2EGTA

Crystal structure of hypothetical protein (aq1549) from aquifex aeolicus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AQ_1549
publication title Crystal Structure of Hypothetical protein (AQ1549) from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
total genus 42
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.300 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2egtA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2egtA02
1L2FA 1I94C 3J81D 4JI8C 1JOSA 4DR6C 4DR7C 2UXDC 2CXCA 4GKKC 2HJGA 4DV1C 1LQLA 2EGTA 4NXMC 3R9WA 5LMNC 5IT9D 4YY3C 4DR4C 4JV5C 4DR3C 4KHPC 1QWIA 4GKJC 2HHHC 4X64C 1NYEA 2CY1A 4LF9C 4X66C 1ZB8A 4JI6C 2D7VA 5IWAC 4LFAC 3OTOC 1HR0C 4LF6C 3IEVA 4XX2A 3I07A 2JMPA 1N32C 4DV2C 1KKGA 1N2FA 4JI3C 3JAMD 3CJEA 4JI0C 2UXBC 2ATWA 1EGAA 3LUSA 3EERA 2E5LC 5FLXD 4K0KC 4DV5C 4B3RC 2XR1A 1XNRC 4JI4C 1ML8A 4X65C 2DYJA 2VQEC 2PT7G 4B3SC 2UUCC 3IEUA 4LFCC 1N34C 1WF3A 4X62C 4DV6C 4JI5C 2E8CA 3T1HC 1K0RA 3GKUA 5A2QD 3T1YC 4LFBC 4LF7C 4JI7C 2YCBA 2UUAC 1XNQC 1XMQC 3J80D 1ZB9A 4NXNC 1HNZC 4DV0C 1XMOC 1N36C 2OPLB 3AF6A 1IBMC 4DR1C 1IBKC 4LF4C 2ZM6C 1USPB 2E7GA 4LF8C 1UKKA 4DUZC 1J5EC 1HH2P 2UU9C 3R9XA 4DCUA 4DV4C 3AF5A 2E8FA 4B3TC 2VQFC 2PN2A 4DR5C 4MTNA 1PA4A 1N33C 4BSZA 2QL8A 4DV3C 1HNXC 4DCTA 2BJOA 2F4VC 5BR8C 4DCVA 4YHHC 4DR2C 2UUBC 4B3MC 5LMUC 4JI1C 2OPLA 2ASBA 4JI2C 1WH9A 4JYAC 2ONFA 1IBLC 4DV7C 1HNWC 1VLAA 4MH4A 4AQYC 1USPA 1FJGC 1MKYA 4DUYC 2KZFA 2E8EA 2UXCC 4DCSA 4LF5C 4OX9C 4NOZA
chains in the Genus database with same CATH superfamily
4A3CI 2P2QA 5DV9A 5KYTA 2E9HA 1I94C 2Q4ZA 4DR7C 1JOSA 1Z01A 2UXDC 4NFRA 2NAPA 1WZNA 1RLYA 1YHQZ 4BBSI 2E0GA 3R9WA 1Q16A 4MONA 5LMNC 4YY3C 3S2HI 2DPLA 5K8FA 3CCE1 4DGLA 1V25A 4PUGA 4RMNA 1YUKA 4X64C 1NYEA 4ISBA 2JIMA 4G37A 2JA8I 3GTKI 2MM9A 2LEXA 4OYCA 3BG0B 1VQNZ 2OBVA 3PESA 4LF6C 3IEVA 4XX2A 4PUIA 3DHVA 1O93A 3GPCA 3J81f 1Z03A 1KKGA 1N2FA 3NDIA 3FQQA 3CPWY 5BUQA 1S7MA 1Y8CA 3JAMD 4E2YA 2V8JA 4NDNA 4GXQA 5BURA 4GXRA 2ATWA 3S16I 2D1TA 2V45A 2IV2X 1GPMA 3CCQ1 3A26A 2R93I 5BSVA 5GTDA 4DV5C 1P9NA 3HOWI 1M6XC 4NBCA 3U50C 2E7ZA 1NJI2 3FCEA 3RV2A 1MXBA 1RNIA 3J81b 3GTPI 3HOVI 1YI2Z 5AN9F 2QVYX 4JI4C 2AYDA 2DYJA 2IZ4A 4NB8A 1NP6A 3N54B 2F4MA 3R44A 3UOWA 3VMGA 1N34C 2R7ZI 4Y52I 1ZH1A 3I55Z 4DV6C 2D1RA 3BG1B 2ZAEB 3T1HC 2JUBA 4NBEA 4BY7I 1Y1WI 3CW8X 4K0BA 5A1IA 2OOXB 1XMQC 2K3RA 1AMUA 5BSTA 2VUMI 4D4IA 1XMOC 5LCIA 5IP7I 2JS4A 2JIRA 5E7QA 3AF6A 2YWCA 2D28C 4A93I 3CC41 3GR1A 4LF4C 2P2BA 1M901 1USPB 3GTQI 4NBBA 3CCEZ 1MXAA 1UKKA 3G6E1 1VQ71 4DUZC 2QW0X 3MZLB 1K732 2V8KA 1S721 3K7AI 4RVFA 1XRBA 1ULTA 3SO4A 3R9XA 3D6WA 1VQO1 4B3TC 2R92I 1TWAI 4G36A 4IR7A 3GTMI 4A3BI 3O2EA 1FLOA 2QEX1 1M902 1Z02A 3G4S1 4BSZA 2VSQA 1WCMI 3PO3I 1XHJA 2F4VC 1YIT1 3D9XA 3CCQZ 1XS3A 2WAQA 1LCIA 4PZPA 3RG2A 4DCVA 2UUBC 4BC9A 2F4OA 5BSUA 2ASBA 1RG9A 3VB9A 4JI2C 1WH9A 3NH4A 1V60A 2ONFA 1MXCA 1HNWC 2RPRA 1VQ41 3NFZA 4JM1A 1P4EA 4DK1A 1K8A2 4DUYC 3CPWZ 1QVGY 3GTLI 4LF5C 2PMZA 3TUFA 4NBDA 3S82A 1WJ2A 3EEDA 3CCJ1 4FUTA 1XRCA 2RT9A 1YJ7A 1TWHI 4ZLPA 5T8TA 2CXCA 2HJGA 2I3CA 3L95X 3CME1 1Y1VS 2P20A 4GS5A 3P5JB 3IR7A 4U5YD 3H3VJ 4NXMC 2P2MA 2Z51A 3CCMZ 4KTTA 4G1IA 3G6EZ 1VQ7Z 1QWIA 2IZ3A 4RM3A 4GKJC 1S72Z 2CY1A 3A25A 5A1GA 3S17I 4ZJZA 3GKQA 3D2LA 1W2BY 4NBHA 3OTOC 1AA6A 1Q861 3LAXA 2JMPA 3GR0A 1MDFA 3UX3A 2QEXZ 4CL1A 1N32C 2HU9A 3G4SZ 2OTL1 1VEHA 3DLPX 4JI0C 1JJ2Y 3CCL1 3EERA 1YITZ 4A3LI 2E5LC 2WD9A 5IT9f 5IP9I 3FQMA 2CU6A 1DL6A 1N8R2 4TNUA 1VQ91 1Q862 4X65C 1X3ZA 1T5DX 4X6AI 3CCU1 2QLVB 3HOYI 1RO4A 2PT7G 3I08A 3ETCA 3IEUA 2UUCC 4A3JI 3GTGI 2LFUA 4JI5C 4BBRI 1P7LA 2E8CA 3CCV1 1NJI1 5IT9b 3CCJZ 3OW2Y 2Y4OA 4E2WA 1TWFI 4LFBC 4WV3A 4JI7C 3MONA 1XNQC 2JR6A 3CMEZ 3J80D 4S1TA 3S15I 1HNZC 1VQL1 1N36C 1YJ91 1VQK1 3CQ1A 2WB1A 2JA6I 5FLXf 3IPLA 4D57A 1QVGZ 1WCJA 2O4HA 3S1QI 2E7GA 3E7XA 4PHTA 1P4EC 3S1NI 1J5EC 2DHMA 2UU9C 4QTTA 1RO0A 3FKII 4DG8A 5T6BA 1VQMZ 5FLXb 3NYQA 3RZOI 1Q821 2P3YA 2PN2A 4DR5C 4MTNA 1WW9A 1K731 1SFOI 3TDEA 1O90A 3HKZA 3GTOI 2QL8A 3CCLZ 1HNXC 4A3FI 4OXIA 4DCTA 2H85A 1VQ61 1K9M2 3VNRA 1PU1A 5BR8C 4YHHC 5D1PA 4B3MC 1VQ51 5ADZA 2YU9I 1VQ81 1YUAA 2VPZA 4LE5A 1VQ9Z 4EATA 1O92A 1W2BZ 1Q822 3HOUI 2P2FA 4RV9A 3CCUZ 1MD9A 4MH4A 4HH4A 3CW9A 1USPA 3PBKA 2OZKA 1MKYA 2YX1A 2E8EA 4HPVA 5C3EI 4L7IA 4MD7A 1JJ2Z 3M4OI 1I3QI 4AYBA 3CCVZ 4E33A 2QR1B 5C44I 4WS9A 5T67A 1FDIA 1L2FA 2RHBA 2M5HA 3J81D 4JI8C 2YADA 3UEBA 4DR6C 2V8IA 3MZKB 1TWCI 3GCFA 1K8A1 3PO2I 1BA3A 4DV1C 1VQKZ 2QRCB 1SIWA 2DE5A 1IB8A 2KZ0A 2DE6A 3L8CA 3KXWA 4DR4C 2ZZNA 4D56A 3IF8A 4JV5C 4NB9A 4RLQA 3K6RA 1YJN1 3DAYA 3OW2Z 5IFIA 2P28A 2BH1X 5CM2M 4LF9C 2QREB 3CC21 3KIFA 4X66C 4L4QA 1ZB8A 4JI6C 3J7A4 2D7VA 4R1LA 5IWAC 4BBYA 3G7SA 3UX2A 1TWGI 1KRLA 3CJEA 4Y7NI 3TE5B 3LGXA 2UXBC 2E2HI 1EGAA 1QF8A 3LUSA 4I9GA 2VPXA 2Q51A 3N2QA 1YJW1 1RO2A 2QKDA 3VTNA 1RQFA 3CC4Z 3PROC 2Y27A 2PK7A 3TR3A 1Q811 1QXFA 2QA41 2E2II 3CC71 5A19A 4E2XA 4B3SC 1FDOA 3I561 4LFCC 1WIIA 1WF3A 1VQOZ 2O53A 1N8R1 1PG3A 1K0RA 3ETOA 1VQP1 3T1YC 2VUGA 4LF7C 1Q812 3M3YI 5FLMI 2UUAC 2JMOA 3EQ6A 4NXNC 2KDNA 2PROA 1M1K2 3CXCY 1MDBA 2OPLB 4D4GA 5T64A 2Y4NA 1IBMC 3TDHB 2DE7A 1RY2A 2KI7B 1KQSY 2YWBA 3LNVA 4A3DI 4FTFA 4DG9A 3VNSA 1YJNZ 4LF8C 3IX0A 1HH2P 3CC2Z 3JAMb 1KD12 1VQ4Z 3Q87A 4MD9A 2RBLA 1Q7Y2 2JIOA 5C4XI 5BUSA 5AE3A 4DV4C 2KPIA 2E8FA 3NH8A 2PM9A 2VQFC 3GTMS 2QRDB 2NVYI 2M6NA 4E32A 1PA4A 3T4NB 2VZEA 2JA7I 2OOYB 3PO3S 2W04A 4PUHA 3A9UA 4L2ZA 5CZVA 2BJOA 4MRIA 1YJWZ 2AKLA 3S1MI 3CD61 4JI1C 4BCAA 4NBFA 4RVDA 2VPYA 1I50I 2QA4Z 4JYAC 3CC7Z 4A3EI 5BSMA 3TQIA 3VMIA 1VLAA 4AQYC 3LNOA 3H0GI 2JIPA 1K9M1 2P02A 1FJGC 3I56Z 3NDJA 3NI2A 5H9UA 1QVFY 4R1MA 1K83I 2QVXX 2D1QA 1YIJ1 4NOZA 4MXUA 4RVGA 1TFIA 1VQPZ 5AE1A 4NH1C 5D1OB 5A2Qf 2OTJ1 5KYVA 2OTLZ 2NVTI 4GKKC 5BSRA 4RS4A 5D1OA 2G2KA 2M48A 1LQLA 2EGTA 1KC81 4IZ6A 5CZXA 4RVOA 2V3VA 3IFUA 3GTJI 1Y1VI 3CCR1 1I6HI 5IT9D 3QWUA 4FUQA 2QVZX 1PG4A 1FUGA 4DR3C 4KHPC 3UZ0A 3NYRA 5A2Qb 2HHHC 3F3PC 2MMAB 5K85A 4TPSB 5T8SA 5JRHA 5C4JI 4A3GI 3G711 3CQ2A 1QYPA 3FCCA 3CXCZ 1KC82 2Y0SA 1T5HX 4LFAC 1HR0C 2D1SA 3I07A 4E31A 1TH5A 2NCLA 2VF1A 4MD8A 3B7WA 4DV2C 1X3WA 1KQSZ 4EWCA 4JI3C 5BSWA 4QTUA 2HF1A 2JIQA 4R0MA 2WP0C 1VQLZ 4NBAA 3CCS1 1L1OC 1YJ9Z 3CD6Z 4A3MI 3A4IA 5KEIA 5FLXD 4K0KC 3NH5A 1XRAA 3A9VA 4B3RC 3CCM1 3ESWA 4E2ZA 2XR1A 2JA5I 4PROC 2AYAA 1XNRC 1UWDA 1O9TA 1ML8A 4RVHA 2NVXI 3CMA1 2VQEC 2R6MA 2JNVA 4X62C 3HOZI 1YIJZ 1X0TA 2NVQI 3NPDA 2W03A 2VPWA 4NBGA 2J6AA 3GKUA 3RZDI 5A2QD 2OTJZ 3AY0A 3CQZI 3H2TA 2YCBA 4A3II 1ZB9A 3HOXI 1NY8A 4DV0C 2ZZMA 1PFTA 3CCRZ 1VQ6Z 1YHQ1 4BXXI 2MCQA 4DQYB 1VQ5Z 3S14I 3VNQA 4DR1C 1IBKC 1QVFZ 2ZM6C 1VQ8Z 4RLFA 4HGZA 1NUIA 1V26A 2B63I 1M1K1 1M6XA 3G71Z 3I4NI 2GU2A 2D27A 3E7WA 4DCUA 3AF5A 3I4MI 3KIHA 3IMLA 4I9FA 3C5EA 1VQN1 2E2JI 4HGYA 4RM2A 1KD11 1N33C 2LIYA 1Q7Y1 2M5OA 3J80f 2K5RA 3JAMf 4DV3C 3CCSZ 1QM4A 4DR2C 2V7BA 5LL6f 5LMUC 2P2JA 2OPLA 2RIQA 4KTVA 2OO4A 4RVNA 3VMHA 3CQ3A 1IBLC 2GTHA 4DV7C 3CMAZ 3S2DI 1YI21 3S1RI 3J80b 1R9TI 3F3FC 2KZFA 4BC7A 2UXCC 1JWHC 4DCSA 4BY1I 1VQM1 4OX9C 2GTIA 3I551 4A3KI 4ODJA 5AE2A 4E30A 2JNYA
chains in the Genus database with same CATH topology
4A3CI 2P2QA 5DV9A 5KYTA 2E9HA 1I94C 2Q4ZA 4DR7C 1JOSA 1Z01A 2UXDC 4NFRA 1RLYA 1YHQZ 4BBSI 2E0GA 3R9WA 4MONA 5LMNC 4YY3C 3S2HI 2DPLA 5K8FA 3CCE1 4DGLA 1V25A 4RMNA 1YUKA 4X64C 1NYEA 4ISBA 4G37A 2JA8I 3GTKI 4OYCA 3BG0B 1VQNZ 2OBVA 3PESA 4LF6C 3IEVA 4XX2A 3DHVA 1O93A 3GPCA 3J81f 1Z03A 1KKGA 1N2FA 3NDIA 3FQQA 3CPWY 5BUQA 1S7MA 3JAMD 4E2YA 2V8JA 4NDNA 4GXQA 5BURA 4GXRA 2ATWA 3S16I 2D1TA 1GPMA 3CCQ1 2R93I 5BSVA 5GTDA 4DV5C 1P9NA 3HOWI 4NBCA 3U50C 1NJI2 3RV2A 3FCEA 1MXBA 1RNIA 3J81b 3GTPI 3HOVI 1YI2Z 5AN9F 2QVYX 4JI4C 2DYJA 2IZ4A 4NB8A 1NP6A 3N54B 2F4MA 3R44A 3UOWA 3VMGA 1N34C 2R7ZI 4Y52I 1ZH1A 3I55Z 4DV6C 2D1RA 3BG1B 2ZAEB 3T1HC 2JUBA 4NBEA 4BY7I 1Y1WI 3CW8X 4K0BA 5A1IA 2OOXB 1XMQC 2K3RA 1AMUA 5BSTA 2VUMI 4D4IA 1XMOC 5IP7I 2JS4A 5E7QA 3AF6A 2YWCA 2D28C 4A93I 3CC41 3GR1A 4LF4C 2P2BA 1M901 1USPB 3GTQI 4NBBA 3CCEZ 1MXAA 1UKKA 3G6E1 1VQ71 4DUZC 2QW0X 3MZLB 1K732 2V8KA 1S721 3K7AI 4RVFA 1XRBA 1ULTA 3SO4A 3R9XA 3D6WA 1VQO1 4B3TC 2R92I 1TWAI 4G36A 4IR7A 3GTMI 4A3BI 2QEX1 1M902 1Z02A 3G4S1 4BSZA 2VSQA 1WCMI 3PO3I 2F4VC 1YIT1 3D9XA 3CCQZ 4PZPA 2WAQA 1LCIA 3RG2A 4DCVA 2UUBC 4BC9A 2F4OA 5BSUA 2ASBA 1RG9A 3VB9A 4JI2C 1WH9A 3NH4A 2ONFA 1MXCA 1HNWC 2RPRA 1VQ41 3NFZA 4JM1A 4DK1A 1K8A2 4DUYC 3CPWZ 1QVGY 3GTLI 4LF5C 2PMZA 3TUFA 4NBDA 3S82A 3EEDA 3CCJ1 4FUTA 1XRCA 2RT9A 1YJ7A 1TWHI 4ZLPA 5T8TA 2CXCA 2HJGA 2I3CA 3L95X 3CME1 1Y1VS 2P20A 4GS5A 3P5JB 4U5YD 3H3VJ 4NXMC 2P2MA 3CCMZ 4KTTA 4G1IA 3G6EZ 1VQ7Z 1QWIA 2IZ3A 4RM3A 4GKJC 1S72Z 2CY1A 5A1GA 3S17I 4ZJZA 3GKQA 1W2BY 4NBHA 3OTOC 1Q861 3LAXA 2JMPA 3GR0A 1MDFA 2QEXZ 4CL1A 1N32C 2HU9A 3G4SZ 2OTL1 3DLPX 4JI0C 1JJ2Y 3CCL1 3EERA 1YITZ 4A3LI 2E5LC 2WD9A 5IT9f 5IP9I 3FQMA 1DL6A 1N8R2 4TNUA 1VQ91 1Q862 4X65C 1X3ZA 1T5DX 4X6AI 3CCU1 2QLVB 3HOYI 1RO4A 2PT7G 3I08A 3ETCA 3IEUA 2UUCC 4A3JI 3GTGI 2LFUA 4JI5C 4BBRI 1P7LA 2E8CA 3CCV1 1NJI1 5IT9b 3CCJZ 3OW2Y 2Y4OA 4E2WA 1TWFI 4LFBC 4WV3A 4JI7C 3MONA 1XNQC 2JR6A 3CMEZ 3J80D 4S1TA 3S15I 1HNZC 1VQL1 1N36C 1YJ91 1VQK1 2WB1A 2JA6I 5FLXf 3IPLA 4D57A 1QVGZ 2O4HA 3S1QI 2E7GA 3E7XA 4PHTA 3S1NI 1J5EC 2UU9C 4QTTA 1RO0A 3FKII 4DG8A 5T6BA 1VQMZ 5FLXb 3NYQA 3RZOI 1Q821 2P3YA 2PN2A 4DR5C 4MTNA 1WW9A 1K731 1SFOI 3TDEA 1O90A 3HKZA 3GTOI 2QL8A 3CCLZ 1HNXC 4A3FI 4OXIA 4DCTA 2H85A 1VQ61 1K9M2 3VNRA 5BR8C 4YHHC 5D1PA 4B3MC 1VQ51 5ADZA 2YU9I 1VQ81 1YUAA 4LE5A 1VQ9Z 4EATA 1O92A 1W2BZ 1Q822 3HOUI 2P2FA 4RV9A 3CCUZ 1MD9A 4MH4A 4HH4A 3CW9A 1USPA 3PBKA 2OZKA 1MKYA 2E8EA 4HPVA 5C3EI 4L7IA 4MD7A 1JJ2Z 3M4OI 1I3QI 4AYBA 3CCVZ 4E33A 2QR1B 5C44I 4WS9A 5T67A 1L2FA 2RHBA 3J81D 4JI8C 2YADA 4DR6C 2V8IA 3MZKB 1TWCI 3GCFA 1K8A1 3PO2I 1BA3A 4DV1C 1VQKZ 2QRCB 2DE5A 2DE6A 3L8CA 3KXWA 4DR4C 4D56A 3IF8A 4JV5C 4NB9A 4RLQA 1YJN1 3DAYA 3OW2Z 5IFIA 2P28A 2BH1X 5CM2M 4LF9C 2QREB 3CC21 3KIFA 4X66C 4L4QA 1ZB8A 4JI6C 3J7A4 2D7VA 4R1LA 5IWAC 4BBYA 3G7SA 1TWGI 1KRLA 3CJEA 4Y7NI 3TE5B 3LGXA 2UXBC 2E2HI 1EGAA 1QF8A 3LUSA 4I9GA 2Q51A 3N2QA 1YJW1 1RO2A 2QKDA 3VTNA 1RQFA 3CC4Z 3PROC 2Y27A 2PK7A 1Q811 2QA41 2E2II 3CC71 5A19A 4E2XA 4B3SC 3I561 4LFCC 1WIIA 1WF3A 1VQOZ 2O53A 1N8R1 1PG3A 1K0RA 3ETOA 1VQP1 3T1YC 2VUGA 4LF7C 1Q812 3M3YI 5FLMI 2UUAC 2JMOA 3EQ6A 4NXNC 2PROA 1M1K2 3CXCY 1MDBA 2OPLB 4D4GA 5T64A 2Y4NA 1IBMC 3TDHB 2DE7A 1RY2A 2KI7B 1KQSY 2YWBA 3LNVA 4A3DI 4FTFA 4DG9A 3VNSA 1YJNZ 4LF8C 3IX0A 1HH2P 3CC2Z 3JAMb 1KD12 1VQ4Z 3Q87A 4MD9A 2RBLA 1Q7Y2 5C4XI 5BUSA 5AE3A 4DV4C 2KPIA 2E8FA 3NH8A 2PM9A 2VQFC 3GTMS 2QRDB 2NVYI 2M6NA 4E32A 1PA4A 3T4NB 2VZEA 2JA7I 2OOYB 3PO3S 2W04A 3A9UA 4L2ZA 5CZVA 2BJOA 4MRIA 1YJWZ 2AKLA 3S1MI 3CD61 4JI1C 4BCAA 4NBFA 4RVDA 1I50I 2QA4Z 4JYAC 3CC7Z 4A3EI 5BSMA 3TQIA 3VMIA 1VLAA 4AQYC 3H0GI 1K9M1 2P02A 1FJGC 3I56Z 3NDJA 3NI2A 5H9UA 1QVFY 4R1MA 1K83I 2QVXX 2D1QA 1YIJ1 4NOZA 4MXUA 4RVGA 1TFIA 1VQPZ 5AE1A 4NH1C 5D1OB 5A2Qf 2OTJ1 5KYVA 2OTLZ 2NVTI 4GKKC 5BSRA 4RS4A 5D1OA 2G2KA 2M48A 1LQLA 2EGTA 1KC81 4IZ6A 5CZXA 4RVOA 3GTJI 3IFUA 3CCR1 1Y1VI 1I6HI 5IT9D 3QWUA 4FUQA 2QVZX 1PG4A 1FUGA 4DR3C 4KHPC 3UZ0A 3NYRA 5A2Qb 2HHHC 3F3PC 5K85A 4TPSB 5T8SA 5JRHA 5C4JI 4A3GI 3G711 1QYPA 3FCCA 3CXCZ 1KC82 2Y0SA 1T5HX 4LFAC 1HR0C 2D1SA 3I07A 4E31A 2VF1A 4MD8A 3B7WA 4DV2C 1X3WA 1KQSZ 4EWCA 4JI3C 5BSWA 4QTUA 2HF1A 4R0MA 2WP0C 1VQLZ 4NBAA 3CCS1 1L1OC 1YJ9Z 3CD6Z 4A3MI 3A4IA 5KEIA 5FLXD 4K0KC 3NH5A 1XRAA 3A9VA 4B3RC 3CCM1 3ESWA 4E2ZA 2XR1A 2JA5I 4PROC 2AYAA 1XNRC 1O9TA 1ML8A 4RVHA 2NVXI 3CMA1 2VQEC 2R6MA 4X62C 3HOZI 1YIJZ 1X0TA 2NVQI 3NPDA 2W03A 4NBGA 2J6AA 3GKUA 3RZDI 5A2QD 2OTJZ 3CQZI 3H2TA 2YCBA 4A3II 1ZB9A 3HOXI 4DV0C 1PFTA 3CCRZ 1VQ6Z 1YHQ1 4BXXI 4DQYB 1VQ5Z 3S14I 3VNQA 4DR1C 1IBKC 1QVFZ 2ZM6C 1VQ8Z 4RLFA 4HGZA 1NUIA 1V26A 2B63I 1M1K1 3G71Z 3I4NI 2GU2A 2D27A 3E7WA 4DCUA 3AF5A 3I4MI 3KIHA 3IMLA 4I9FA 3C5EA 1VQN1 2E2JI 4HGYA 4RM2A 1KD11 1N33C 2LIYA 1Q7Y1 3J80f 2K5RA 3JAMf 4DV3C 3CCSZ 1QM4A 4DR2C 2V7BA 5LL6f 5LMUC 2P2JA 2OPLA 2RIQA 4KTVA 2OO4A 4RVNA 3VMHA 1IBLC 2GTHA 4DV7C 3CMAZ 3S2DI 1YI21 3S1RI 3J80b 1R9TI 3F3FC 2KZFA 4BC7A 2UXCC 1JWHC 4DCSA 4BY1I 1VQM1 4OX9C 2GTIA 3I551 4A3KI 4ODJA 5AE2A 4E30A 2JNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L2F A;  1I94 C;  3J81 D;  4JI8 C;  1JOS A;  4DR6 C;  4DR7 C;  2UXD C;  2CXC A;  4GKK C;  2HJG A;  4DV1 C;  1LQL A;  2EGT A;  4NXM C;  3R9W A;  5LMN C;  5IT9 D;  4YY3 C;  4DR4 C;  4JV5 C;  4DR3 C;  4KHP C;  1QWI A;  4GKJ C;  2HHH C;  4X64 C;  1NYE A;  2CY1 A;  4LF9 C;  4X66 C;  1ZB8 A;  4JI6 C;  2D7V A;  5IWA C;  4LFA C;  3OTO C;  1HR0 C;  4LF6 C;  3IEV A;  4XX2 A;  3I07 A;  2JMP A;  1N32 C;  4DV2 C;  1KKG A;  1N2F A;  4JI3 C;  3JAM D;  3CJE A;  4JI0 C;  2UXB C;  2ATW A;  1EGA A;  3LUS A;  3EER A;  2E5L C;  5FLX D;  4K0K C;  4DV5 C;  4B3R C;  2XR1 A;  1XNR C;  4JI4 C;  1ML8 A;  4X65 C;  2DYJ A;  2VQE C;  2PT7 G;  4B3S C;  2UUC C;  3IEU A;  4LFC C;  1N34 C;  1WF3 A;  4X62 C;  4DV6 C;  4JI5 C;  2E8C A;  3T1H C;  1K0R A;  3GKU A;  5A2Q D;  3T1Y C;  4LFB C;  4LF7 C;  4JI7 C;  2YCB A;  2UUA C;  1XNQ C;  1XMQ C;  3J80 D;  1ZB9 A;  4NXN C;  1HNZ C;  4DV0 C;  1XMO C;  1N36 C;  2OPL B;  3AF6 A;  1IBM C;  4DR1 C;  1IBK C;  4LF4 C;  2ZM6 C;  1USP B;  2E7G A;  4LF8 C;  1UKK A;  4DUZ C;  1J5E C;  1HH2 P;  2UU9 C;  3R9X A;  4DCU A;  4DV4 C;  3AF5 A;  2E8F A;  4B3T C;  2VQF C;  2PN2 A;  4DR5 C;  4MTN A;  1PA4 A;  1N33 C;  4BSZ A;  2QL8 A;  4DV3 C;  1HNX C;  4DCT A;  2BJO A;  2F4V C;  5BR8 C;  4DCV A;  4YHH C;  4DR2 C;  2UUB C;  4B3M C;  5LMU C;  4JI1 C;  2OPL A;  2ASB A;  4JI2 C;  1WH9 A;  4JYA C;  2ONF A;  1IBL C;  4DV7 C;  1HNW C;  1VLA A;  4MH4 A;  4AQY C;  1USP A;  1FJG C;  1MKY A;  4DUY C;  2KZF A;  2E8E A;  2UXC C;  4DCS A;  4LF5 C;  4OX9 C;  4NOZ A; 
#chains in the Genus database with same CATH topology
 4A3C I;  2P2Q A;  5DV9 A;  5KYT A;  2E9H A;  1I94 C;  2Q4Z A;  4DR7 C;  1JOS A;  1Z01 A;  2UXD C;  4NFR A;  2NAP A;  1WZN A;  1RLY A;  1YHQ Z;  4BBS I;  2E0G A;  3R9W A;  1Q16 A;  4MON A;  5LMN C;  4YY3 C;  3S2H I;  2DPL A;  5K8F A;  3CCE 1;  4DGL A;  1V25 A;  4PUG A;  4RMN A;  1YUK A;  4X64 C;  1NYE A;  4ISB A;  2JIM A;  4G37 A;  2JA8 I;  3GTK I;  2MM9 A;  2LEX A;  4OYC A;  3BG0 B;  1VQN Z;  2OBV A;  3PES A;  4LF6 C;  3IEV A;  4XX2 A;  4PUI A;  3DHV A;  1O93 A;  3GPC A;  3J81 f;  1Z03 A;  1KKG A;  1N2F A;  3NDI A;  3FQQ A;  3CPW Y;  5BUQ A;  1S7M A;  1Y8C A;  3JAM D;  4E2Y A;  2V8J A;  4NDN A;  4GXQ A;  5BUR A;  4GXR A;  2ATW A;  3S16 I;  2D1T A;  2V45 A;  2IV2 X;  1GPM A;  3CCQ 1;  3A26 A;  2R93 I;  5BSV A;  5GTD A;  4DV5 C;  1P9N A;  3HOW I;  1M6X C;  4NBC A;  3U50 C;  2E7Z A;  1NJI 2;  3FCE A;  3RV2 A;  1MXB A;  1RNI A;  3J81 b;  3GTP I;  3HOV I;  1YI2 Z;  5AN9 F;  2QVY X;  4JI4 C;  2AYD A;  2DYJ A;  2IZ4 A;  4NB8 A;  1NP6 A;  3N54 B;  2F4M A;  3R44 A;  3UOW A;  3VMG A;  1N34 C;  2R7Z I;  4Y52 I;  1ZH1 A;  3I55 Z;  4DV6 C;  2D1R A;  3BG1 B;  2ZAE B;  3T1H C;  2JUB A;  4NBE A;  4BY7 I;  1Y1W I;  3CW8 X;  4K0B A;  5A1I A;  2OOX B;  1XMQ C;  2K3R A;  1AMU A;  5BST A;  2VUM I;  4D4I A;  1XMO C;  5LCI A;  5IP7 I;  2JS4 A;  2JIR A;  5E7Q A;  3AF6 A;  2YWC A;  2D28 C;  4A93 I;  3CC4 1;  3GR1 A;  4LF4 C;  2P2B A;  1M90 1;  1USP B;  3GTQ I;  4NBB A;  3CCE Z;  1MXA A;  1UKK A;  3G6E 1;  1VQ7 1;  4DUZ C;  2QW0 X;  3MZL B;  1K73 2;  2V8K A;  1S72 1;  3K7A I;  4RVF A;  1XRB A;  1ULT A;  3SO4 A;  3R9X A;  3D6W A;  1VQO 1;  4B3T C;  2R92 I;  1TWA I;  4G36 A;  4IR7 A;  3GTM I;  4A3B I;  3O2E A;  1FLO A;  2QEX 1;  1M90 2;  1Z02 A;  3G4S 1;  4BSZ A;  2VSQ A;  1WCM I;  3PO3 I;  1XHJ A;  2F4V C;  1YIT 1;  3D9X A;  3CCQ Z;  1XS3 A;  2WAQ A;  1LCI A;  4PZP A;  3RG2 A;  4DCV A;  2UUB C;  4BC9 A;  2F4O A;  5BSU A;  2ASB A;  1RG9 A;  3VB9 A;  4JI2 C;  1WH9 A;  3NH4 A;  1V60 A;  2ONF A;  1MXC A;  1HNW C;  2RPR A;  1VQ4 1;  3NFZ A;  4JM1 A;  1P4E A;  4DK1 A;  1K8A 2;  4DUY C;  3CPW Z;  1QVG Y;  3GTL I;  4LF5 C;  2PMZ A;  3TUF A;  4NBD A;  3S82 A;  1WJ2 A;  3EED A;  3CCJ 1;  4FUT A;  1XRC A;  2RT9 A;  1YJ7 A;  1TWH I;  4ZLP A;  5T8T A;  2CXC A;  2HJG A;  2I3C A;  3L95 X;  3CME 1;  1Y1V S;  2P20 A;  4GS5 A;  3P5J B;  3IR7 A;  4U5Y D;  3H3V J;  4NXM C;  2P2M A;  2Z51 A;  3CCM Z;  4KTT A;  4G1I A;  3G6E Z;  1VQ7 Z;  1QWI A;  2IZ3 A;  4RM3 A;  4GKJ C;  1S72 Z;  2CY1 A;  3A25 A;  5A1G A;  3S17 I;  4ZJZ A;  3GKQ A;  3D2L A;  1W2B Y;  4NBH A;  3OTO C;  1AA6 A;  1Q86 1;  3LAX A;  2JMP A;  3GR0 A;  1MDF A;  3UX3 A;  2QEX Z;  4CL1 A;  1N32 C;  2HU9 A;  3G4S Z;  2OTL 1;  1VEH A;  3DLP X;  4JI0 C;  1JJ2 Y;  3CCL 1;  3EER A;  1YIT Z;  4A3L I;  2E5L C;  2WD9 A;  5IT9 f;  5IP9 I;  3FQM A;  2CU6 A;  1DL6 A;  1N8R 2;  4TNU A;  1VQ9 1;  1Q86 2;  4X65 C;  1X3Z A;  1T5D X;  4X6A I;  3CCU 1;  2QLV B;  3HOY I;  1RO4 A;  2PT7 G;  3I08 A;  3ETC A;  3IEU A;  2UUC C;  4A3J I;  3GTG I;  2LFU A;  4JI5 C;  4BBR I;  1P7L A;  2E8C A;  3CCV 1;  1NJI 1;  5IT9 b;  3CCJ Z;  3OW2 Y;  2Y4O A;  4E2W A;  1TWF I;  4LFB C;  4WV3 A;  4JI7 C;  3MON A;  1XNQ C;  2JR6 A;  3CME Z;  3J80 D;  4S1T A;  3S15 I;  1HNZ C;  1VQL 1;  1N36 C;  1YJ9 1;  1VQK 1;  3CQ1 A;  2WB1 A;  2JA6 I;  5FLX f;  3IPL A;  4D57 A;  1QVG Z;  1WCJ A;  2O4H A;  3S1Q I;  2E7G A;  3E7X A;  4PHT A;  1P4E C;  3S1N I;  1J5E C;  2DHM A;  2UU9 C;  4QTT A;  1RO0 A;  3FKI I;  4DG8 A;  5T6B A;  1VQM Z;  5FLX b;  3NYQ A;  3RZO I;  1Q82 1;  2P3Y A;  2PN2 A;  4DR5 C;  4MTN A;  1WW9 A;  1K73 1;  1SFO I;  3TDE A;  1O90 A;  3HKZ A;  3GTO I;  2QL8 A;  3CCL Z;  1HNX C;  4A3F I;  4OXI A;  4DCT A;  2H85 A;  1VQ6 1;  1K9M 2;  3VNR A;  1PU1 A;  5BR8 C;  4YHH C;  5D1P A;  4B3M C;  1VQ5 1;  5ADZ A;  2YU9 I;  1VQ8 1;  1YUA A;  2VPZ A;  4LE5 A;  1VQ9 Z;  4EAT A;  1O92 A;  1W2B Z;  1Q82 2;  3HOU I;  2P2F A;  4RV9 A;  3CCU Z;  1MD9 A;  4MH4 A;  4HH4 A;  3CW9 A;  1USP A;  3PBK A;  2OZK A;  1MKY A;  2YX1 A;  2E8E A;  4HPV A;  5C3E I;  4L7I A;  4MD7 A;  1JJ2 Z;  3M4O I;  1I3Q I;  4AYB A;  3CCV Z;  4E33 A;  2QR1 B;  5C44 I;  4WS9 A;  5T67 A;  1FDI A;  1L2F A;  2RHB A;  2M5H A;  3J81 D;  4JI8 C;  2YAD A;  3UEB A;  4DR6 C;  2V8I A;  3MZK B;  1TWC I;  3GCF A;  1K8A 1;  3PO2 I;  1BA3 A;  4DV1 C;  1VQK Z;  2QRC B;  1SIW A;  2DE5 A;  1IB8 A;  2KZ0 A;  2DE6 A;  3L8C A;  3KXW A;  4DR4 C;  2ZZN A;  4D56 A;  3IF8 A;  4JV5 C;  4NB9 A;  4RLQ A;  3K6R A;  1YJN 1;  3DAY A;  3OW2 Z;  5IFI A;  2P28 A;  2BH1 X;  5CM2 M;  4LF9 C;  2QRE B;  3CC2 1;  3KIF A;  4X66 C;  4L4Q A;  1ZB8 A;  4JI6 C;  3J7A 4;  2D7V A;  4R1L A;  5IWA C;  4BBY A;  3G7S A;  3UX2 A;  1TWG I;  1KRL A;  3CJE A;  4Y7N I;  3TE5 B;  3LGX A;  2UXB C;  2E2H I;  1EGA A;  1QF8 A;  3LUS A;  4I9G A;  2VPX A;  2Q51 A;  3N2Q A;  1YJW 1;  1RO2 A;  2QKD A;  3VTN A;  1RQF A;  3CC4 Z;  3PRO C;  2Y27 A;  2PK7 A;  3TR3 A;  1Q81 1;  1QXF A;  2QA4 1;  2E2I I;  3CC7 1;  5A19 A;  4E2X A;  4B3S C;  1FDO A;  3I56 1;  4LFC C;  1WII A;  1WF3 A;  1VQO Z;  2O53 A;  1N8R 1;  1PG3 A;  1K0R A;  3ETO A;  1VQP 1;  3T1Y C;  2VUG A;  4LF7 C;  1Q81 2;  3M3Y I;  5FLM I;  2UUA C;  2JMO A;  3EQ6 A;  4NXN C;  2KDN A;  2PRO A;  1M1K 2;  3CXC Y;  1MDB A;  2OPL B;  4D4G A;  5T64 A;  2Y4N A;  1IBM C;  3TDH B;  2DE7 A;  1RY2 A;  2KI7 B;  1KQS Y;  2YWB A;  3LNV A;  4A3D I;  4FTF A;  4DG9 A;  3VNS A;  1YJN Z;  4LF8 C;  3IX0 A;  1HH2 P;  3CC2 Z;  3JAM b;  1KD1 2;  1VQ4 Z;  3Q87 A;  4MD9 A;  2RBL A;  1Q7Y 2;  2JIO A;  5C4X I;  5BUS A;  5AE3 A;  4DV4 C;  2KPI A;  2E8F A;  3NH8 A;  2PM9 A;  2VQF C;  3GTM S;  2QRD B;  2NVY I;  2M6N A;  4E32 A;  1PA4 A;  3T4N B;  2VZE A;  2JA7 I;  2OOY B;  3PO3 S;  2W04 A;  4PUH A;  3A9U A;  4L2Z A;  5CZV A;  2BJO A;  4MRI A;  1YJW Z;  2AKL A;  3S1M I;  3CD6 1;  4JI1 C;  4BCA A;  4NBF A;  4RVD A;  2VPY A;  1I50 I;  2QA4 Z;  4JYA C;  3CC7 Z;  4A3E I;  5BSM A;  3TQI A;  3VMI A;  1VLA A;  4AQY C;  3LNO A;  3H0G I;  2JIP A;  1K9M 1;  2P02 A;  1FJG C;  3I56 Z;  3NDJ A;  3NI2 A;  5H9U A;  1QVF Y;  4R1M A;  1K83 I;  2QVX X;  2D1Q A;  1YIJ 1;  4NOZ A;  4MXU A;  4RVG A;  1TFI A;  1VQP Z;  5AE1 A;  4NH1 C;  5D1O B;  5A2Q f;  2OTJ 1;  5KYV A;  2OTL Z;  2NVT I;  4GKK C;  5BSR A;  4RS4 A;  5D1O A;  2G2K A;  2M48 A;  1LQL A;  2EGT A;  1KC8 1;  4IZ6 A;  5CZX A;  4RVO A;  2V3V A;  3IFU A;  3GTJ I;  1Y1V I;  3CCR 1;  1I6H I;  5IT9 D;  3QWU A;  4FUQ A;  2QVZ X;  1PG4 A;  1FUG A;  4DR3 C;  4KHP C;  3UZ0 A;  3NYR A;  5A2Q b;  2HHH C;  3F3P C;  2MMA B;  5K85 A;  4TPS B;  5T8S A;  5JRH A;  5C4J I;  4A3G I;  3G71 1;  3CQ2 A;  1QYP A;  3FCC A;  3CXC Z;  1KC8 2;  2Y0S A;  1T5H X;  4LFA C;  1HR0 C;  2D1S A;  3I07 A;  4E31 A;  1TH5 A;  2NCL A;  2VF1 A;  4MD8 A;  3B7W A;  4DV2 C;  1X3W A;  1KQS Z;  4EWC A;  4JI3 C;  5BSW A;  4QTU A;  2HF1 A;  2JIQ A;  4R0M A;  2WP0 C;  1VQL Z;  4NBA A;  3CCS 1;  1L1O C;  1YJ9 Z;  3CD6 Z;  4A3M I;  3A4I A;  5KEI A;  5FLX D;  4K0K C;  3NH5 A;  1XRA A;  3A9V A;  4B3R C;  3CCM 1;  3ESW A;  4E2Z A;  2XR1 A;  2JA5 I;  4PRO C;  2AYA A;  1XNR C;  1UWD A;  1O9T A;  1ML8 A;  4RVH A;  2NVX I;  3CMA 1;  2VQE C;  2R6M A;  2JNV A;  4X62 C;  3HOZ I;  1YIJ Z;  1X0T A;  2NVQ I;  3NPD A;  2W03 A;  2VPW A;  4NBG A;  2J6A A;  3GKU A;  3RZD I;  5A2Q D;  2OTJ Z;  3AY0 A;  3CQZ I;  3H2T A;  2YCB A;  4A3I I;  1ZB9 A;  3HOX I;  1NY8 A;  4DV0 C;  2ZZM A;  1PFT A;  3CCR Z;  1VQ6 Z;  1YHQ 1;  4BXX I;  2MCQ A;  4DQY B;  1VQ5 Z;  3S14 I;  3VNQ A;  4DR1 C;  1IBK C;  1QVF Z;  2ZM6 C;  1VQ8 Z;  4RLF A;  4HGZ A;  1NUI A;  1V26 A;  2B63 I;  1M1K 1;  1M6X A;  3G71 Z;  3I4N I;  2GU2 A;  2D27 A;  3E7W A;  4DCU A;  3AF5 A;  3I4M I;  3KIH A;  3IML A;  4I9F A;  3C5E A;  1VQN 1;  2E2J I;  4HGY A;  4RM2 A;  1KD1 1;  1N33 C;  2LIY A;  1Q7Y 1;  2M5O A;  3J80 f;  2K5R A;  3JAM f;  4DV3 C;  3CCS Z;  1QM4 A;  4DR2 C;  2V7B A;  5LL6 f;  5LMU C;  2P2J A;  2OPL A;  2RIQ A;  4KTV A;  2OO4 A;  4RVN A;  3VMH A;  3CQ3 A;  1IBL C;  2GTH A;  4DV7 C;  3CMA Z;  3S2D I;  1YI2 1;  3S1R I;  3J80 b;  1R9T I;  3F3F C;  2KZF A;  4BC7 A;  2UXC C;  1JWH C;  4DCS A;  4BY1 I;  1VQM 1;  4OX9 C;  2GTI A;  3I55 1;  4A3K I;  4ODJ A;  5AE2 A;  4E30 A;  2JNY A; 
#chains in the Genus database with same CATH homology
 4A3C I;  2P2Q A;  5DV9 A;  5KYT A;  2E9H A;  1I94 C;  2Q4Z A;  4DR7 C;  1JOS A;  1Z01 A;  2UXD C;  4NFR A;  1RLY A;  1YHQ Z;  4BBS I;  2E0G A;  3R9W A;  4MON A;  5LMN C;  4YY3 C;  3S2H I;  2DPL A;  5K8F A;  3CCE 1;  4DGL A;  1V25 A;  4RMN A;  1YUK A;  4X64 C;  1NYE A;  4ISB A;  4G37 A;  2JA8 I;  3GTK I;  4OYC A;  3BG0 B;  1VQN Z;  2OBV A;  3PES A;  4LF6 C;  3IEV A;  4XX2 A;  3DHV A;  1O93 A;  3GPC A;  3J81 f;  1Z03 A;  1KKG A;  1N2F A;  3NDI A;  3FQQ A;  3CPW Y;  5BUQ A;  1S7M A;  3JAM D;  4E2Y A;  2V8J A;  4NDN A;  4GXQ A;  5BUR A;  4GXR A;  2ATW A;  3S16 I;  2D1T A;  1GPM A;  3CCQ 1;  2R93 I;  5BSV A;  5GTD A;  4DV5 C;  1P9N A;  3HOW I;  4NBC A;  3U50 C;  1NJI 2;  3RV2 A;  3FCE A;  1MXB A;  1RNI A;  3J81 b;  3GTP I;  3HOV I;  1YI2 Z;  5AN9 F;  2QVY X;  4JI4 C;  2DYJ A;  2IZ4 A;  4NB8 A;  1NP6 A;  3N54 B;  2F4M A;  3R44 A;  3UOW A;  3VMG A;  1N34 C;  2R7Z I;  4Y52 I;  1ZH1 A;  3I55 Z;  4DV6 C;  2D1R A;  3BG1 B;  2ZAE B;  3T1H C;  2JUB A;  4NBE A;  4BY7 I;  1Y1W I;  3CW8 X;  4K0B A;  5A1I A;  2OOX B;  1XMQ C;  2K3R A;  1AMU A;  5BST A;  2VUM I;  4D4I A;  1XMO C;  5IP7 I;  2JS4 A;  5E7Q A;  3AF6 A;  2YWC A;  2D28 C;  4A93 I;  3CC4 1;  3GR1 A;  4LF4 C;  2P2B A;  1M90 1;  1USP B;  3GTQ I;  4NBB A;  3CCE Z;  1MXA A;  1UKK A;  3G6E 1;  1VQ7 1;  4DUZ C;  2QW0 X;  3MZL B;  1K73 2;  2V8K A;  1S72 1;  3K7A I;  4RVF A;  1XRB A;  1ULT A;  3SO4 A;  3R9X A;  3D6W A;  1VQO 1;  4B3T C;  2R92 I;  1TWA I;  4G36 A;  4IR7 A;  3GTM I;  4A3B I;  2QEX 1;  1M90 2;  1Z02 A;  3G4S 1;  4BSZ A;  2VSQ A;  1WCM I;  3PO3 I;  2F4V C;  1YIT 1;  3D9X A;  3CCQ Z;  4PZP A;  2WAQ A;  1LCI A;  3RG2 A;  4DCV A;  2UUB C;  4BC9 A;  2F4O A;  5BSU A;  2ASB A;  1RG9 A;  3VB9 A;  4JI2 C;  1WH9 A;  3NH4 A;  2ONF A;  1MXC A;  1HNW C;  2RPR A;  1VQ4 1;  3NFZ A;  4JM1 A;  4DK1 A;  1K8A 2;  4DUY C;  3CPW Z;  1QVG Y;  3GTL I;  4LF5 C;  2PMZ A;  3TUF A;  4NBD A;  3S82 A;  3EED A;  3CCJ 1;  4FUT A;  1XRC A;  2RT9 A;  1YJ7 A;  1TWH I;  4ZLP A;  5T8T A;  2CXC A;  2HJG A;  2I3C A;  3L95 X;  3CME 1;  1Y1V S;  2P20 A;  4GS5 A;  3P5J B;  4U5Y D;  3H3V J;  4NXM C;  2P2M A;  3CCM Z;  4KTT A;  4G1I A;  3G6E Z;  1VQ7 Z;  1QWI A;  2IZ3 A;  4RM3 A;  4GKJ C;  1S72 Z;  2CY1 A;  5A1G A;  3S17 I;  4ZJZ A;  3GKQ A;  1W2B Y;  4NBH A;  3OTO C;  1Q86 1;  3LAX A;  2JMP A;  3GR0 A;  1MDF A;  2QEX Z;  4CL1 A;  1N32 C;  2HU9 A;  3G4S Z;  2OTL 1;  3DLP X;  4JI0 C;  1JJ2 Y;  3CCL 1;  3EER A;  1YIT Z;  4A3L I;  2E5L C;  2WD9 A;  5IT9 f;  5IP9 I;  3FQM A;  1DL6 A;  1N8R 2;  4TNU A;  1VQ9 1;  1Q86 2;  4X65 C;  1X3Z A;  1T5D X;  4X6A I;  3CCU 1;  2QLV B;  3HOY I;  1RO4 A;  2PT7 G;  3I08 A;  3ETC A;  3IEU A;  2UUC C;  4A3J I;  3GTG I;  2LFU A;  4JI5 C;  4BBR I;  1P7L A;  2E8C A;  3CCV 1;  1NJI 1;  5IT9 b;  3CCJ Z;  3OW2 Y;  2Y4O A;  4E2W A;  1TWF I;  4LFB C;  4WV3 A;  4JI7 C;  3MON A;  1XNQ C;  2JR6 A;  3CME Z;  3J80 D;  4S1T A;  3S15 I;  1HNZ C;  1VQL 1;  1N36 C;  1YJ9 1;  1VQK 1;  2WB1 A;  2JA6 I;  5FLX f;  3IPL A;  4D57 A;  1QVG Z;  2O4H A;  3S1Q I;  2E7G A;  3E7X A;  4PHT A;  3S1N I;  1J5E C;  2UU9 C;  4QTT A;  1RO0 A;  3FKI I;  4DG8 A;  5T6B A;  1VQM Z;  5FLX b;  3NYQ A;  3RZO I;  1Q82 1;  2P3Y A;  2PN2 A;  4DR5 C;  4MTN A;  1WW9 A;  1K73 1;  1SFO I;  3TDE A;  1O90 A;  3HKZ A;  3GTO I;  2QL8 A;  3CCL Z;  1HNX C;  4A3F I;  4OXI A;  4DCT A;  2H85 A;  1VQ6 1;  1K9M 2;  3VNR A;  5BR8 C;  4YHH C;  5D1P A;  4B3M C;  1VQ5 1;  5ADZ A;  2YU9 I;  1VQ8 1;  1YUA A;  4LE5 A;  1VQ9 Z;  4EAT A;  1O92 A;  1W2B Z;  1Q82 2;  3HOU I;  2P2F A;  4RV9 A;  3CCU Z;  1MD9 A;  4MH4 A;  4HH4 A;  3CW9 A;  1USP A;  3PBK A;  2OZK A;  1MKY A;  2E8E A;  4HPV A;  5C3E I;  4L7I A;  4MD7 A;  1JJ2 Z;  3M4O I;  1I3Q I;  4AYB A;  3CCV Z;  4E33 A;  2QR1 B;  5C44 I;  4WS9 A;  5T67 A;  1L2F A;  2RHB A;  3J81 D;  4JI8 C;  2YAD A;  4DR6 C;  2V8I A;  3MZK B;  1TWC I;  3GCF A;  1K8A 1;  3PO2 I;  1BA3 A;  4DV1 C;  1VQK Z;  2QRC B;  2DE5 A;  2DE6 A;  3L8C A;  3KXW A;  4DR4 C;  4D56 A;  3IF8 A;  4JV5 C;  4NB9 A;  4RLQ A;  1YJN 1;  3DAY A;  3OW2 Z;  5IFI A;  2P28 A;  2BH1 X;  5CM2 M;  4LF9 C;  2QRE B;  3CC2 1;  3KIF A;  4X66 C;  4L4Q A;  1ZB8 A;  4JI6 C;  3J7A 4;  2D7V A;  4R1L A;  5IWA C;  4BBY A;  3G7S A;  1TWG I;  1KRL A;  3CJE A;  4Y7N I;  3TE5 B;  3LGX A;  2UXB C;  2E2H I;  1EGA A;  1QF8 A;  3LUS A;  4I9G A;  2Q51 A;  3N2Q A;  1YJW 1;  1RO2 A;  2QKD A;  3VTN A;  1RQF A;  3CC4 Z;  3PRO C;  2Y27 A;  2PK7 A;  1Q81 1;  2QA4 1;  2E2I I;  3CC7 1;  5A19 A;  4E2X A;  4B3S C;  3I56 1;  4LFC C;  1WII A;  1WF3 A;  1VQO Z;  2O53 A;  1N8R 1;  1PG3 A;  1K0R A;  3ETO A;  1VQP 1;  3T1Y C;  2VUG A;  4LF7 C;  1Q81 2;  3M3Y I;  5FLM I;  2UUA C;  2JMO A;  3EQ6 A;  4NXN C;  2PRO A;  1M1K 2;  3CXC Y;  1MDB A;  2OPL B;  4D4G A;  5T64 A;  2Y4N A;  1IBM C;  3TDH B;  2DE7 A;  1RY2 A;  2KI7 B;  1KQS Y;  2YWB A;  3LNV A;  4A3D I;  4FTF A;  4DG9 A;  3VNS A;  1YJN Z;  4LF8 C;  3IX0 A;  1HH2 P;  3CC2 Z;  3JAM b;  1KD1 2;  1VQ4 Z;  3Q87 A;  4MD9 A;  2RBL A;  1Q7Y 2;  5C4X I;  5BUS A;  5AE3 A;  4DV4 C;  2KPI A;  2E8F A;  3NH8 A;  2PM9 A;  2VQF C;  3GTM S;  2QRD B;  2NVY I;  2M6N A;  4E32 A;  1PA4 A;  3T4N B;  2VZE A;  2JA7 I;  2OOY B;  3PO3 S;  2W04 A;  3A9U A;  4L2Z A;  5CZV A;  2BJO A;  4MRI A;  1YJW Z;  2AKL A;  3S1M I;  3CD6 1;  4JI1 C;  4BCA A;  4NBF A;  4RVD A;  1I50 I;  2QA4 Z;  4JYA C;  3CC7 Z;  4A3E I;  5BSM A;  3TQI A;  3VMI A;  1VLA A;  4AQY C;  3H0G I;  1K9M 1;  2P02 A;  1FJG C;  3I56 Z;  3NDJ A;  3NI2 A;  5H9U A;  1QVF Y;  4R1M A;  1K83 I;  2QVX X;  2D1Q A;  1YIJ 1;  4NOZ A;  4MXU A;  4RVG A;  1TFI A;  1VQP Z;  5AE1 A;  4NH1 C;  5D1O B;  5A2Q f;  2OTJ 1;  5KYV A;  2OTL Z;  2NVT I;  4GKK C;  5BSR A;  4RS4 A;  5D1O A;  2G2K A;  2M48 A;  1LQL A;  2EGT A;  1KC8 1;  4IZ6 A;  5CZX A;  4RVO A;  3GTJ I;  3IFU A;  3CCR 1;  1Y1V I;  1I6H I;  5IT9 D;  3QWU A;  4FUQ A;  2QVZ X;  1PG4 A;  1FUG A;  4DR3 C;  4KHP C;  3UZ0 A;  3NYR A;  5A2Q b;  2HHH C;  3F3P C;  5K85 A;  4TPS B;  5T8S A;  5JRH A;  5C4J I;  4A3G I;  3G71 1;  1QYP A;  3FCC A;  3CXC Z;  1KC8 2;  2Y0S A;  1T5H X;  4LFA C;  1HR0 C;  2D1S A;  3I07 A;  4E31 A;  2VF1 A;  4MD8 A;  3B7W A;  4DV2 C;  1X3W A;  1KQS Z;  4EWC A;  4JI3 C;  5BSW A;  4QTU A;  2HF1 A;  4R0M A;  2WP0 C;  1VQL Z;  4NBA A;  3CCS 1;  1L1O C;  1YJ9 Z;  3CD6 Z;  4A3M I;  3A4I A;  5KEI A;  5FLX D;  4K0K C;  3NH5 A;  1XRA A;  3A9V A;  4B3R C;  3CCM 1;  3ESW A;  4E2Z A;  2XR1 A;  2JA5 I;  4PRO C;  2AYA A;  1XNR C;  1O9T A;  1ML8 A;  4RVH A;  2NVX I;  3CMA 1;  2VQE C;  2R6M A;  4X62 C;  3HOZ I;  1YIJ Z;  1X0T A;  2NVQ I;  3NPD A;  2W03 A;  4NBG A;  2J6A A;  3GKU A;  3RZD I;  5A2Q D;  2OTJ Z;  3CQZ I;  3H2T A;  2YCB A;  4A3I I;  1ZB9 A;  3HOX I;  4DV0 C;  1PFT A;  3CCR Z;  1VQ6 Z;  1YHQ 1;  4BXX I;  4DQY B;  1VQ5 Z;  3S14 I;  3VNQ A;  4DR1 C;  1IBK C;  1QVF Z;  2ZM6 C;  1VQ8 Z;  4RLF A;  4HGZ A;  1NUI A;  1V26 A;  2B63 I;  1M1K 1;  3G71 Z;  3I4N I;  2GU2 A;  2D27 A;  3E7W A;  4DCU A;  3AF5 A;  3I4M I;  3KIH A;  3IML A;  4I9F A;  3C5E A;  1VQN 1;  2E2J I;  4HGY A;  4RM2 A;  1KD1 1;  1N33 C;  2LIY A;  1Q7Y 1;  3J80 f;  2K5R A;  3JAM f;  4DV3 C;  3CCS Z;  1QM4 A;  4DR2 C;  2V7B A;  5LL6 f;  5LMU C;  2P2J A;  2OPL A;  2RIQ A;  4KTV A;  2OO4 A;  4RVN A;  3VMH A;  1IBL C;  2GTH A;  4DV7 C;  3CMA Z;  3S2D I;  1YI2 1;  3S1R I;  3J80 b;  1R9T I;  3F3F C;  2KZF A;  4BC7 A;  2UXC C;  1JWH C;  4DCS A;  4BY1 I;  1VQM 1;  4OX9 C;  2GTI A;  3I55 1;  4A3K I;  4ODJ A;  5AE2 A;  4E30 A;  2JNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...