMAB 3CCV1 2NVQI 2V8KA 1WCMI 5A1GA 2P2JA 1X3ZA 1FDOA 1RLYA 5ADZA 2YADA 4NB9A 4A3LI 1Q862 3CCMZ 2QEX1 3CCQZ 2QA4Z 1AA6A 3PO3I 1PG3A 1M1K2 4E2YA 1P4EA 3CCR1 1JWHC 2F4OA 2P2FA 2QVYX 3R9WA 1ULTA 3CC21 2V7BA 3J7A4 2K5RA 2AKLA 4A3EI 2JIPA 2KI7B 2QKDA 4A3MI 1VQ6Z 3IFUA 3S2HI 2Y4NA 1HR0C 4BBRI 3FCEA 3K7AI 3JAMb 5BSWA 2VPYA 3RG2A 5K85A 1W2BZ 4ISBA 2E2HI 2QVXX 1NUIA 3OW2Z 3GTQI 3MONA 1YIT1 4NB8A 1TWGI 2VUMI 5IT9D 1MXCA 1PU1A 3CPWY 3CD61 2D28C 4AQYC 2UU9C 4DG9A 2JMOA 3VMHA 3ESWA 1VQ8Z 1XNQC 3D6WA 1TWFI 4RV9A 1S72Z 4A3JI 3E7WA 1NJI2 2E9HA 1KC82 1YI2Z 2R7ZI 1TWAI 3LNVA 5IP9I 3CXCZ 4HGZA 2E8CA 1YITZ 2P2QA 3DAYA 4JI1C 2P3YA 1O93A 5IFIA 1N36C 2GTHA 5T67A 3RZDI 3A26A 2VSQA 2OOXB 4RS4A 1MXBA 4EATA 3GCFA 1YJWZ 2OPLA 4PZPA 4DUYC 1I50I 2W04A 5FLXb 1FDIA 3F3FC 1K732 2E2II 2E5LC 3IMLA 2MCQA 3ETCA 4X6AI 4RLFA 3S14I 2P2MA 2RIQA 1HH2P 3NH8A 2ZM6C 4E2XA 1WF3A 2UUAC 4B3TC 2ZZMA 3D2LA 1GPMA 2D1TA 2OTL1 4IZ6A 1M902
chains in the Genus database with same CATH topology
3NH4A 2QW0X 1V25A 2JA7I 4MRIA 1S7MA 1DL6A 3C5EA 3D9XA 4RVOA 5T8SA 4DR5C 2WD9A 4DV1C 3CCEZ 3S1MI 3VMIA 4DV4C 2R93I 5BSRA 4BSZA 1VQ41 3P5JB 2OBVA 3CCM1 2RT9A 2QRCB 5A2Qb 2JS4A 3DHVA 1Z02A 3UZ0A 3GTMS 4DG8A 1WIIA 1YJ91 1YJNZ 4FUTA 4A3KI 3A4IA 3VNQA 1QF8A 1JJ2Y 3CCRZ 2OZKA 3KIFA 3BG1B 4A93I 3KXWA 4B3MC 1K83I 4FTFA 1X3WA 4D57A 1TWCI 1R9TI 2HU9A 3L8CA 2OOYB 4HGYA 3CCE1 1VQPZ 1KD12 1VQLZ 3CMEZ 1L1OC 1JJ2Z 4RVDA 3OTOC 3PO3S 4DV3C 3GTMI 2QLVB 1KQSY 1I3QI 3GKUA 2Y4OA 4NBGA 4R1MA 5A19A 5KEIA 4DR3C 1USPA 2E8EA 1V26A 1IBKC 1KQSZ 1QVFZ 1JOSA 1P7LA 2YWCA 1ZB8A 2Q51A 2W03A 4NBHA 1W2BY 1VQ5Z 3PESA 3VNSA 1Q7Y1 1NYEA 4D56A 2YU9I 3J81f 3VNRA 4JI6C 1ZH1A 4PROC 3I561 2RHBA 1QM4A 1VQ9Z 3I07A 3CC4Z 3I551 2QA41 5LL6f 2M6NA 3VMGA 2V8JA 4U5YD 4MD8A 1XNRC 1O90A 3CCUZ 4NBCA 4Y52I 5JRHA 1K9M1 4CL1A 3TE5B 4R1LA 3G711 4RVNA 4WV3A 3CMA1 4PHTA 1L2FA 1RY2A 2JNYA 3HOVI 3H0GI 4NBAA 3SO4A 3CJEA 2JA6I 4E33A 1MDFA 2D7VA 3H3VJ 3BG0B 1K731 1YJ7A 1J5EC 4E2WA 3J80f 2RPRA 4MONA 1FUGA 1RNIA 2JR6A 4LF7C 4JM1A 1Q822 2XR1A 3CQZI 1HNXC 1X0TA 1M901 1KKGA 4GXRA 3GTKI 5DV9A 4DR4C 3T1HC 4HH4A 1P9NA 4OXIA 1T5HX 5E7QA 2F4VC 3CC71 3A9VA 1VQ7Z 3HKZA 2E2JI 2OO4A 1YIJZ 3HOWI 1LCIA 5IP7I 3N54B 3CME1 3CPWZ 2OTJZ 4KTTA 1S721 5FLXD 4LF5C 1XMOC 5C3EI 2D1SA 2QEXZ 3CCQ1 2QL8A 1RO0A 2WP0C 4NXNC 4NDNA 1ZB9A 4A3DI 2HHHC 1Q811 4IR7A 5IWAC 4DV6C 4D4GA 5BSVA 1VQ71 3M4OI 3FQQA 3S1NI 3I4MI 3NH5A 4E31A 3FCCA 4GKJC 3S16I 2D1RA 5K8FA 3U50C 2R6MA 2OPLB 5D1PA 3GKQA 2OTLZ 2DYJA 1VQK1 1MDBA 4A3BI 4DCVA 3S1QI 5LMUC 1T5DX 1XRCA 2VZEA 1PA4A 1VQM1 1VQ51 4HPVA 3RV2A 4X64C 4RVFA 3CCJ1 3CXCY 5H9UA 3CCU1 4MXUA 2JMPA 4DV5C 1Q7Y2 1RG9A 4NBFA 2O4HA 3J81b 3KIHA 1TFIA 3CC41 4DUZC 2H85A 5D1OB 3ETOA 4NBBA 3IF8A 3UOWA 3LUSA 1VQKZ 2D1QA 5GTDA 2IZ3A 2E8FA 4DCSA 2UXDC 2PMZA 2DE5A 3JAMf 3CCVZ 4LF9C 5AE1A 3AF6A 4E32A 5C4JI 2CY1A 2UUCC 4B3RC 5AN9F 5A1IA 5CZXA 2IZ4A 4G36A 2QREB 1O92A 4K0BA 2YCBA 4BBYA 5IT9f 4BCAA 3MZLB 1N8R2 2PROA 4BXXI 4DR1C 4A3CI 4LE5A 4X62C 4DR7C 4EWCA 3HOXI 4LFCC 2WB1A 4A3GI 2PM9A 2JA5I 3PO2I 3AF5A 2ONFA 1Q861 3DLPX 5CM2M 4DR2C 3G4SZ 3GPCA 1YUKA 5AE3A 3IX0A 3OW2Y 3FKII 2D27A 2PN2A 1O9TA 5AE2A 4OYCA 2OTJ1 4LF8C 4KTVA 3CC7Z 4NBEA 4BBSI 1LQLA 2Y27A 4JI3C 1Q812 3HOUI 2E7GA 3IEUA 4I9GA 4L7IA 4LFBC 1RO2A 4L2ZA 1M1K1 2KZFA 5BR8C 4BY1I 4MD7A 4R0MA 1KRLA 4DR6C 1NP6A 1VQ91 3RZOI 3NFZA 2UXBC 4RLQA 1Y1WI 5C4XI 3QWUA 1Z03A 3S82A 3CMAZ 3A9UA 2F4MA 2I3CA 1YI21 4LF4C 5LMNC 1XMQC 1YJW1 4DV2C 1VQOZ 2RBLA 3GR1A 4A3FI 3EEDA 5FLXf 3I4NI 4I9FA 2QR1B 2VQFC 2KPIA 1I94C 4BC7A 4NOZA 3VB9A 1VQMZ 1IBLC 3F3PC 4QTUA 3G7SA 4JI0C 2UUBC 4E30A 5C44I 3TQIA 2K3RA 3PBKA 3MZKB 4JI4C 4ZJZA 4JI7C 1NJI1 1AMUA 2V8IA 4QTTA 4TPSB 2DE6A 1VQO1 3L95X 1N32C 1RQFA 4GXQA 5BUSA 2ASBA 2M48A 1TWHI 4TNUA 2BJOA 3TUFA 1YHQ1 3S15I 3I56Z 1K8A1 2E0GA 3GTJI 3NYQA 3Q87A 4BC9A 3GTLI 2DPLA 4RVHA 3NDJA 2VF1A 4JYAC 3NYRA 4NFRA 2UXCC 1HNWC 1N34C 1KC81 1VQN1 2YWBA 3IEVA 3S2DI 2BH1X 2GTIA 3E7XA 5BSMA 5BSUA 3CD6Z 3G6EZ 1VQ81 3T4NB 1K0RA 1QVGZ 2ZAEB 4D4IA 3GTGI 1WH9A 1YJN1 1YHQZ 2R92I 1K9M2 1RO4A 5FLMI 3CW8X 2QRDB 3FQMA 3CCLZ 3EERA 4DV0C 3R9XA 3TDHB 3LAXA 2G2KA 2ATWA 1I6HI 1EGAA 1N33C 3M3YI 1VQ4Z 1IBMC 2P02A 5CZVA 1SFOI 3NPDA 4G1IA 3G71Z 3TDEA 3J81D 1HNZC 5T6BA 3B7WA 3CCJZ 1XRBA 4JI5C 3NI2A 1Q821 2CXCA 3J80b 1VQNZ 2HJGA 3IPLA 4YY3C 4LF6C 2Q4ZA 2AYAA 1QYPA 3HOYI 4NBDA 3I08A 3R44A 3JAMD 4S1TA 4LFAC 4RMNA 5BUQA 1WW9A 4B3SC 1QVGY 5D1OA 4ZLPA 2EGTA 1VLAA 4NXMC 4MH4A 4DCTA 2O53A 3CCL1 5IT9b 4ODJA 4OX9C 1MKYA 5BSTA 4X65C 2NVTI 2J6AA 5T8TA 3EQ6A 5BURA 4DK1A 4K0KC 4KHPC 4WS9A 2LFUA 4JI2C 1YIJ1 2PK7A 4RVGA 5T64A 4NH1C 1QVFY 4DQYB 2HF1A 1N2FA 1Y1VS 4JI8C 2GU2A 4A3II 3CCSZ 1ML8A 1KD11 1QWIA 5KYTA 2Y0SA 3GTOI 3I55Z 4YHHC 3S17I 2P2BA 4L4QA 3N2QA 1PFTA 4RM2A 4FUQA 1VQP1 2B63I 1MD9A 4RM3A 2VUGA 4AYBA 1XRAA 4X66C 5A2QD 4DCUA 3S1RI 4E2ZA 3GTPI 4DGLA 1YJ9Z 1USPB 1K8A2 1VQL1 3G4S1 3LGXA 4GS5A 1MXAA 1Y1VI 2LIYA 3CCS1 3HOZI 2VQEC 4DV7C 4GKKC 4JV5C 2JUBA 4XX2A 3GR0A 1Z01A 2PT7G 4G37A 4BY7I 1PG4A 3CW9A 3NDIA 4Y7NI 3VTNA 2NVYI 3G6E1 2WAQA 3T1YC 2QVZX 2DE7A 1FJGC 3PROC 1YUAA 2P28A 5KYVA 2JA8I 3J80D 1VQ61 1BA3A 1N8R1 5A2Qf 3H2TA 4MD9A 3CC2Z 1UKKA 2P20A 4MTNA 2NVXI 3CCV1 2NVQI 2V8KA 1WCMI 5A1GA 2P2JA 1X3ZA 1RLYA 5ADZA 2YADA 4NB9A 4A3LI 1Q862 3CCMZ 2QEX1 3CCQZ 2QA4Z 1PG3A 3PO3I 1M1K2 4E2YA 3CCR1 1JWHC 2F4OA 2P2FA 2QVYX 3R9WA 1ULTA 3CC21 2V7BA 3J7A4 2K5RA 2AKLA 4A3EI 4A3MI 2KI7B 2QKDA 1VQ6Z 3IFUA 3S2HI 2Y4NA 1HR0C 4BBRI 3FCEA 3K7AI 3JAMb 5BSWA 3RG2A 5K85A 1W2BZ 4ISBA 2E2HI 2QVXX 1NUIA 3OW2Z 3GTQI 3MONA 1YIT1 4NB8A 1TWGI 2VUMI 5IT9D 1MXCA 2D28C 3CPWY 3CD61 4AQYC 2UU9C 4DG9A 2JMOA 3VMHA 3ESWA 1VQ8Z 1XNQC 3D6WA 1TWFI 4RV9A 1S72Z 4A3JI 3E7WA 1NJI2 2E9HA 1KC82 1YI2Z 2R7ZI 1TWAI 3LNVA 5IP9I 3CXCZ 4HGZA 2E8CA 1YITZ 2P2QA 3DAYA 4JI1C 2P3YA 1O93A 5IFIA 1N36C 2GTHA 5T67A 3RZDI 2VSQA 2OOXB 4RS4A 1MXBA 4EATA 3GCFA 1YJWZ 2OPLA 4PZPA 4DUYC 1I50I 2W04A 5FLXb 3F3FC 1K732 2E2II 2E5LC 3IMLA 3ETCA 4X6AI 4RLFA 3S14I 2P2MA 2RIQA 1HH2P 3NH8A 2ZM6C 4E2XA 1WF3A 2UUAC 4B3TC 1GPMA 2D1TA 2OTL1 4IZ6A 1M902
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 C;  5A2Q D;  4DCU A;  5FLX D;  1USP B;  1XMO C;  4LF5 C;  2QL8 A;  4NXN C;  2VQF C;  2VQE C;  1I94 C;  4NOZ A;  4DV7 C;  1ZB9 A;  4DR5 C;  1IBL C;  4GKK C;  4JI0 C;  2UUB C;  2HHH C;  4DV6 C;  5IWA C;  4JV5 C;  4DV1 C;  4XX2 A;  4JI4 C;  2PT7 G;  4JI7 C;  4DV4 C;  4BSZ A;  4GKJ C;  1N32 C;  2ASB A;  2BJO A;  2OPL B;  3T1Y C;  2DYJ A;  1FJG C;  4DCV A;  5LMU C;  3J80 D;  1UKK A;  4B3M C;  4MTN A;  4JYA C;  1PA4 A;  2UXC C;  1HNW C;  1N34 C;  4X64 C;  3IEV A;  4DV5 C;  2JMP A;  1K0R A;  3OTO C;  1WH9 A;  4DV3 C;  4DUZ C;  3GKU A;  4DR3 C;  3LUS A;  3R9W A;  1USP A;  4DV0 C;  3EER A;  2E8F A;  2E8E A;  4DCS A;  3R9X A;  2UXD C;  2ATW A;  1IBK C;  4LF9 C;  1EGA A;  1N33 C;  1IBM C;  3AF6 A;  1JOS A;  1HR0 C;  1ZB8 A;  3J81 D;  1NYE A;  2CY1 A;  1HNZ C;  2UUC C;  4B3R C;  4JI6 C;  4JI5 C;  3I07 A;  2CXC A;  2YCB A;  2HJG A;  5IT9 D;  4YY3 C;  4DR1 C;  2E5L C;  4X62 C;  4DR7 C;  4LFC C;  4AQY C;  4LF6 C;  2UU9 C;  1XNR C;  1XNQ C;  3JAM D;  3AF5 A;  2ONF A;  4DR2 C;  4LFA C;  2PN2 A;  4B3S C;  1L2F A;  2EGT A;  1VLA A;  4LF8 C;  4NXM C;  1LQL A;  4MH4 A;  4DCT A;  4OX9 C;  2E8C A;  4JI3 C;  1MKY A;  3CJE A;  2E7G A;  1N36 C;  4X65 C;  4JI1 C;  2D7V A;  3IEU A;  4K0K C;  4KHP C;  4LFB C;  2KZF A;  4JI2 C;  5BR8 C;  2OPL A;  1J5E C;  4DUY C;  4DR6 C;  2UXB C;  1N2F A;  4JI8 C;  4LF7 C;  1ML8 A;  2XR1 A;  1HNX C;  1QWI A;  1KKG A;  4DR4 C;  4YHH C;  3T1H C;  1HH2 P;  4LF4 C;  2ZM6 C;  5LMN C;  2F4V C;  1XMQ C;  1WF3 A;  2UUA C;  4B3T C;  4DV2 C; 
#chains in the Genus database with same CATH topology
 3NH4 A;  2QW0 X;  1V25 A;  2JA7 I;  4MRI A;  1S7M A;  1VEH A;  1DL6 A;  3C5E A;  3D9X A;  2KDN A;  4RVO A;  2AYD A;  5T8S A;  4DR5 C;  2WD9 A;  4DV1 C;  3CCE Z;  2VPX A;  3VMI A;  3S1M I;  4DV4 C;  2R93 I;  5BSR A;  4BSZ A;  1VQ4 1;  3P5J B;  2OBV A;  3CCM 1;  2JNV A;  3AY0 A;  2RT9 A;  2QRC B;  5A2Q b;  1V60 A;  2JS4 A;  3DHV A;  1Z02 A;  3UZ0 A;  3GTM S;  4DG8 A;  1WII A;  1YJ9 1;  1YJN Z;  4FUT A;  4A3K I;  3A4I A;  3VNQ A;  1QF8 A;  1JJ2 Y;  3CCR Z;  2OZK A;  3KIF A;  1XHJ A;  3BG1 B;  4A93 I;  3KXW A;  4B3M C;  1K83 I;  4FTF A;  1X3W A;  4D57 A;  1TWC I;  1R9T I;  2HU9 A;  3IR7 A;  3L8C A;  2OOY B;  4HGY A;  3CCE 1;  1VQP Z;  1KD1 2;  1VQL Z;  3CME Z;  1L1O C;  1JJ2 Z;  4RVD A;  3CQ1 A;  3OTO C;  3PO3 S;  4DV3 C;  3GTM I;  2QLV B;  1KQS Y;  1I3Q I;  3GKU A;  2Y4O A;  4NBG A;  4R1M A;  5A19 A;  5KEI A;  4DR3 C;  1USP A;  2E8E A;  1V26 A;  1IBK C;  1KQS Z;  2M5O A;  1QVF Z;  3LNO A;  1JOS A;  1P7L A;  2YWC A;  1ZB8 A;  2Q51 A;  2W03 A;  4NBH A;  1W2B Y;  1VQ5 Z;  3PES A;  3VNS A;  1Q7Y 1;  1NYE A;  3UX2 A;  4D56 A;  2YU9 I;  3J81 f;  3VNR A;  4JI6 C;  1ZH1 A;  4PRO C;  3I56 1;  2RHB A;  1QM4 A;  1VQ9 Z;  3I07 A;  3CC4 Z;  2M5H A;  3I55 1;  2QA4 1;  5LL6 f;  2M6N A;  3VMG A;  2V8J A;  4U5Y D;  4MD8 A;  1XNR C;  1O90 A;  3CCU Z;  4NBC A;  4Y52 I;  5JRH A;  1K9M 1;  4CL1 A;  3TE5 B;  4R1L A;  3G71 1;  4RVN A;  4WV3 A;  3CMA 1;  3A25 A;  4PHT A;  1L2F A;  1RY2 A;  2JNY A;  3HOV I;  3H0G I;  4NBA A;  3SO4 A;  3CJE A;  2JA6 I;  4E33 A;  1MDF A;  2D7V A;  3O2E A;  3H3V J;  3BG0 B;  1K73 1;  1YJ7 A;  1WZN A;  1J5E C;  4E2W A;  3J80 f;  2RPR A;  4MON A;  1FUG A;  1RNI A;  2JR6 A;  4LF7 C;  1WJ2 A;  4JM1 A;  1Q82 2;  2XR1 A;  3CQZ I;  1HNX C;  1X0T A;  1M90 1;  1KKG A;  4GXR A;  3GTK I;  5DV9 A;  4DR4 C;  3T1H C;  4HH4 A;  1P9N A;  2NAP A;  1T5H X;  4OXI A;  5E7Q A;  2F4V C;  3CC7 1;  3A9V A;  1VQ7 Z;  3HKZ A;  2E2J I;  2OO4 A;  1YIJ Z;  3HOW I;  1LCI A;  5IP7 I;  3N54 B;  3CME 1;  3CPW Z;  2OTJ Z;  4KTT A;  1S72 1;  5FLX D;  4LF5 C;  1XMO C;  5C3E I;  2D1S A;  2QEX Z;  3CCQ 1;  2QL8 A;  1RO0 A;  2WP0 C;  3K6R A;  4NXN C;  4NDN A;  1ZB9 A;  4A3D I;  2HHH C;  2IV2 X;  1Q81 1;  4IR7 A;  5IWA C;  4DV6 C;  4D4G A;  5BSV A;  1VQ7 1;  3M4O I;  3FQQ A;  3S1N I;  3I4M I;  3NH5 A;  4E31 A;  3FCC A;  4GKJ C;  1IB8 A;  3S16 I;  2D1R A;  5K8F A;  3U50 C;  2R6M A;  2OPL B;  5D1P A;  3GKQ A;  2OTL Z;  2DYJ A;  1VQK 1;  1MDB A;  4A3B I;  4DCV A;  3S1Q I;  5LMU C;  2LEX A;  1T5D X;  1XRC A;  2JIR A;  2VZE A;  1PA4 A;  1VQM 1;  1VQ5 1;  4HPV A;  3RV2 A;  1M6X A;  4X64 C;  4RVF A;  3CCJ 1;  3CXC Y;  5H9U A;  3CCU 1;  4MXU A;  2JMP A;  4DV5 C;  1Q7Y 2;  1RG9 A;  4NBF A;  2O4H A;  3J81 b;  3KIH A;  1TFI A;  3CC4 1;  4DUZ C;  2H85 A;  5D1O B;  3ETO A;  4NBB A;  3IF8 A;  3UOW A;  3LUS A;  1VQK Z;  2D1Q A;  5GTD A;  2IZ3 A;  2E8F A;  4DCS A;  2UXD C;  2PMZ A;  2DE5 A;  3JAM f;  3CCV Z;  4LF9 C;  5AE1 A;  3AF6 A;  4E32 A;  5C4J I;  2CY1 A;  2UUC C;  4B3R C;  5AN9 F;  5A1I A;  5CZX A;  2IZ4 A;  4G36 A;  2QRE B;  1O92 A;  4K0B A;  2YCB A;  4BBY A;  5IT9 f;  4BCA A;  3MZL B;  1N8R 2;  2PRO A;  4BXX I;  4DR1 C;  4A3C I;  4LE5 A;  4X62 C;  4DR7 C;  4EWC A;  3HOX I;  4LFC C;  2WB1 A;  4A3G I;  2PM9 A;  2JA5 I;  3PO2 I;  1P4E C;  3AF5 A;  2ONF A;  1Q86 1;  2MM9 A;  5CM2 M;  3DLP X;  4DR2 C;  1FLO A;  3G4S Z;  3GPC A;  1YUK A;  5AE3 A;  3IX0 A;  3OW2 Y;  3FKI I;  2D27 A;  1SIW A;  2PN2 A;  1O9T A;  5AE2 A;  4OYC A;  2OTJ 1;  2V45 A;  4KTV A;  4LF8 C;  3CC7 Z;  4NBE A;  4BBS I;  1LQL A;  2Y27 A;  4JI3 C;  1NY8 A;  1Q81 2;  3HOU I;  2E7G A;  3IEU A;  4I9G A;  3CQ3 A;  4L7I A;  4LFB C;  1RO2 A;  1Q16 A;  2VPW A;  4L2Z A;  1M1K 1;  2KZF A;  5BR8 C;  4BY1 I;  4MD7 A;  4R0M A;  1KRL A;  4DR6 C;  1NP6 A;  1VQ9 1;  3RZO I;  3NFZ A;  2UXB C;  4RLQ A;  1Y1W I;  5C4X I;  3QWU A;  3UX3 A;  1Z03 A;  3S82 A;  3CMA Z;  3A9U A;  2F4M A;  2I3C A;  1YI2 1;  4LF4 C;  5LMN C;  1XMQ C;  1YJW 1;  4DV2 C;  1VQO Z;  2RBL A;  3GR1 A;  4A3F I;  3EED A;  5FLX f;  1TH5 A;  3I4N I;  4I9F A;  2Z51 A;  2QR1 B;  2VQF C;  2KPI A;  1I94 C;  4BC7 A;  4NOZ A;  3VB9 A;  1VQM Z;  1IBL C;  3F3P C;  4QTU A;  3G7S A;  5LCI A;  4JI0 C;  4E30 A;  1QXF A;  5C44 I;  2UUB C;  3TQI A;  2K3R A;  3PBK A;  3MZK B;  4JI4 C;  4ZJZ A;  4JI7 C;  1NJI 1;  1AMU A;  2V8I A;  4QTT A;  4TPS B;  2DE6 A;  1VQO 1;  3L95 X;  1N32 C;  1RQF A;  4GXQ A;  1XS3 A;  5BUS A;  1TWH I;  2M48 A;  4TNU A;  2ASB A;  2BJO A;  2JIM A;  3TUF A;  3TR3 A;  1YHQ 1;  3S15 I;  3I56 Z;  1K8A 1;  2E0G A;  3UEB A;  3GTJ I;  2YX1 A;  3NYQ A;  3Q87 A;  4BC9 A;  3GTL I;  2DPL A;  4RVH A;  3NDJ A;  2VF1 A;  4PUG A;  4JYA C;  3NYR A;  4NFR A;  2UXC C;  1HNW C;  1N34 C;  1KC8 1;  1VQN 1;  2NCL A;  2YWB A;  3IEV A;  3S2D I;  2BH1 X;  2GTI A;  3E7X A;  5BSM A;  5BSU A;  2ZZN A;  3CD6 Z;  3G6E Z;  1VQ8 1;  3T4N B;  1K0R A;  1QVG Z;  2VPZ A;  2E7Z A;  2ZAE B;  4D4I A;  3GTG I;  1WH9 A;  1YJN 1;  1YHQ Z;  2R92 I;  2KZ0 A;  1K9M 2;  1RO4 A;  5FLM I;  3CW8 X;  2QRD B;  2JIQ A;  3FQM A;  3CCL Z;  3EER A;  4DV0 C;  3R9X A;  3TDH B;  3LAX A;  2G2K A;  2ATW A;  1I6H I;  1EGA A;  1N33 C;  3M3Y I;  1VQ4 Z;  1IBM C;  2P02 A;  5CZV A;  1SFO I;  3NPD A;  4G1I A;  3G71 Z;  3TDE A;  3J81 D;  1HNZ C;  5T6B A;  3B7W A;  3CCJ Z;  1XRB A;  4JI5 C;  3NI2 A;  1Q82 1;  2CXC A;  3J80 b;  1VQN Z;  2HJG A;  3IPL A;  4YY3 C;  4LF6 C;  2Q4Z A;  2AYA A;  1QYP A;  3CQ2 A;  3HOY I;  2DHM A;  4NBD A;  3I08 A;  3R44 A;  3JAM D;  4S1T A;  4LFA C;  4RMN A;  5BUQ A;  1WW9 A;  4B3S C;  1QVG Y;  5D1O A;  4ZLP A;  2EGT A;  1VLA A;  1M6X C;  4NXM C;  4MH4 A;  4DCT A;  2O53 A;  3CCL 1;  5IT9 b;  4ODJ A;  4OX9 C;  1MKY A;  5BST A;  4X65 C;  2NVT I;  2J6A A;  5T8T A;  3EQ6 A;  5BUR A;  4DK1 A;  4K0K C;  4KHP C;  4WS9 A;  2LFU A;  1UWD A;  4JI2 C;  1YIJ 1;  2PK7 A;  4RVG A;  5T64 A;  4NH1 C;  1QVF Y;  4PUH A;  4DQY B;  2HF1 A;  1N2F A;  1Y1V S;  4PUI A;  4JI8 C;  2GU2 A;  4A3I I;  3CCS Z;  1ML8 A;  1KD1 1;  1QWI A;  5KYT A;  2Y0S A;  3GTO I;  2CU6 A;  3I55 Z;  4YHH C;  3S17 I;  2P2B A;  4L4Q A;  3N2Q A;  1PFT A;  4RM2 A;  1Y8C A;  4FUQ A;  1VQP 1;  2B63 I;  1MD9 A;  4RM3 A;  2VUG A;  4AYB A;  1XRA A;  4X66 C;  5A2Q D;  4DCU A;  3S1R I;  4E2Z A;  3GTP I;  4DGL A;  1YJ9 Z;  1USP B;  1K8A 2;  1VQL 1;  3G4S 1;  3LGX A;  4GS5 A;  2V3V A;  1MXA A;  1Y1V I;  2LIY A;  3CCS 1;  3HOZ I;  2VQE C;  4DV7 C;  4GKK C;  4JV5 C;  2JUB A;  4XX2 A;  3GR0 A;  1Z01 A;  2PT7 G;  4G37 A;  2JIO A;  4BY7 I;  1PG4 A;  3CW9 A;  3NDI A;  4Y7N I;  3VTN A;  2NVY I;  3G6E 1;  2WAQ A;  3T1Y C;  2QVZ X;  2DE7 A;  1FJG C;  3PRO C;  1YUA A;  2P28 A;  5KYV A;  2JA8 I;  3J80 D;  1VQ6 1;  1BA3 A;  1WCJ A;  1N8R 1;  5A2Q f;  3H2T A;  4MD9 A;  3CC2 Z;  1UKK A;  2P20 A;  4MTN A;  2NVX I;  2MMA B;  3CCV 1;  2NVQ I;  2V8K A;  1WCM I;  5A1G A;  2P2J A;  1X3Z A;  1FDO A;  1RLY A;  5ADZ A;  2YAD A;  4NB9 A;  4A3L I;  1Q86 2;  3CCM Z;  2QEX 1;  3CCQ Z;  2QA4 Z;  1AA6 A;  3PO3 I;  1PG3 A;  1M1K 2;  4E2Y A;  1P4E A;  3CCR 1;  1JWH C;  2F4O A;  2P2F A;  2QVY X;  3R9W A;  1ULT A;  3CC2 1;  2V7B A;  3J7A 4;  2K5R A;  2AKL A;  4A3E I;  2JIP A;  2KI7 B;  2QKD A;  4A3M I;  1VQ6 Z;  3IFU A;  3S2H I;  2Y4N A;  1HR0 C;  4BBR I;  3FCE A;  3K7A I;  3JAM b;  5BSW A;  2VPY A;  3RG2 A;  5K85 A;  1W2B Z;  4ISB A;  2E2H I;  2QVX X;  1NUI A;  3OW2 Z;  3GTQ I;  3MON A;  1YIT 1;  4NB8 A;  1TWG I;  2VUM I;  5IT9 D;  1MXC A;  1PU1 A;  3CPW Y;  3CD6 1;  2D28 C;  4AQY C;  2UU9 C;  4DG9 A;  2JMO A;  3VMH A;  3ESW A;  1VQ8 Z;  1XNQ C;  3D6W A;  1TWF I;  4RV9 A;  1S72 Z;  4A3J I;  3E7W A;  1NJI 2;  2E9H A;  1KC8 2;  1YI2 Z;  2R7Z I;  1TWA I;  3LNV A;  5IP9 I;  3CXC Z;  4HGZ A;  2E8C A;  1YIT Z;  2P2Q A;  3DAY A;  4JI1 C;  2P3Y A;  1O93 A;  5IFI A;  1N36 C;  2GTH A;  5T67 A;  3RZD I;  3A26 A;  2VSQ A;  2OOX B;  4RS4 A;  1MXB A;  4EAT A;  3GCF A;  1YJW Z;  2OPL A;  4PZP A;  4DUY C;  1I50 I;  2W04 A;  5FLX b;  1FDI A;  3F3F C;  1K73 2;  2E2I I;  2E5L C;  3IML A;  2MCQ A;  3ETC A;  4X6A I;  4RLF A;  3S14 I;  2P2M A;  2RIQ A;  1HH2 P;  3NH8 A;  2ZM6 C;  4E2X A;  1WF3 A;  2UUA C;  4B3T C;  2ZZM A;  3D2L A;  1GPM A;  2D1T A;  2OTL 1;  4IZ6 A;  1M90 2; 
#chains in the Genus database with same CATH homology
 3NH4 A;  2QW0 X;  1V25 A;  2JA7 I;  4MRI A;  1S7M A;  1DL6 A;  3C5E A;  3D9X A;  4RVO A;  5T8S A;  4DR5 C;  2WD9 A;  4DV1 C;  3CCE Z;  3S1M I;  3VMI A;  4DV4 C;  2R93 I;  5BSR A;  4BSZ A;  1VQ4 1;  3P5J B;  2OBV A;  3CCM 1;  2RT9 A;  2QRC B;  5A2Q b;  2JS4 A;  3DHV A;  1Z02 A;  3UZ0 A;  3GTM S;  4DG8 A;  1WII A;  1YJ9 1;  1YJN Z;  4FUT A;  4A3K I;  3A4I A;  3VNQ A;  1QF8 A;  1JJ2 Y;  3CCR Z;  2OZK A;  3KIF A;  3BG1 B;  4A93 I;  3KXW A;  4B3M C;  1K83 I;  4FTF A;  1X3W A;  4D57 A;  1TWC I;  1R9T I;  2HU9 A;  3L8C A;  2OOY B;  4HGY A;  3CCE 1;  1VQP Z;  1KD1 2;  1VQL Z;  3CME Z;  1L1O C;  1JJ2 Z;  4RVD A;  3OTO C;  3PO3 S;  4DV3 C;  3GTM I;  2QLV B;  1KQS Y;  1I3Q I;  3GKU A;  2Y4O A;  4NBG A;  4R1M A;  5A19 A;  5KEI A;  4DR3 C;  1USP A;  2E8E A;  1V26 A;  1IBK C;  1KQS Z;  1QVF Z;  1JOS A;  1P7L A;  2YWC A;  1ZB8 A;  2Q51 A;  2W03 A;  4NBH A;  1W2B Y;  1VQ5 Z;  3PES A;  3VNS A;  1Q7Y 1;  1NYE A;  4D56 A;  2YU9 I;  3J81 f;  3VNR A;  4JI6 C;  1ZH1 A;  4PRO C;  3I56 1;  2RHB A;  1QM4 A;  1VQ9 Z;  3I07 A;  3CC4 Z;  3I55 1;  2QA4 1;  5LL6 f;  2M6N A;  3VMG A;  2V8J A;  4U5Y D;  4MD8 A;  1XNR C;  1O90 A;  3CCU Z;  4NBC A;  4Y52 I;  5JRH A;  1K9M 1;  4CL1 A;  3TE5 B;  4R1L A;  3G71 1;  4RVN A;  4WV3 A;  3CMA 1;  4PHT A;  1L2F A;  1RY2 A;  2JNY A;  3HOV I;  3H0G I;  4NBA A;  3SO4 A;  3CJE A;  2JA6 I;  4E33 A;  1MDF A;  2D7V A;  3H3V J;  3BG0 B;  1K73 1;  1YJ7 A;  1J5E C;  4E2W A;  3J80 f;  2RPR A;  4MON A;  1FUG A;  1RNI A;  2JR6 A;  4LF7 C;  4JM1 A;  1Q82 2;  2XR1 A;  3CQZ I;  1HNX C;  1X0T A;  1M90 1;  1KKG A;  4GXR A;  3GTK I;  5DV9 A;  4DR4 C;  3T1H C;  4HH4 A;  1P9N A;  4OXI A;  1T5H X;  5E7Q A;  2F4V C;  3CC7 1;  3A9V A;  1VQ7 Z;  3HKZ A;  2E2J I;  2OO4 A;  1YIJ Z;  3HOW I;  1LCI A;  5IP7 I;  3N54 B;  3CME 1;  3CPW Z;  2OTJ Z;  4KTT A;  1S72 1;  5FLX D;  4LF5 C;  1XMO C;  5C3E I;  2D1S A;  2QEX Z;  3CCQ 1;  2QL8 A;  1RO0 A;  2WP0 C;  4NXN C;  4NDN A;  1ZB9 A;  4A3D I;  2HHH C;  1Q81 1;  4IR7 A;  5IWA C;  4DV6 C;  4D4G A;  5BSV A;  1VQ7 1;  3M4O I;  3FQQ A;  3S1N I;  3I4M I;  3NH5 A;  4E31 A;  3FCC A;  4GKJ C;  3S16 I;  2D1R A;  5K8F A;  3U50 C;  2R6M A;  2OPL B;  5D1P A;  3GKQ A;  2OTL Z;  2DYJ A;  1VQK 1;  1MDB A;  4A3B I;  4DCV A;  3S1Q I;  5LMU C;  1T5D X;  1XRC A;  2VZE A;  1PA4 A;  1VQM 1;  1VQ5 1;  4HPV A;  3RV2 A;  4X64 C;  4RVF A;  3CCJ 1;  3CXC Y;  5H9U A;  3CCU 1;  4MXU A;  2JMP A;  4DV5 C;  1Q7Y 2;  1RG9 A;  4NBF A;  2O4H A;  3J81 b;  3KIH A;  1TFI A;  3CC4 1;  4DUZ C;  2H85 A;  5D1O B;  3ETO A;  4NBB A;  3IF8 A;  3UOW A;  3LUS A;  1VQK Z;  2D1Q A;  5GTD A;  2IZ3 A;  2E8F A;  4DCS A;  2UXD C;  2PMZ A;  2DE5 A;  3JAM f;  3CCV Z;  4LF9 C;  5AE1 A;  3AF6 A;  4E32 A;  5C4J I;  2CY1 A;  2UUC C;  4B3R C;  5AN9 F;  5A1I A;  5CZX A;  2IZ4 A;  4G36 A;  2QRE B;  1O92 A;  4K0B A;  2YCB A;  4BBY A;  5IT9 f;  4BCA A;  3MZL B;  1N8R 2;  2PRO A;  4BXX I;  4DR1 C;  4A3C I;  4LE5 A;  4X62 C;  4DR7 C;  4EWC A;  3HOX I;  4LFC C;  2WB1 A;  4A3G I;  2PM9 A;  2JA5 I;  3PO2 I;  3AF5 A;  2ONF A;  1Q86 1;  3DLP X;  5CM2 M;  4DR2 C;  3G4S Z;  3GPC A;  1YUK A;  5AE3 A;  3IX0 A;  3OW2 Y;  3FKI I;  2D27 A;  2PN2 A;  1O9T A;  5AE2 A;  4OYC A;  2OTJ 1;  4LF8 C;  4KTV A;  3CC7 Z;  4NBE A;  4BBS I;  1LQL A;  2Y27 A;  4JI3 C;  1Q81 2;  3HOU I;  2E7G A;  3IEU A;  4I9G A;  4L7I A;  4LFB C;  1RO2 A;  4L2Z A;  1M1K 1;  2KZF A;  5BR8 C;  4BY1 I;  4MD7 A;  4R0M A;  1KRL A;  4DR6 C;  1NP6 A;  1VQ9 1;  3RZO I;  3NFZ A;  2UXB C;  4RLQ A;  1Y1W I;  5C4X I;  3QWU A;  1Z03 A;  3S82 A;  3CMA Z;  3A9U A;  2F4M A;  2I3C A;  1YI2 1;  4LF4 C;  5LMN C;  1XMQ C;  1YJW 1;  4DV2 C;  1VQO Z;  2RBL A;  3GR1 A;  4A3F I;  3EED A;  5FLX f;  3I4N I;  4I9F A;  2QR1 B;  2VQF C;  2KPI A;  1I94 C;  4BC7 A;  4NOZ A;  3VB9 A;  1VQM Z;  1IBL C;  3F3P C;  4QTU A;  3G7S A;  4JI0 C;  2UUB C;  4E30 A;  5C44 I;  3TQI A;  2K3R A;  3PBK A;  3MZK B;  4JI4 C;  4ZJZ A;  4JI7 C;  1NJI 1;  1AMU A;  2V8I A;  4QTT A;  4TPS B;  2DE6 A;  1VQO 1;  3L95 X;  1N32 C;  1RQF A;  4GXQ A;  5BUS A;  2ASB A;  2M48 A;  1TWH I;  4TNU A;  2BJO A;  3TUF A;  1YHQ 1;  3S15 I;  3I56 Z;  1K8A 1;  2E0G A;  3GTJ I;  3NYQ A;  3Q87 A;  4BC9 A;  3GTL I;  2DPL A;  4RVH A;  3NDJ A;  2VF1 A;  4JYA C;  3NYR A;  4NFR A;  2UXC C;  1HNW C;  1N34 C;  1KC8 1;  1VQN 1;  2YWB A;  3IEV A;  3S2D I;  2BH1 X;  2GTI A;  3E7X A;  5BSM A;  5BSU A;  3CD6 Z;  3G6E Z;  1VQ8 1;  3T4N B;  1K0R A;  1QVG Z;  2ZAE B;  4D4I A;  3GTG I;  1WH9 A;  1YJN 1;  1YHQ Z;  2R92 I;  1K9M 2;  1RO4 A;  5FLM I;  3CW8 X;  2QRD B;  3FQM A;  3CCL Z;  3EER A;  4DV0 C;  3R9X A;  3TDH B;  3LAX A;  2G2K A;  2ATW A;  1I6H I;  1EGA A;  1N33 C;  3M3Y I;  1VQ4 Z;  1IBM C;  2P02 A;  5CZV A;  1SFO I;  3NPD A;  4G1I A;  3G71 Z;  3TDE A;  3J81 D;  1HNZ C;  5T6B A;  3B7W A;  3CCJ Z;  1XRB A;  4JI5 C;  3NI2 A;  1Q82 1;  2CXC A;  3J80 b;  1VQN Z;  2HJG A;  3IPL A;  4YY3 C;  4LF6 C;  2Q4Z A;  2AYA A;  1QYP A;  3HOY I;  4NBD A;  3I08 A;  3R44 A;  3JAM D;  4S1T A;  4LFA C;  4RMN A;  5BUQ A;  1WW9 A;  4B3S C;  1QVG Y;  5D1O A;  4ZLP A;  2EGT A;  1VLA A;  4NXM C;  4MH4 A;  4DCT A;  2O53 A;  3CCL 1;  5IT9 b;  4ODJ A;  4OX9 C;  1MKY A;  5BST A;  4X65 C;  2NVT I;  2J6A A;  5T8T A;  3EQ6 A;  5BUR A;  4DK1 A;  4K0K C;  4KHP C;  4WS9 A;  2LFU A;  4JI2 C;  1YIJ 1;  2PK7 A;  4RVG A;  5T64 A;  4NH1 C;  1QVF Y;  4DQY B;  2HF1 A;  1N2F A;  1Y1V S;  4JI8 C;  2GU2 A;  4A3I I;  3CCS Z;  1ML8 A;  1KD1 1;  1QWI A;  5KYT A;  2Y0S A;  3GTO I;  3I55 Z;  4YHH C;  3S17 I;  2P2B A;  4L4Q A;  3N2Q A;  1PFT A;  4RM2 A;  4FUQ A;  1VQP 1;  2B63 I;  1MD9 A;  4RM3 A;  2VUG A;  4AYB A;  1XRA A;  4X66 C;  5A2Q D;  4DCU A;  3S1R I;  4E2Z A;  3GTP I;  4DGL A;  1YJ9 Z;  1USP B;  1K8A 2;  1VQL 1;  3G4S 1;  3LGX A;  4GS5 A;  1MXA A;  1Y1V I;  2LIY A;  3CCS 1;  3HOZ I;  2VQE C;  4DV7 C;  4GKK C;  4JV5 C;  2JUB A;  4XX2 A;  3GR0 A;  1Z01 A;  2PT7 G;  4G37 A;  4BY7 I;  1PG4 A;  3CW9 A;  3NDI A;  4Y7N I;  3VTN A;  2NVY I;  3G6E 1;  2WAQ A;  3T1Y C;  2QVZ X;  2DE7 A;  1FJG C;  3PRO C;  1YUA A;  2P28 A;  5KYV A;  2JA8 I;  3J80 D;  1VQ6 1;  1BA3 A;  1N8R 1;  5A2Q f;  3H2T A;  4MD9 A;  3CC2 Z;  1UKK A;  2P20 A;  4MTN A;  2NVX I;  3CCV 1;  2NVQ I;  2V8K A;  1WCM I;  5A1G A;  2P2J A;  1X3Z A;  1RLY A;  5ADZ A;  2YAD A;  4NB9 A;  4A3L I;  1Q86 2;  3CCM Z;  2QEX 1;  3CCQ Z;  2QA4 Z;  1PG3 A;  3PO3 I;  1M1K 2;  4E2Y A;  3CCR 1;  1JWH C;  2F4O A;  2P2F A;  2QVY X;  3R9W A;  1ULT A;  3CC2 1;  2V7B A;  3J7A 4;  2K5R A;  2AKL A;  4A3E I;  4A3M I;  2KI7 B;  2QKD A;  1VQ6 Z;  3IFU A;  3S2H I;  2Y4N A;  1HR0 C;  4BBR I;  3FCE A;  3K7A I;  3JAM b;  5BSW A;  3RG2 A;  5K85 A;  1W2B Z;  4ISB A;  2E2H I;  2QVX X;  1NUI A;  3OW2 Z;  3GTQ I;  3MON A;  1YIT 1;  4NB8 A;  1TWG I;  2VUM I;  5IT9 D;  1MXC A;  2D28 C;  3CPW Y;  3CD6 1;  4AQY C;  2UU9 C;  4DG9 A;  2JMO A;  3VMH A;  3ESW A;  1VQ8 Z;  1XNQ C;  3D6W A;  1TWF I;  4RV9 A;  1S72 Z;  4A3J I;  3E7W A;  1NJI 2;  2E9H A;  1KC8 2;  1YI2 Z;  2R7Z I;  1TWA I;  3LNV A;  5IP9 I;  3CXC Z;  4HGZ A;  2E8C A;  1YIT Z;  2P2Q A;  3DAY A;  4JI1 C;  2P3Y A;  1O93 A;  5IFI A;  1N36 C;  2GTH A;  5T67 A;  3RZD I;  2VSQ A;  2OOX B;  4RS4 A;  1MXB A;  4EAT A;  3GCF A;  1YJW Z;  2OPL A;  4PZP A;  4DUY C;  1I50 I;  2W04 A;  5FLX b;  3F3F C;  1K73 2;  2E2I I;  2E5L C;  3IML A;  3ETC A;  4X6A I;  4RLF A;  3S14 I;  2P2M A;  2RIQ A;  1HH2 P;  3NH8 A;  2ZM6 C;  4E2X A;  1WF3 A;  2UUA C;  4B3T C;  1GPM A;  2D1T A;  2OTL 1;  4IZ6 A;  1M90 2; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...