2EGTA

Crystal structure of hypothetical protein (aq1549) from aquifex aeolicus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
b'MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_1549
publication title Crystal Structure of Hypothetical protein (AQ1549) from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 42
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.300 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2egtA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2egtA02
4JYAC 4DV7C 2ZM6C 1I94C 2UUCC 4DV1C 2E5LC 4LF4C 5LMUC 1VLAA 4DR6C 4B3SC 4K0KC 3AF6A 4X66C 1PA4A 4DCVA 4X65C 3R9WA 1ZB9A 4DV0C 2UU9C 4LFAC 2KZFA 1HNXC 1USPA 2DYJA 3J80D 5A2QD 2E8FA 4DR7C 1N36C 3OTOC 1N34C 3JAMD 3LUSA 2E8EA 2ASBA 4DR4C 1N32C 1MKYA 4X64C 4YHHC 4B3TC 4JI7C 2UXBC 2VQFC 1WF3A 4LF6C 2UXDC 3EERA 4DV4C 1ZB8A 1XMQC 4XX2A 1WH9A 4JI6C 4DCSA 1L2FA 5IWAC 2PN2A 4LF7C 2QL8A 1HH2P 4DV3C 5IT9D 2ATWA 4AQYC 4JI3C 4B3RC 4DUZC 1JOSA 2E8CA 4LF9C 2PT7G 3IEUA 4LF8C 2OPLB 4DV6C 4NOZA 4LFBC 4DR1C 1IBMC 4BSZA 1HNZC 1NYEA 4DCTA 1HNWC 2VQEC 4JI1C 2UXCC 4JI4C 4DV5C 4LFCC 1XMOC 2EGTA 1J5EC 2HHHC 4JI5C 3I07A 4DCUA 1HR0C 1KKGA 4DR3C 4JI2C 4YY3C 5BR8C 1IBLC 2D7VA 1FJGC 4DR2C 4JI8C 2CXCA 4JI0C 2BJOA 2YCBA 1XNRC 4MTNA 1K0RA 4GKJC 1XNQC 5FLXD 3R9XA 3T1HC 3J81D 1EGAA 1LQLA 3AF5A 1IBKC 2ONFA 2OPLA 4JV5C 4NXNC 4NXMC 4DUYC 4LF5C 4DV2C 2E7GA 5LMNC 2CY1A 3GKUA 2UUBC 4GKKC 4MH4A 4KHPC 1N33C 4DR5C 2UUAC 1UKKA 1USPB 1ML8A 1QWIA 1N2FA 2JMPA 4X62C 2XR1A 4OX9C 3CJEA 3IEVA 2F4VC 2HJGA 4B3MC 3T1YC
chains in the Genus database with same CATH superfamily
1NP6A 4E2YA 3CC4Z 2K5RA 4A3EI 3GTGI 5KYVA 3CQ1A 4PUHA 1Y8CA 4K0BA 3I551 3GR0A 1VQ41 5FLXb 3ETOA 3ESWA 1KC81 2JA8I 3NPDA 5BSUA 4TPSB 4X66C 4X65C 2OTJ1 2Y4NA 2JIQA 2D1SA 5C4JI 1USPA 2NVXI 1MDBA 2KZFA 3FQMA 1YI2Z 4Y7NI 2E8FA 1X3WA 3QWUA 1Q811 2YADA 1M901 1LCIA 2PM9A 2P2MA 2P3YA 4OXIA 1VQLZ 3PO3I 3E7WA 3O2EA 1Q821 4PUIA 3CW9A 5CM2M 2QEXZ 1VEHA 4LE5A 1Y1WI 3I4NI 3EERA 4A3DI 1Q16A 1XMQC 4D57A 5IWAC 1JJ2Y 3CC7Z 4DV3C 5AE2A 3VNQA 3CQ3A 1K83I 3TR3A 1VQ91 2PT7G 5JRHA 4JM1A 3CC2Z 2OZKA 2JA6I 4KTVA 1RNIA 2OO4A 4DV6C 3U50C 3K7AI 2D1TA 2YWBA 1YIJ1 4OYCA 4BC9A 1YIT1 3CMAZ 1HNZC 5LCIA 3S2HI 4NB8A 4GS5A 3GPCA 4IR7A 5D1OB 4RVOA 2W03A 1VQK1 4JI4C 1T5DX 1TWCI 3OW2Z 2D28C 3CCV1 2QR1B 3I07A 5A2Qb 1HR0C 2QLVB 1O9TA 1IBLC 3CQ2A 1YUAA 4DR2C 4BXXI 3CPWZ 4D56A 2QVYX 2NVTI 2BH1X 3IPLA 2BJOA 2P2FA 4BBSI 1O93A 3CD61 3RZOI 3S1NI 1KC82 3JAMf 4DG9A 4TNUA 4NXNC 2OTJZ 2V7BA 1M6XC 4R0MA 1YJ9Z 1VQ71 5CZVA 4R1LA 4A3KI 5A1IA 4G1IA 4EWCA 4MH4A 1Q812 1M902 2OOYB 1YJW1 4DR5C 3EEDA 4NBCA 5D1OA 4DGLA 4BY7I 5A19A 1Q822 2JMPA 5BSRA 3S15I 1PFTA 4D4IA 1WIIA 1RLYA 1YHQZ 3D9XA 1VQN1 4RLFA 1NJI1 4A3LI 3J81f 2QW0X 3NI2A 5BSTA 3DLPX 3D6WA 4G37A 3L8CA 4B3MC 1V60A 3N2QA 3IMLA 2M5HA 1RG9A 1VQ8Z 1QVFZ 2M5OA 2ZM6C 3GTKI 3VMIA 5AE1A 4DV1C 4HPVA 2E0GA 3VMHA 3I4MI 1XRCA 2VSQA 5BSVA 3I08A 2DE5A 5LMUC 1YITZ 2QKDA 4B3SC 1JWHC 3CCQ1 2JNVA 4NB9A 4DCVA 3R9WA 2O4HA 5T67A 3UEBA 3SO4A 2UU9C 1IB8A 5KYTA 4A3FI 3UOWA 4GXQA 2DYJA 2D27A 4MD9A 2JNYA 3OTOC 4AYBA 1S7MA 4DR4C 4QTTA 3A26A 1MKYA 1S721 1T5HX 1L1OC 4YHHC 3ETCA 4JI7C 2WB1A 5T64A 1AA6A 2VUMI 4E2XA 1RQFA 2DPLA 3H0GI 1NUIA 4LF6C 1QM4A 4L2ZA 1ZB8A 3CD6Z 2PMZA 1WH9A 1W2BZ 3CCR1 4LF7C 4E30A 1RO0A 4AQYC 1VQ7Z 4DUZC 2P28A 3BG1B 2JA7I 2Z51A 3S14I 3BG0B 3IEUA 4DQYB 3PROC 4LF8C 4NBAA 1YJ91 4NBHA 1KD12 2JUBA 1YJWZ 4NOZA 2E9HA 1P9NA 2M6NA 2Y0SA 2KDNA 3D2LA 4DR1C 3HOVI 3HOWI 4BSZA 3IF8A 4NBFA 3CCMZ 1VQNZ 2D1RA 3A9VA 3RV2A 1HNWC 2UXCC 4JI1C 1FDOA 1NJI2 1V25A 1YHQ1 4PHTA 2HF1A 1J5EC 3J80b 4DR3C 2V45A 2IZ3A 1XRBA 4YY3C 3GTQI 5BR8C 2E2HI 2V8IA 2QRCB 4ZJZA 3UZ0A 2IZ4A 3M4OI 2JIOA 1K0RA 1VQ81 5FLXD 3J80f 4RM3A 3T1HC 3IR7A 3AF5A 1WW9A 3B7WA 3CCQZ 2R93I 5IP7I 2V8JA 3OW2Y 3RZDI 4R1MA 1WZNA 1P4EC 3VMGA 2AKLA 4PUGA 3GTLI 2I3CA 3IX0A 3CPWY 3H3VJ 4A3GI 2WP0C 3LNVA 1S72Z 2F4OA 2B63I 1GPMA 2YU9I 1UKKA 1YJ7A 5IT9f 1I6HI 1Q862 3JAMb 4X62C 2JA5I 3KXWA 2OTLZ 2XR1A 1WCMI 2E2II 1UWDA 2D1QA 3PO2I 3CCRZ 2G2KA 4DK1A 1VQM1 3I561 4HGZA 3T1YC 2DE7A 3HOZI 1MXAA 1N8R2 3S1MI 5H9UA 2E2JI 1ULTA 3LAXA 4IZ6A 1I94C 4NBBA 1X0TA 5C4XI 2LEXA 1K9M1 3R44A 4LF4C 1KD11 4HGYA 4E31A 1VLAA 3CXCZ 3J81b 5LL6f 3G6EZ 1O92A 5D1PA 2ZZMA 2JIPA 4DR6C 2Y4OA 4K0KC 3AF6A 2YX1A 1M1K1 1VQ51 1PA4A 3A9UA 4PZPA 3FKII 3HOYI 5K85A 2J6AA 4DV0C 2QRDB 3G4S1 2VPZA 3CCM1 4A3II 4FUQA 4LFAC 5A2QD 2JR6A 3GTOI 1I50I 3A25A 4DR7C 5AN9F 1MXCA 1VQPZ 1QVFY 1YJN1 1N34C 3LUSA 3JAMD 2E8EA 4FTFA 2ASBA 1N32C 3T4NB 2WAQA 3CCUZ 1TWGI 1Z03A 2RT9A 2V3VA 2GTIA 5C44I 2UXBC 3A4IA 2UXDC 4XX2A 2CU6A 1TFIA 3UX3A 1O90A 1TWFI 1MD9A 1DL6A 2AYAA 1HH2P 2ATWA 1QVGY 3NYQA 4JI3C 3FQQA 4B3RC 1WCJA 2E8CA 1TWHI 2JS4A 4FUTA 4NFRA 4BCAA 2OPLB 3K6RA 3VNSA 4A3MI 1PG3A 4BC7A 4NH1C 5T8SA 4KTTA 1QVGZ 1M6XA 4NDNA 5BURA 4A3CI 1FUGA 1KQSZ 4HH4A 1FDIA 2VPWA 3M3YI 1RO4A 2GU2A 2QREB 1QXFA 3TE5B 1Q861 3NYRA 1W2BY 4MXUA 1NYEA 3DAYA 3MZLB 4MD7A 4ODJA 4RVGA 5DV9A 4DCTA 2OTL1 2LFUA 1XMOC 1YUKA 3GTPI 4RVFA 3IFUA 1VQMZ 1K731 3I56Z 1VQO1 4DCUA 3C5EA 2HHHC 1Z01A 2P2BA 3RG2A 4JI5C 1N8R1 2NVQI 4JI8C 1RO2A 5BSWA 1XRAA 3LGXA 3Q87A 2PROA 2VZEA 2WD9A 1XNRC 4BBRI 4MTNA 3NH8A 4S1TA 3R9XA 3G71Z 1K9M2 4I9FA 3E7XA 3MONA 1LQLA 3TDHB 4RVNA 1IBKC 2ONFA 1QYPA 5FLMI 1VQ5Z 2OPLA 4JV5C 3G6E1 2K3RA 3P5JB 5IP9I 2F4MA 4QTUA 4E2WA 3G4SZ 3CCJ1 1M1K2 3S2DI 1XHJA 2E7GA 5LMNC 2R7ZI 2P02A 3S1QI 3S82A 3GKUA 3TQIA 1YJNZ 4NBGA 3LNOA 2UUBC 4GKKC 3MZKB 5BUSA 4KHPC 2RIQA 1Q7Y1 1N33C 2RPRA 4A3JI 2MMAB 4RMNA 5BSMA 1VQP1 2QVXX 2MCQA 3CCE1 1N2FA 1P7LA 3EQ6A 2R6MA 3CCU1 1MDFA 4RVDA 5FLXf 4OX9C 3CJEA 1K8A2 2KPIA 3CCSZ 3CME1 3NH5A 2F4VC 3S16I 2KI7B 3S17I 2VF1A 4JYAC 3DHVA 2JIRA 1MXBA 4DV7C 4BBYA 3CCL1 5IT9b 1SIWA 2UUCC 1BA3A 4NBEA 1Y1VS 2M48A 2E5LC 2QA4Z 3F3FC 2VPYA 2HU9A 4CL1A 3G7SA 3FCEA 3VNRA 1NY8A 1RY2A 2ZZNA 3GTMS 1ZB9A 3NFZA 5IFIA 1FLOA 1JJ2Z 4L4QA 3GKQA 3HOXI 2Q4ZA 5BUQA 1HNXC 3AY0A 3J80D 1VQOZ 4GXRA 4Y52I 4I9GA 1N36C 1ZH1A 3KIFA 4MD8A 5C3EI 1K732 1VQ61 3PBKA 2DE6A 4MONA 2Q51A 4A3BI 4X64C 4RLQA 4B3TC 1WJ2A 4A93I 4RS4A 4BY1I 3CXCY 2VQFC 2R92I 1PU1A 1WF3A 4E33A 4RM2A 2RBLA 2Y27A 4DV4C 4MRIA 4DG8A 5K8FA 2PK7A 3VTNA 4JI6C 4DCSA 1L2FA 3GR1A 3G711 4U5YD 2PN2A 2JMOA 3GCFA 1TWAI 2IV2X 2JIMA 2P2QA 2QL8A 5IT9D 3CCJZ 2RHBA 3NDIA 1JOSA 4LF9C 3CC41 3I55Z 2KZ0A 1VQ4Z 5A2Qf 2H85A 4NBDA 3H2TA 4ZLPA 1Q7Y2 2LIYA 4LFBC 3PESA 2NAPA 1R9TI 4G36A 3CCEZ 1PG4A 5KEIA 1P4EA 1IBMC 2ZAEB 4L7IA 2P2JA 1KRLA 2MM9A 2OBVA 2VQEC 3FCCA 4DV5C 2NVYI 2P20A 2VUGA 5T6BA 3CMEZ 4LFCC 3PO3S 2EGTA 2V8KA 1K8A1 1YI21 3HKZA 3NH4A 1KKGA 5CZXA 1I3QI 3L95X 5GTDA 1AMUA 4JI2C 3F3PC 3CCS1 2D7VA 4WS9A 1FJGC 1VQL1 2CXCA 1X3ZA 2VPXA 3CCLZ 2E7ZA 3KIHA 2QVZX 4X6AI 2QEX1 2YCBA 5E7QA 4JI0C 4GKJC 1KQSY 1XNQC 2W04A 3J81D 3S1RI 1EGAA 2NCLA 5AE3A 4RV9A 1Y1VI 2QA41 1QF8A 1XS3A 2DHMA 1VQ9Z 3TUFA 3CC71 4NXMC 5T8TA 4DUYC 4LF5C 2YWCA 1Z02A 4DV2C 1SFOI 2CY1A 3CQZI 4D4GA 4EATA 1YIJZ 3CC21 1VQ6Z 3GTMI 2UUAC 4ISBA 1USPB 3N54B 1V26A 4E32A 1ML8A 4PROC 1QWIA 2OOXB 4E2ZA 3HOUI 1VQKZ 3CMA1 4RVHA 1TH5A 2GTHA 3VB9A 5A1GA 3UX2A 3CCVZ 2O53A 3CW8X 3GTJI 5ADZA 2AYDA 3NDJA 3IEVA 3TDEA 3J7A4 2HJGA 4WV3A
chains in the Genus database with same CATH topology
1NP6A 4E2YA 3CC4Z 2K5RA 4A3EI 3GTGI 5KYVA 4K0BA 3I551 3GR0A 1VQ41 5FLXb 3ETOA 3ESWA 1KC81 2JA8I 3NPDA 5BSUA 4TPSB 4X66C 4X65C 2OTJ1 2Y4NA 2D1SA 5C4JI 1USPA 2NVXI 1MDBA 2KZFA 3FQMA 1YI2Z 4Y7NI 2E8FA 1X3WA 3QWUA 1Q811 2YADA 1M901 1LCIA 2PM9A 2P2MA 2P3YA 4OXIA 1VQLZ 3PO3I 3E7WA 1Q821 3CW9A 5CM2M 2QEXZ 4LE5A 1Y1WI 3I4NI 3EERA 4A3DI 1XMQC 4D57A 5IWAC 1JJ2Y 3CC7Z 4DV3C 5AE2A 3VNQA 1K83I 1VQ91 2PT7G 5JRHA 4JM1A 3CC2Z 2OZKA 2JA6I 4KTVA 1RNIA 2OO4A 4DV6C 3U50C 3K7AI 2D1TA 2YWBA 1YIJ1 4OYCA 4BC9A 1YIT1 3CMAZ 1HNZC 3S2HI 4NB8A 4GS5A 3GPCA 4IR7A 5D1OB 4RVOA 2W03A 1VQK1 4JI4C 1T5DX 1TWCI 3OW2Z 2D28C 3CCV1 2QR1B 3I07A 5A2Qb 1HR0C 2QLVB 1O9TA 1IBLC 4DR2C 1YUAA 4BXXI 3CPWZ 4D56A 2QVYX 2NVTI 2BH1X 3IPLA 2BJOA 2P2FA 4BBSI 1O93A 3CD61 3RZOI 3S1NI 1KC82 3JAMf 4DG9A 4TNUA 4NXNC 2OTJZ 2V7BA 4R0MA 1YJ9Z 1VQ71 5CZVA 4R1LA 4A3KI 5A1IA 4G1IA 4EWCA 4MH4A 1Q812 1M902 2OOYB 1YJW1 4DR5C 3EEDA 4NBCA 5D1OA 4DGLA 4BY7I 5A19A 1Q822 2JMPA 5BSRA 3S15I 1PFTA 4D4IA 1WIIA 1RLYA 1YHQZ 3D9XA 1VQN1 4RLFA 1NJI1 4A3LI 3J81f 2QW0X 3NI2A 5BSTA 3DLPX 3D6WA 4G37A 3L8CA 4B3MC 3N2QA 3IMLA 1RG9A 1VQ8Z 1QVFZ 2ZM6C 3GTKI 3VMIA 5AE1A 4DV1C 4HPVA 2E0GA 3VMHA 3I4MI 1XRCA 2VSQA 5BSVA 3I08A 2DE5A 5LMUC 1YITZ 2QKDA 4B3SC 1JWHC 3CCQ1 4NB9A 4DCVA 3R9WA 2O4HA 5T67A 3SO4A 2UU9C 5KYTA 4A3FI 3UOWA 4GXQA 2DYJA 2D27A 4MD9A 2JNYA 3OTOC 4AYBA 1S7MA 4DR4C 4QTTA 1MKYA 1S721 1T5HX 1L1OC 4YHHC 3ETCA 4JI7C 2WB1A 5T64A 2VUMI 4E2XA 1RQFA 2DPLA 3H0GI 1NUIA 4LF6C 1QM4A 4L2ZA 1ZB8A 3CD6Z 2PMZA 1WH9A 1W2BZ 3CCR1 4LF7C 4E30A 1RO0A 4AQYC 1VQ7Z 4DUZC 2P28A 3BG1B 2JA7I 3S14I 3BG0B 3IEUA 4DQYB 3PROC 4LF8C 4NBAA 1YJ91 4NBHA 1KD12 2JUBA 1YJWZ 4NOZA 2E9HA 1P9NA 2M6NA 2Y0SA 4DR1C 3HOVI 3HOWI 4BSZA 3IF8A 4NBFA 3CCMZ 1VQNZ 2D1RA 3A9VA 3RV2A 1HNWC 2UXCC 4JI1C 1NJI2 1V25A 1YHQ1 4PHTA 2HF1A 1J5EC 3J80b 4DR3C 2IZ3A 1XRBA 4YY3C 3GTQI 5BR8C 2E2HI 2V8IA 2QRCB 4ZJZA 3UZ0A 2IZ4A 3M4OI 1K0RA 1VQ81 5FLXD 3J80f 4RM3A 3T1HC 3AF5A 1WW9A 3B7WA 3CCQZ 2R93I 5IP7I 2V8JA 3OW2Y 3RZDI 4R1MA 3VMGA 2AKLA 3GTLI 2I3CA 3IX0A 3CPWY 3H3VJ 4A3GI 2WP0C 3LNVA 1S72Z 2F4OA 2B63I 1GPMA 2YU9I 1UKKA 1YJ7A 5IT9f 1I6HI 1Q862 3JAMb 4X62C 2JA5I 3KXWA 2OTLZ 2XR1A 1WCMI 2E2II 2D1QA 3PO2I 3CCRZ 2G2KA 4DK1A 1VQM1 3I561 4HGZA 3T1YC 2DE7A 3HOZI 1MXAA 1N8R2 3S1MI 5H9UA 2E2JI 1ULTA 3LAXA 4IZ6A 1I94C 4NBBA 1X0TA 5C4XI 1K9M1 3R44A 4LF4C 1KD11 4HGYA 4E31A 1VLAA 3CXCZ 3J81b 5LL6f 3G6EZ 1O92A 5D1PA 4DR6C 2Y4OA 4K0KC 3AF6A 1M1K1 1VQ51 1PA4A 3A9UA 4PZPA 3FKII 3HOYI 5K85A 2J6AA 4DV0C 2QRDB 3G4S1 4LFAC 3CCM1 4A3II 4FUQA 5A2QD 2JR6A 3GTOI 1I50I 4DR7C 5AN9F 1MXCA 1VQPZ 1QVFY 1YJN1 1N34C 3LUSA 3JAMD 2E8EA 4FTFA 2ASBA 1N32C 3T4NB 2WAQA 3CCUZ 1TWGI 1Z03A 2RT9A 2GTIA 5C44I 2UXBC 3A4IA 2UXDC 4XX2A 1TFIA 1O90A 1TWFI 1MD9A 1DL6A 2AYAA 1HH2P 2ATWA 1QVGY 3NYQA 4JI3C 3FQQA 4B3RC 2E8CA 1TWHI 2JS4A 4FUTA 4NFRA 4BCAA 2OPLB 3VNSA 4A3MI 1PG3A 4BC7A 4NH1C 5T8SA 4KTTA 1QVGZ 4NDNA 5BURA 4A3CI 1FUGA 1KQSZ 4HH4A 3M3YI 1RO4A 2GU2A 2QREB 3TE5B 1Q861 3NYRA 1W2BY 4MXUA 1NYEA 3DAYA 3MZLB 4MD7A 4ODJA 4RVGA 5DV9A 4DCTA 2OTL1 2LFUA 1XMOC 1YUKA 3GTPI 4RVFA 3IFUA 1VQMZ 1K731 3I56Z 1VQO1 4DCUA 3C5EA 2HHHC 1Z01A 2P2BA 3RG2A 4JI5C 1N8R1 2NVQI 4JI8C 1RO2A 5BSWA 1XRAA 3LGXA 3Q87A 2PROA 2VZEA 2WD9A 1XNRC 4BBRI 4MTNA 3NH8A 4S1TA 3R9XA 3G71Z 1K9M2 4I9FA 3E7XA 3MONA 1LQLA 3TDHB 4RVNA 1IBKC 2ONFA 1QYPA 5FLMI 1VQ5Z 2OPLA 4JV5C 3G6E1 2K3RA 3P5JB 5IP9I 2F4MA 4QTUA 4E2WA 3G4SZ 3CCJ1 1M1K2 3S2DI 2E7GA 5LMNC 2R7ZI 2P02A 3S1QI 3S82A 3GKUA 3TQIA 1YJNZ 4NBGA 2UUBC 4GKKC 3MZKB 5BUSA 4KHPC 2RIQA 1Q7Y1 1N33C 2RPRA 4A3JI 4RMNA 5BSMA 1VQP1 2QVXX 3CCE1 1N2FA 1P7LA 3EQ6A 2R6MA 3CCU1 1MDFA 4RVDA 5FLXf 4OX9C 3CJEA 1K8A2 2KPIA 3CCSZ 3CME1 3NH5A 2F4VC 3S16I 2KI7B 3S17I 2VF1A 4JYAC 3DHVA 1MXBA 4DV7C 4BBYA 3CCL1 5IT9b 2UUCC 1BA3A 4NBEA 1Y1VS 2M48A 2E5LC 2QA4Z 3F3FC 2HU9A 4CL1A 3G7SA 3FCEA 3VNRA 1RY2A 3GTMS 1ZB9A 3NFZA 5IFIA 1JJ2Z 4L4QA 3GKQA 3HOXI 2Q4ZA 5BUQA 1HNXC 3J80D 1VQOZ 4GXRA 4Y52I 4I9GA 1N36C 1ZH1A 3KIFA 4MD8A 5C3EI 1K732 1VQ61 3PBKA 2DE6A 4MONA 2Q51A 4A3BI 4X64C 4RLQA 4B3TC 4A93I 4RS4A 4BY1I 3CXCY 2VQFC 2R92I 1WF3A 4E33A 4RM2A 2RBLA 2Y27A 4DV4C 4MRIA 4DG8A 5K8FA 2PK7A 3VTNA 4JI6C 4DCSA 1L2FA 3GR1A 3G711 4U5YD 2PN2A 2JMOA 3GCFA 1TWAI 2P2QA 2QL8A 5IT9D 3CCJZ 2RHBA 3NDIA 1JOSA 4LF9C 3CC41 3I55Z 1VQ4Z 5A2Qf 2H85A 4NBDA 3H2TA 4ZLPA 1Q7Y2 2LIYA 4LFBC 3PESA 1R9TI 4G36A 3CCEZ 1PG4A 5KEIA 1IBMC 2ZAEB 4L7IA 2P2JA 1KRLA 2OBVA 2VQEC 3FCCA 4DV5C 2NVYI 2P20A 2VUGA 5T6BA 3CMEZ 4LFCC 3PO3S 2EGTA 2V8KA 1K8A1 1YI21 3HKZA 3NH4A 1KKGA 5CZXA 1I3QI 3L95X 5GTDA 1AMUA 4JI2C 3F3PC 3CCS1 2D7VA 4WS9A 1FJGC 1VQL1 2CXCA 1X3ZA 3CCLZ 3KIHA 2QVZX 4X6AI 2QEX1 2YCBA 5E7QA 4JI0C 4GKJC 1KQSY 1XNQC 2W04A 3J81D 3S1RI 1EGAA 5AE3A 4RV9A 1Y1VI 2QA41 1QF8A 1VQ9Z 3TUFA 3CC71 4NXMC 5T8TA 4DUYC 4LF5C 2YWCA 1Z02A 4DV2C 1SFOI 2CY1A 3CQZI 4D4GA 4EATA 1YIJZ 3CC21 1VQ6Z 3GTMI 2UUAC 4ISBA 1USPB 3N54B 1V26A 4E32A 1ML8A 4PROC 1QWIA 2OOXB 4E2ZA 3HOUI 1VQKZ 3CMA1 4RVHA 5A1GA 2GTHA 3VB9A 3CCVZ 2O53A 3CW8X 3GTJI 5ADZA 3NDJA 3IEVA 3TDEA 3J7A4 2HJGA 4WV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA C;  4DV7 C;  2ZM6 C;  1I94 C;  2UUC C;  4DV1 C;  2E5L C;  4LF4 C;  5LMU C;  1VLA A;  4DR6 C;  4B3S C;  4K0K C;  3AF6 A;  4X66 C;  1PA4 A;  4DCV A;  4X65 C;  3R9W A;  1ZB9 A;  4DV0 C;  2UU9 C;  4LFA C;  2KZF A;  1HNX C;  1USP A;  2DYJ A;  3J80 D;  5A2Q D;  2E8F A;  4DR7 C;  1N36 C;  3OTO C;  1N34 C;  3JAM D;  3LUS A;  2E8E A;  2ASB A;  4DR4 C;  1N32 C;  1MKY A;  4X64 C;  4YHH C;  4B3T C;  4JI7 C;  2UXB C;  2VQF C;  1WF3 A;  4LF6 C;  2UXD C;  3EER A;  4DV4 C;  1ZB8 A;  1XMQ C;  4XX2 A;  1WH9 A;  4JI6 C;  4DCS A;  1L2F A;  5IWA C;  2PN2 A;  4LF7 C;  2QL8 A;  1HH2 P;  4DV3 C;  5IT9 D;  2ATW A;  4AQY C;  4JI3 C;  4B3R C;  4DUZ C;  1JOS A;  2E8C A;  4LF9 C;  2PT7 G;  3IEU A;  4LF8 C;  2OPL B;  4DV6 C;  4NOZ A;  4LFB C;  4DR1 C;  1IBM C;  4BSZ A;  1HNZ C;  1NYE A;  4DCT A;  1HNW C;  2VQE C;  4JI1 C;  2UXC C;  4JI4 C;  4DV5 C;  4LFC C;  1XMO C;  2EGT A;  1J5E C;  2HHH C;  4JI5 C;  3I07 A;  4DCU A;  1HR0 C;  1KKG A;  4DR3 C;  4JI2 C;  4YY3 C;  5BR8 C;  1IBL C;  2D7V A;  1FJG C;  4DR2 C;  4JI8 C;  2CXC A;  4JI0 C;  2BJO A;  2YCB A;  1XNR C;  4MTN A;  1K0R A;  4GKJ C;  1XNQ C;  5FLX D;  3R9X A;  3T1H C;  3J81 D;  1EGA A;  1LQL A;  3AF5 A;  1IBK C;  2ONF A;  2OPL A;  4JV5 C;  4NXN C;  4NXM C;  4DUY C;  4LF5 C;  4DV2 C;  2E7G A;  5LMN C;  2CY1 A;  3GKU A;  2UUB C;  4GKK C;  4MH4 A;  4KHP C;  1N33 C;  4DR5 C;  2UUA C;  1UKK A;  1USP B;  1ML8 A;  1QWI A;  1N2F A;  2JMP A;  4X62 C;  2XR1 A;  4OX9 C;  3CJE A;  3IEV A;  2F4V C;  2HJG A;  4B3M C;  3T1Y C; 
#chains in the Genus database with same CATH topology
 1NP6 A;  4E2Y A;  3CC4 Z;  2K5R A;  4A3E I;  3GTG I;  5KYV A;  3CQ1 A;  4PUH A;  1Y8C A;  4K0B A;  3I55 1;  3GR0 A;  1VQ4 1;  5FLX b;  3ETO A;  3ESW A;  1KC8 1;  2JA8 I;  3NPD A;  5BSU A;  4TPS B;  4X66 C;  4X65 C;  2OTJ 1;  2Y4N A;  2JIQ A;  2D1S A;  5C4J I;  1USP A;  2NVX I;  1MDB A;  2KZF A;  3FQM A;  1YI2 Z;  4Y7N I;  2E8F A;  1X3W A;  3QWU A;  1Q81 1;  2YAD A;  1M90 1;  1LCI A;  2PM9 A;  2P2M A;  2P3Y A;  4OXI A;  1VQL Z;  3PO3 I;  3E7W A;  3O2E A;  1Q82 1;  4PUI A;  3CW9 A;  5CM2 M;  2QEX Z;  1VEH A;  4LE5 A;  1Y1W I;  3I4N I;  3EER A;  4A3D I;  1Q16 A;  1XMQ C;  4D57 A;  5IWA C;  1JJ2 Y;  3CC7 Z;  4DV3 C;  5AE2 A;  3VNQ A;  3CQ3 A;  1K83 I;  3TR3 A;  1VQ9 1;  2PT7 G;  5JRH A;  4JM1 A;  3CC2 Z;  2OZK A;  2JA6 I;  4KTV A;  1RNI A;  2OO4 A;  4DV6 C;  3U50 C;  3K7A I;  2D1T A;  2YWB A;  1YIJ 1;  4OYC A;  4BC9 A;  1YIT 1;  3CMA Z;  1HNZ C;  5LCI A;  3S2H I;  4NB8 A;  4GS5 A;  3GPC A;  4IR7 A;  5D1O B;  4RVO A;  2W03 A;  1VQK 1;  4JI4 C;  1T5D X;  1TWC I;  3OW2 Z;  2D28 C;  3CCV 1;  2QR1 B;  3I07 A;  5A2Q b;  1HR0 C;  2QLV B;  1O9T A;  1IBL C;  3CQ2 A;  1YUA A;  4DR2 C;  4BXX I;  3CPW Z;  4D56 A;  2QVY X;  2NVT I;  2BH1 X;  3IPL A;  2BJO A;  2P2F A;  4BBS I;  1O93 A;  3CD6 1;  3RZO I;  3S1N I;  1KC8 2;  3JAM f;  4DG9 A;  4TNU A;  4NXN C;  2OTJ Z;  2V7B A;  1M6X C;  4R0M A;  1YJ9 Z;  1VQ7 1;  5CZV A;  4R1L A;  4A3K I;  5A1I A;  4G1I A;  4EWC A;  4MH4 A;  1Q81 2;  1M90 2;  2OOY B;  1YJW 1;  4DR5 C;  3EED A;  4NBC A;  5D1O A;  4DGL A;  4BY7 I;  5A19 A;  1Q82 2;  2JMP A;  5BSR A;  3S15 I;  1PFT A;  4D4I A;  1WII A;  1RLY A;  1YHQ Z;  3D9X A;  1VQN 1;  4RLF A;  1NJI 1;  4A3L I;  3J81 f;  2QW0 X;  3NI2 A;  5BST A;  3DLP X;  3D6W A;  4G37 A;  3L8C A;  4B3M C;  1V60 A;  3N2Q A;  3IML A;  2M5H A;  1RG9 A;  1VQ8 Z;  1QVF Z;  2M5O A;  2ZM6 C;  3GTK I;  3VMI A;  5AE1 A;  4DV1 C;  4HPV A;  2E0G A;  3VMH A;  3I4M I;  1XRC A;  2VSQ A;  5BSV A;  3I08 A;  2DE5 A;  5LMU C;  1YIT Z;  2QKD A;  4B3S C;  1JWH C;  3CCQ 1;  2JNV A;  4NB9 A;  4DCV A;  3R9W A;  2O4H A;  5T67 A;  3UEB A;  3SO4 A;  2UU9 C;  1IB8 A;  5KYT A;  4A3F I;  3UOW A;  4GXQ A;  2DYJ A;  2D27 A;  4MD9 A;  2JNY A;  3OTO C;  4AYB A;  1S7M A;  4DR4 C;  4QTT A;  3A26 A;  1MKY A;  1S72 1;  1T5H X;  1L1O C;  4YHH C;  3ETC A;  4JI7 C;  2WB1 A;  5T64 A;  1AA6 A;  2VUM I;  4E2X A;  1RQF A;  2DPL A;  3H0G I;  1NUI A;  4LF6 C;  1QM4 A;  4L2Z A;  1ZB8 A;  3CD6 Z;  2PMZ A;  1WH9 A;  1W2B Z;  3CCR 1;  4LF7 C;  4E30 A;  1RO0 A;  4AQY C;  1VQ7 Z;  4DUZ C;  2P28 A;  3BG1 B;  2JA7 I;  2Z51 A;  3S14 I;  3BG0 B;  3IEU A;  4DQY B;  3PRO C;  4LF8 C;  4NBA A;  1YJ9 1;  4NBH A;  1KD1 2;  2JUB A;  1YJW Z;  4NOZ A;  2E9H A;  1P9N A;  2M6N A;  2Y0S A;  2KDN A;  3D2L A;  4DR1 C;  3HOV I;  3HOW I;  4BSZ A;  3IF8 A;  4NBF A;  3CCM Z;  1VQN Z;  2D1R A;  3A9V A;  3RV2 A;  1HNW C;  2UXC C;  4JI1 C;  1FDO A;  1NJI 2;  1V25 A;  1YHQ 1;  4PHT A;  2HF1 A;  1J5E C;  3J80 b;  4DR3 C;  2V45 A;  2IZ3 A;  1XRB A;  4YY3 C;  3GTQ I;  5BR8 C;  2E2H I;  2V8I A;  2QRC B;  4ZJZ A;  3UZ0 A;  2IZ4 A;  3M4O I;  2JIO A;  1K0R A;  1VQ8 1;  5FLX D;  3J80 f;  4RM3 A;  3T1H C;  3IR7 A;  3AF5 A;  1WW9 A;  3B7W A;  3CCQ Z;  2R93 I;  5IP7 I;  2V8J A;  3OW2 Y;  3RZD I;  4R1M A;  1WZN A;  1P4E C;  3VMG A;  2AKL A;  4PUG A;  3GTL I;  2I3C A;  3IX0 A;  3CPW Y;  3H3V J;  4A3G I;  2WP0 C;  3LNV A;  1S72 Z;  2F4O A;  2B63 I;  1GPM A;  2YU9 I;  1UKK A;  1YJ7 A;  5IT9 f;  1I6H I;  1Q86 2;  3JAM b;  4X62 C;  2JA5 I;  3KXW A;  2OTL Z;  2XR1 A;  1WCM I;  2E2I I;  1UWD A;  2D1Q A;  3PO2 I;  3CCR Z;  2G2K A;  4DK1 A;  1VQM 1;  3I56 1;  4HGZ A;  3T1Y C;  2DE7 A;  3HOZ I;  1MXA A;  1N8R 2;  3S1M I;  5H9U A;  2E2J I;  1ULT A;  3LAX A;  4IZ6 A;  1I94 C;  4NBB A;  1X0T A;  5C4X I;  2LEX A;  1K9M 1;  3R44 A;  4LF4 C;  1KD1 1;  4HGY A;  4E31 A;  1VLA A;  3CXC Z;  3J81 b;  5LL6 f;  3G6E Z;  1O92 A;  5D1P A;  2ZZM A;  2JIP A;  4DR6 C;  2Y4O A;  4K0K C;  3AF6 A;  2YX1 A;  1M1K 1;  1VQ5 1;  1PA4 A;  3A9U A;  4PZP A;  3FKI I;  3HOY I;  5K85 A;  2J6A A;  4DV0 C;  2QRD B;  3G4S 1;  2VPZ A;  3CCM 1;  4A3I I;  4FUQ A;  4LFA C;  5A2Q D;  2JR6 A;  3GTO I;  1I50 I;  3A25 A;  4DR7 C;  5AN9 F;  1MXC A;  1VQP Z;  1QVF Y;  1YJN 1;  1N34 C;  3LUS A;  3JAM D;  2E8E A;  4FTF A;  2ASB A;  1N32 C;  3T4N B;  2WAQ A;  3CCU Z;  1TWG I;  1Z03 A;  2RT9 A;  2V3V A;  2GTI A;  5C44 I;  2UXB C;  3A4I A;  2UXD C;  4XX2 A;  2CU6 A;  1TFI A;  3UX3 A;  1O90 A;  1TWF I;  1MD9 A;  1DL6 A;  2AYA A;  1HH2 P;  2ATW A;  1QVG Y;  3NYQ A;  4JI3 C;  3FQQ A;  4B3R C;  1WCJ A;  2E8C A;  1TWH I;  2JS4 A;  4FUT A;  4NFR A;  4BCA A;  2OPL B;  3K6R A;  3VNS A;  4A3M I;  1PG3 A;  4BC7 A;  4NH1 C;  5T8S A;  4KTT A;  1QVG Z;  1M6X A;  4NDN A;  5BUR A;  4A3C I;  1FUG A;  1KQS Z;  4HH4 A;  1FDI A;  2VPW A;  3M3Y I;  1RO4 A;  2GU2 A;  2QRE B;  1QXF A;  3TE5 B;  1Q86 1;  3NYR A;  1W2B Y;  4MXU A;  1NYE A;  3DAY A;  3MZL B;  4MD7 A;  4ODJ A;  4RVG A;  5DV9 A;  4DCT A;  2OTL 1;  2LFU A;  1XMO C;  1YUK A;  3GTP I;  4RVF A;  3IFU A;  1VQM Z;  1K73 1;  3I56 Z;  1VQO 1;  4DCU A;  3C5E A;  2HHH C;  1Z01 A;  2P2B A;  3RG2 A;  4JI5 C;  1N8R 1;  2NVQ I;  4JI8 C;  1RO2 A;  5BSW A;  1XRA A;  3LGX A;  3Q87 A;  2PRO A;  2VZE A;  2WD9 A;  1XNR C;  4BBR I;  4MTN A;  3NH8 A;  4S1T A;  3R9X A;  3G71 Z;  1K9M 2;  4I9F A;  3E7X A;  3MON A;  1LQL A;  3TDH B;  4RVN A;  1IBK C;  2ONF A;  1QYP A;  5FLM I;  1VQ5 Z;  2OPL A;  4JV5 C;  3G6E 1;  2K3R A;  3P5J B;  5IP9 I;  2F4M A;  4QTU A;  4E2W A;  3G4S Z;  3CCJ 1;  1M1K 2;  3S2D I;  1XHJ A;  2E7G A;  5LMN C;  2R7Z I;  2P02 A;  3S1Q I;  3S82 A;  3GKU A;  3TQI A;  1YJN Z;  4NBG A;  3LNO A;  2UUB C;  4GKK C;  3MZK B;  5BUS A;  4KHP C;  2RIQ A;  1Q7Y 1;  1N33 C;  2RPR A;  4A3J I;  2MMA B;  4RMN A;  5BSM A;  1VQP 1;  2QVX X;  2MCQ A;  3CCE 1;  1N2F A;  1P7L A;  3EQ6 A;  2R6M A;  3CCU 1;  1MDF A;  4RVD A;  5FLX f;  4OX9 C;  3CJE A;  1K8A 2;  2KPI A;  3CCS Z;  3CME 1;  3NH5 A;  2F4V C;  3S16 I;  2KI7 B;  3S17 I;  2VF1 A;  4JYA C;  3DHV A;  2JIR A;  1MXB A;  4DV7 C;  4BBY A;  3CCL 1;  5IT9 b;  1SIW A;  2UUC C;  1BA3 A;  4NBE A;  1Y1V S;  2M48 A;  2E5L C;  2QA4 Z;  3F3F C;  2VPY A;  2HU9 A;  4CL1 A;  3G7S A;  3FCE A;  3VNR A;  1NY8 A;  1RY2 A;  2ZZN A;  3GTM S;  1ZB9 A;  3NFZ A;  5IFI A;  1FLO A;  1JJ2 Z;  4L4Q A;  3GKQ A;  3HOX I;  2Q4Z A;  5BUQ A;  1HNX C;  3AY0 A;  3J80 D;  1VQO Z;  4GXR A;  4Y52 I;  4I9G A;  1N36 C;  1ZH1 A;  3KIF A;  4MD8 A;  5C3E I;  1K73 2;  1VQ6 1;  3PBK A;  2DE6 A;  4MON A;  2Q51 A;  4A3B I;  4X64 C;  4RLQ A;  4B3T C;  1WJ2 A;  4A93 I;  4RS4 A;  4BY1 I;  3CXC Y;  2VQF C;  2R92 I;  1PU1 A;  1WF3 A;  4E33 A;  4RM2 A;  2RBL A;  2Y27 A;  4DV4 C;  4MRI A;  4DG8 A;  5K8F A;  2PK7 A;  3VTN A;  4JI6 C;  4DCS A;  1L2F A;  3GR1 A;  3G71 1;  4U5Y D;  2PN2 A;  2JMO A;  3GCF A;  1TWA I;  2IV2 X;  2JIM A;  2P2Q A;  2QL8 A;  5IT9 D;  3CCJ Z;  2RHB A;  3NDI A;  1JOS A;  4LF9 C;  3CC4 1;  3I55 Z;  2KZ0 A;  1VQ4 Z;  5A2Q f;  2H85 A;  4NBD A;  3H2T A;  4ZLP A;  1Q7Y 2;  2LIY A;  4LFB C;  3PES A;  2NAP A;  1R9T I;  4G36 A;  3CCE Z;  1PG4 A;  5KEI A;  1P4E A;  1IBM C;  2ZAE B;  4L7I A;  2P2J A;  1KRL A;  2MM9 A;  2OBV A;  2VQE C;  3FCC A;  4DV5 C;  2NVY I;  2P20 A;  2VUG A;  5T6B A;  3CME Z;  4LFC C;  3PO3 S;  2EGT A;  2V8K A;  1K8A 1;  1YI2 1;  3HKZ A;  3NH4 A;  1KKG A;  5CZX A;  1I3Q I;  3L95 X;  5GTD A;  1AMU A;  4JI2 C;  3F3P C;  3CCS 1;  2D7V A;  4WS9 A;  1FJG C;  1VQL 1;  2CXC A;  1X3Z A;  2VPX A;  3CCL Z;  2E7Z A;  3KIH A;  2QVZ X;  4X6A I;  2QEX 1;  2YCB A;  5E7Q A;  4JI0 C;  4GKJ C;  1KQS Y;  1XNQ C;  2W04 A;  3J81 D;  3S1R I;  1EGA A;  2NCL A;  5AE3 A;  4RV9 A;  1Y1V I;  2QA4 1;  1QF8 A;  1XS3 A;  2DHM A;  1VQ9 Z;  3TUF A;  3CC7 1;  4NXM C;  5T8T A;  4DUY C;  4LF5 C;  2YWC A;  1Z02 A;  4DV2 C;  1SFO I;  2CY1 A;  3CQZ I;  4D4G A;  4EAT A;  1YIJ Z;  3CC2 1;  1VQ6 Z;  3GTM I;  2UUA C;  4ISB A;  1USP B;  3N54 B;  1V26 A;  4E32 A;  1ML8 A;  4PRO C;  1QWI A;  2OOX B;  4E2Z A;  3HOU I;  1VQK Z;  3CMA 1;  4RVH A;  1TH5 A;  2GTH A;  3VB9 A;  5A1G A;  3UX2 A;  3CCV Z;  2O53 A;  3CW8 X;  3GTJ I;  5ADZ A;  2AYD A;  3NDJ A;  3IEV A;  3TDE A;  3J7A 4;  2HJG A;  4WV3 A; 
#chains in the Genus database with same CATH homology
 1NP6 A;  4E2Y A;  3CC4 Z;  2K5R A;  4A3E I;  3GTG I;  5KYV A;  4K0B A;  3I55 1;  3GR0 A;  1VQ4 1;  5FLX b;  3ETO A;  3ESW A;  1KC8 1;  2JA8 I;  3NPD A;  5BSU A;  4TPS B;  4X66 C;  4X65 C;  2OTJ 1;  2Y4N A;  2D1S A;  5C4J I;  1USP A;  2NVX I;  1MDB A;  2KZF A;  3FQM A;  1YI2 Z;  4Y7N I;  2E8F A;  1X3W A;  3QWU A;  1Q81 1;  2YAD A;  1M90 1;  1LCI A;  2PM9 A;  2P2M A;  2P3Y A;  4OXI A;  1VQL Z;  3PO3 I;  3E7W A;  1Q82 1;  3CW9 A;  5CM2 M;  2QEX Z;  4LE5 A;  1Y1W I;  3I4N I;  3EER A;  4A3D I;  1XMQ C;  4D57 A;  5IWA C;  1JJ2 Y;  3CC7 Z;  4DV3 C;  5AE2 A;  3VNQ A;  1K83 I;  1VQ9 1;  2PT7 G;  5JRH A;  4JM1 A;  3CC2 Z;  2OZK A;  2JA6 I;  4KTV A;  1RNI A;  2OO4 A;  4DV6 C;  3U50 C;  3K7A I;  2D1T A;  2YWB A;  1YIJ 1;  4OYC A;  4BC9 A;  1YIT 1;  3CMA Z;  1HNZ C;  3S2H I;  4NB8 A;  4GS5 A;  3GPC A;  4IR7 A;  5D1O B;  4RVO A;  2W03 A;  1VQK 1;  4JI4 C;  1T5D X;  1TWC I;  3OW2 Z;  2D28 C;  3CCV 1;  2QR1 B;  3I07 A;  5A2Q b;  1HR0 C;  2QLV B;  1O9T A;  1IBL C;  4DR2 C;  1YUA A;  4BXX I;  3CPW Z;  4D56 A;  2QVY X;  2NVT I;  2BH1 X;  3IPL A;  2BJO A;  2P2F A;  4BBS I;  1O93 A;  3CD6 1;  3RZO I;  3S1N I;  1KC8 2;  3JAM f;  4DG9 A;  4TNU A;  4NXN C;  2OTJ Z;  2V7B A;  4R0M A;  1YJ9 Z;  1VQ7 1;  5CZV A;  4R1L A;  4A3K I;  5A1I A;  4G1I A;  4EWC A;  4MH4 A;  1Q81 2;  1M90 2;  2OOY B;  1YJW 1;  4DR5 C;  3EED A;  4NBC A;  5D1O A;  4DGL A;  4BY7 I;  5A19 A;  1Q82 2;  2JMP A;  5BSR A;  3S15 I;  1PFT A;  4D4I A;  1WII A;  1RLY A;  1YHQ Z;  3D9X A;  1VQN 1;  4RLF A;  1NJI 1;  4A3L I;  3J81 f;  2QW0 X;  3NI2 A;  5BST A;  3DLP X;  3D6W A;  4G37 A;  3L8C A;  4B3M C;  3N2Q A;  3IML A;  1RG9 A;  1VQ8 Z;  1QVF Z;  2ZM6 C;  3GTK I;  3VMI A;  5AE1 A;  4DV1 C;  4HPV A;  2E0G A;  3VMH A;  3I4M I;  1XRC A;  2VSQ A;  5BSV A;  3I08 A;  2DE5 A;  5LMU C;  1YIT Z;  2QKD A;  4B3S C;  1JWH C;  3CCQ 1;  4NB9 A;  4DCV A;  3R9W A;  2O4H A;  5T67 A;  3SO4 A;  2UU9 C;  5KYT A;  4A3F I;  3UOW A;  4GXQ A;  2DYJ A;  2D27 A;  4MD9 A;  2JNY A;  3OTO C;  4AYB A;  1S7M A;  4DR4 C;  4QTT A;  1MKY A;  1S72 1;  1T5H X;  1L1O C;  4YHH C;  3ETC A;  4JI7 C;  2WB1 A;  5T64 A;  2VUM I;  4E2X A;  1RQF A;  2DPL A;  3H0G I;  1NUI A;  4LF6 C;  1QM4 A;  4L2Z A;  1ZB8 A;  3CD6 Z;  2PMZ A;  1WH9 A;  1W2B Z;  3CCR 1;  4LF7 C;  4E30 A;  1RO0 A;  4AQY C;  1VQ7 Z;  4DUZ C;  2P28 A;  3BG1 B;  2JA7 I;  3S14 I;  3BG0 B;  3IEU A;  4DQY B;  3PRO C;  4LF8 C;  4NBA A;  1YJ9 1;  4NBH A;  1KD1 2;  2JUB A;  1YJW Z;  4NOZ A;  2E9H A;  1P9N A;  2M6N A;  2Y0S A;  4DR1 C;  3HOV I;  3HOW I;  4BSZ A;  3IF8 A;  4NBF A;  3CCM Z;  1VQN Z;  2D1R A;  3A9V A;  3RV2 A;  1HNW C;  2UXC C;  4JI1 C;  1NJI 2;  1V25 A;  1YHQ 1;  4PHT A;  2HF1 A;  1J5E C;  3J80 b;  4DR3 C;  2IZ3 A;  1XRB A;  4YY3 C;  3GTQ I;  5BR8 C;  2E2H I;  2V8I A;  2QRC B;  4ZJZ A;  3UZ0 A;  2IZ4 A;  3M4O I;  1K0R A;  1VQ8 1;  5FLX D;  3J80 f;  4RM3 A;  3T1H C;  3AF5 A;  1WW9 A;  3B7W A;  3CCQ Z;  2R93 I;  5IP7 I;  2V8J A;  3OW2 Y;  3RZD I;  4R1M A;  3VMG A;  2AKL A;  3GTL I;  2I3C A;  3IX0 A;  3CPW Y;  3H3V J;  4A3G I;  2WP0 C;  3LNV A;  1S72 Z;  2F4O A;  2B63 I;  1GPM A;  2YU9 I;  1UKK A;  1YJ7 A;  5IT9 f;  1I6H I;  1Q86 2;  3JAM b;  4X62 C;  2JA5 I;  3KXW A;  2OTL Z;  2XR1 A;  1WCM I;  2E2I I;  2D1Q A;  3PO2 I;  3CCR Z;  2G2K A;  4DK1 A;  1VQM 1;  3I56 1;  4HGZ A;  3T1Y C;  2DE7 A;  3HOZ I;  1MXA A;  1N8R 2;  3S1M I;  5H9U A;  2E2J I;  1ULT A;  3LAX A;  4IZ6 A;  1I94 C;  4NBB A;  1X0T A;  5C4X I;  1K9M 1;  3R44 A;  4LF4 C;  1KD1 1;  4HGY A;  4E31 A;  1VLA A;  3CXC Z;  3J81 b;  5LL6 f;  3G6E Z;  1O92 A;  5D1P A;  4DR6 C;  2Y4O A;  4K0K C;  3AF6 A;  1M1K 1;  1VQ5 1;  1PA4 A;  3A9U A;  4PZP A;  3FKI I;  3HOY I;  5K85 A;  2J6A A;  4DV0 C;  2QRD B;  3G4S 1;  4LFA C;  3CCM 1;  4A3I I;  4FUQ A;  5A2Q D;  2JR6 A;  3GTO I;  1I50 I;  4DR7 C;  5AN9 F;  1MXC A;  1VQP Z;  1QVF Y;  1YJN 1;  1N34 C;  3LUS A;  3JAM D;  2E8E A;  4FTF A;  2ASB A;  1N32 C;  3T4N B;  2WAQ A;  3CCU Z;  1TWG I;  1Z03 A;  2RT9 A;  2GTI A;  5C44 I;  2UXB C;  3A4I A;  2UXD C;  4XX2 A;  1TFI A;  1O90 A;  1TWF I;  1MD9 A;  1DL6 A;  2AYA A;  1HH2 P;  2ATW A;  1QVG Y;  3NYQ A;  4JI3 C;  3FQQ A;  4B3R C;  2E8C A;  1TWH I;  2JS4 A;  4FUT A;  4NFR A;  4BCA A;  2OPL B;  3VNS A;  4A3M I;  1PG3 A;  4BC7 A;  4NH1 C;  5T8S A;  4KTT A;  1QVG Z;  4NDN A;  5BUR A;  4A3C I;  1FUG A;  1KQS Z;  4HH4 A;  3M3Y I;  1RO4 A;  2GU2 A;  2QRE B;  3TE5 B;  1Q86 1;  3NYR A;  1W2B Y;  4MXU A;  1NYE A;  3DAY A;  3MZL B;  4MD7 A;  4ODJ A;  4RVG A;  5DV9 A;  4DCT A;  2OTL 1;  2LFU A;  1XMO C;  1YUK A;  3GTP I;  4RVF A;  3IFU A;  1VQM Z;  1K73 1;  3I56 Z;  1VQO 1;  4DCU A;  3C5E A;  2HHH C;  1Z01 A;  2P2B A;  3RG2 A;  4JI5 C;  1N8R 1;  2NVQ I;  4JI8 C;  1RO2 A;  5BSW A;  1XRA A;  3LGX A;  3Q87 A;  2PRO A;  2VZE A;  2WD9 A;  1XNR C;  4BBR I;  4MTN A;  3NH8 A;  4S1T A;  3R9X A;  3G71 Z;  1K9M 2;  4I9F A;  3E7X A;  3MON A;  1LQL A;  3TDH B;  4RVN A;  1IBK C;  2ONF A;  1QYP A;  5FLM I;  1VQ5 Z;  2OPL A;  4JV5 C;  3G6E 1;  2K3R A;  3P5J B;  5IP9 I;  2F4M A;  4QTU A;  4E2W A;  3G4S Z;  3CCJ 1;  1M1K 2;  3S2D I;  2E7G A;  5LMN C;  2R7Z I;  2P02 A;  3S1Q I;  3S82 A;  3GKU A;  3TQI A;  1YJN Z;  4NBG A;  2UUB C;  4GKK C;  3MZK B;  5BUS A;  4KHP C;  2RIQ A;  1Q7Y 1;  1N33 C;  2RPR A;  4A3J I;  4RMN A;  5BSM A;  1VQP 1;  2QVX X;  3CCE 1;  1N2F A;  1P7L A;  3EQ6 A;  2R6M A;  3CCU 1;  1MDF A;  4RVD A;  5FLX f;  4OX9 C;  3CJE A;  1K8A 2;  2KPI A;  3CCS Z;  3CME 1;  3NH5 A;  2F4V C;  3S16 I;  2KI7 B;  3S17 I;  2VF1 A;  4JYA C;  3DHV A;  1MXB A;  4DV7 C;  4BBY A;  3CCL 1;  5IT9 b;  2UUC C;  1BA3 A;  4NBE A;  1Y1V S;  2M48 A;  2E5L C;  2QA4 Z;  3F3F C;  2HU9 A;  4CL1 A;  3G7S A;  3FCE A;  3VNR A;  1RY2 A;  3GTM S;  1ZB9 A;  3NFZ A;  5IFI A;  1JJ2 Z;  4L4Q A;  3GKQ A;  3HOX I;  2Q4Z A;  5BUQ A;  1HNX C;  3J80 D;  1VQO Z;  4GXR A;  4Y52 I;  4I9G A;  1N36 C;  1ZH1 A;  3KIF A;  4MD8 A;  5C3E I;  1K73 2;  1VQ6 1;  3PBK A;  2DE6 A;  4MON A;  2Q51 A;  4A3B I;  4X64 C;  4RLQ A;  4B3T C;  4A93 I;  4RS4 A;  4BY1 I;  3CXC Y;  2VQF C;  2R92 I;  1WF3 A;  4E33 A;  4RM2 A;  2RBL A;  2Y27 A;  4DV4 C;  4MRI A;  4DG8 A;  5K8F A;  2PK7 A;  3VTN A;  4JI6 C;  4DCS A;  1L2F A;  3GR1 A;  3G71 1;  4U5Y D;  2PN2 A;  2JMO A;  3GCF A;  1TWA I;  2P2Q A;  2QL8 A;  5IT9 D;  3CCJ Z;  2RHB A;  3NDI A;  1JOS A;  4LF9 C;  3CC4 1;  3I55 Z;  1VQ4 Z;  5A2Q f;  2H85 A;  4NBD A;  3H2T A;  4ZLP A;  1Q7Y 2;  2LIY A;  4LFB C;  3PES A;  1R9T I;  4G36 A;  3CCE Z;  1PG4 A;  5KEI A;  1IBM C;  2ZAE B;  4L7I A;  2P2J A;  1KRL A;  2OBV A;  2VQE C;  3FCC A;  4DV5 C;  2NVY I;  2P20 A;  2VUG A;  5T6B A;  3CME Z;  4LFC C;  3PO3 S;  2EGT A;  2V8K A;  1K8A 1;  1YI2 1;  3HKZ A;  3NH4 A;  1KKG A;  5CZX A;  1I3Q I;  3L95 X;  5GTD A;  1AMU A;  4JI2 C;  3F3P C;  3CCS 1;  2D7V A;  4WS9 A;  1FJG C;  1VQL 1;  2CXC A;  1X3Z A;  3CCL Z;  3KIH A;  2QVZ X;  4X6A I;  2QEX 1;  2YCB A;  5E7Q A;  4JI0 C;  4GKJ C;  1KQS Y;  1XNQ C;  2W04 A;  3J81 D;  3S1R I;  1EGA A;  5AE3 A;  4RV9 A;  1Y1V I;  2QA4 1;  1QF8 A;  1VQ9 Z;  3TUF A;  3CC7 1;  4NXM C;  5T8T A;  4DUY C;  4LF5 C;  2YWC A;  1Z02 A;  4DV2 C;  1SFO I;  2CY1 A;  3CQZ I;  4D4G A;  4EAT A;  1YIJ Z;  3CC2 1;  1VQ6 Z;  3GTM I;  2UUA C;  4ISB A;  1USP B;  3N54 B;  1V26 A;  4E32 A;  1ML8 A;  4PRO C;  1QWI A;  2OOX B;  4E2Z A;  3HOU I;  1VQK Z;  3CMA 1;  4RVH A;  5A1G A;  2GTH A;  3VB9 A;  3CCV Z;  2O53 A;  3CW8 X;  3GTJ I;  5ADZ A;  3NDJ A;  3IEV A;  3TDE A;  3J7A 4;  2HJG A;  4WV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...