2EGTA

Crystal structure of hypothetical protein (aq1549) from aquifex aeolicus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_1549
publication title Crystal Structure of Hypothetical protein (AQ1549) from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 42
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.300 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2egtA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2egtA02
3EERA 4DUYC 4LF8C 4LFCC 1XNQC 5BR8C 4B3TC 2ONFA 4DCVA 3AF5A 4XX2A 2ZM6C 2VQEC 5LMUC 1L2FA 3R9XA 2HHHC 1WH9A 1EGAA 1UKKA 4JI4C 4MH4A 4B3RC 4X64C 3J80D 1IBLC 4OX9C 2E8EA 2UXBC 4NXNC 1JOSA 2PT7G 3JAMD 1N2FA 2E8FA 4NXMC 1ML8A 4JI2C 4LF9C 1PA4A 2OPLB 4DV6C 3J81D 1I94C 4DR5C 2E7GA 2KZFA 4DR2C 5LMNC 4DV4C 3IEVA 4DV5C 4JI6C 2CXCA 3R9WA 1HNZC 4DR4C 1IBKC 2XR1A 2D7VA 1USPB 2UUCC 2DYJA 4DV2C 2PN2A 2VQFC 4JI1C 2UXCC 4LF6C 2F4VC 1IBMC 2YCBA 4AQYC 1HH2P 3T1HC 3LUSA 5A2QD 3AF6A 4JI8C 2E8CA 4X62C 1MKYA 3I07A 1WF3A 1KKGA 2E5LC 4DR1C 4X66C 2UUAC 2CY1A 3IEUA 4B3SC 4DCUA 3OTOC 4B3MC 4KHPC 2UXDC 1N34C 4LF5C 4DUZC 2ATWA 4MTNA 5FLXD 1HNWC 2OPLA 4DV0C 4NOZA 5IT9D 1LQLA 2EGTA 1J5EC 4DV3C 4YHHC 4JI5C 4DR6C 4BSZA 3GKUA 1HNXC 1XMQC 1XNRC 4DV7C 4DV1C 4LF4C 4LFAC 2UU9C 1QWIA 4DCSA 1ZB9A 2HJGA 2UUBC 1FJGC 1USPA 2QL8A 4JV5C 4YY3C 1ZB8A 1HR0C 1XMOC 2JMPA 2BJOA 1N36C 4JI3C 3T1YC 4DR7C 1NYEA 4X65C 4K0KC 4JYAC 4JI0C 1VLAA 1K0RA 4JI7C 4LF7C 4DR3C 4GKKC 4LFBC 4GKJC 1N33C 1N32C 3CJEA 4DCTA 5IWAC 2ASBA
chains in the Genus database with same CATH superfamily
2P2BA 4LF8C 1NY8A 4G1IA 4TPSB 2P2QA 4E2XA 1Q862 1RY2A 2Z51A 3NI2A 3AF5A 2QVXX 2LEXA 1XS3A 4FUQA 2VQEC 1K9M1 1VQ4Z 2WD9A 3PBKA 4OXIA 1I3QI 3F3FC 1VQPZ 2HHHC 4RVGA 1PG3A 3PO3I 1BA3A 1VQKZ 1Y1VS 1VQ61 1RQFA 3JAMD 4RVHA 5CM2M 2VPWA 2G2KA 2QEX1 3S16I 3NH8A 3GTKI 4JI2C 2NVXI 3NPDA 2OO4A 2JR6A 4NDNA 4NBAA 4Y52I 3IX0A 2OTJZ 3E7WA 2KZFA 5LMNC 4X6AI 3CW9A 3IMLA 3TUFA 1SFOI 3GKQA 4DV5C 2P3YA 2JIPA 3GTGI 3N54B 5BSRA 2NCLA 1YJ9Z 1O90A 1HNZC 1PFTA 5FLMI 1QXFA 3S2DI 2KPIA 3HOYI 4DV2C 2PN2A 5T8TA 2VQFC 1M1K1 4JI1C 3A26A 2R92I 5BUSA 2KDNA 2JIOA 3FKII 2YCBA 3MZKB 4NBFA 3CD61 1RO2A 3LAXA 5BSVA 3CQZI 3PO2I 4RLQA 5BURA 3CCVZ 2D1RA 3CC4Z 1MD9A 3NDJA 4IZ6A 2MM9A 3FCCA 2E5LC 1W2BY 5C4XI 4OYCA 1Q16A 2RT9A 1VQ7Z 2DE6A 1KQSY 5CZXA 4PHTA 1P4EC 4BBRI 4A3JI 3G7SA 4FUTA 3NFZA 2NVYI 2UXDC 1RO0A 1NJI2 3CCEZ 2J6AA 3PESA 3G4SZ 3VNQA 4D56A 1IB8A 1X3ZA 4KTTA 5DV9A 1T5DX 3O2EA 2H85A 4NOZA 3HOVI 2P28A 3CCLZ 3CCU1 1XHJA 5BSUA 3G71Z 1Q821 1KC81 4PZPA 3LNOA 4JI5C 2JS4A 3CCQ1 4HPVA 4A3EI 5KEIA 4HGYA 5KYTA 4LFAC 2IV2X 2VF1A 1M6XC 4QTUA 5BSTA 2UUBC 1JWHC 1O9TA 2M5OA 3K6RA 4E2ZA 3VMGA 4A3MI 2BH1X 4BXXI 4A3II 3H2TA 1I50I 1WCMI 4NB9A 1HR0C 4DG9A 1XMOC 3S15I 2BJOA 3CCM1 2PK7A 2F4OA 1VQNZ 3CQ3A 5BSMA 1VLAA 3ETCA 4LF7C 5LCIA 5JRHA 4R1MA 1FDIA 4PROC 1K732 3ETOA 1TWHI 3S1NI 1WZNA 4IR7A 2PROA 3EERA 4GS5A 3CCRZ 3U50C 1W2BZ 4EATA 1FDOA 1VQMZ 3S1MI 1KQSZ 1O93A 3NH4A 2ONFA 5LMUC 3CCSZ 2Y0SA 1YUAA 2DE5A 4E33A 1PG4A 2DHMA 3CW8X 4WV3A 5A1IA 1EGAA 3CMA1 2RHBA 3S17I 1UKKA 4JI4C 3VMHA 4B3RC 5AE2A 4X64C 4L4QA 3VNSA 2E8EA 5A1GA 3J80D 4NXNC 4GXRA 2PT7G 3CPWZ 5A19A 4DG8A 3J80f 1N2FA 2WB1A 2I3CA 5ADZA 3G6EZ 1ML8A 2RPRA 1AMUA 4A3FI 3UEBA 2M6NA 2B63I 2OTLZ 2E0GA 3J81D 4GXQA 4DR5C 1VQ5Z 2E2HI 2NAPA 3GTPI 3J81f 1Z01A 2Y27A 1YIJ1 3CQ2A 4DGLA 2Q51A 1YHQ1 3R9WA 2AYAA 2QA41 3FQQA 1Q7Y2 4R0MA 3RZOI 3HOZI 2VUMI 4EWCA 3IFUA 3KIFA 3CQ1A 1VQOZ 1YJN1 1N8R2 2UUCC 2DYJA 4I9FA 4PUGA 2JIMA 2Y4NA 3CXCY 1M901 2M5HA 1HH2P 2VZEA 3CCJZ 3CC21 3FQMA 2VPZA 2OOXB 3LGXA 2WAQA 2GU2A 2R7ZI 3R44A 2E8CA 4QTTA 4A93I 5C3EI 3Q87A 3N2QA 4X62C 5T64A 1KKGA 3I551 4DR1C 4X66C 2V8IA 2CY1A 5K8FA 1QVFY 4A3DI 3PO3S 2VSQA 3TQIA 3CC7Z 2RIQA 1QF8A 1KD11 2VUGA 1JJ2Z 1K9M2 1YITZ 5C44I 1S72Z 1T5HX 3BG0B 2JA7I 5T8SA 3UX2A 4NBDA 4LF5C 2E2II 2YU9I 2KI7B 3EEDA 2IZ3A 4NFRA 4NBBA 3NH5A 1HNWC 3HKZA 4NBCA 2W04A 4E2YA 5T67A 1VQ41 2MMAB 5AE3A 3HOUI 2JA5I 1LQLA 1NUIA 1VQP1 1YI2Z 2EGTA 4NBHA 3GR0A 3GCFA 5D1OA 1VQK1 3MZLB 4BSZA 1QVGZ 3J80b 2V3VA 5CZVA 1QWIA 4DCSA 2UU9C 1XRBA 1ZB9A 4E30A 1YJWZ 1FJGC 1USPA 3MONA 2QL8A 3L8CA 4ISBA 2OTJ1 3J81b 2HU9A 4A3LI 4JM1A 1DL6A 3CCQZ 1RNIA 1M1K2 3I56Z 4JI3C 1WJ2A 4HH4A 1NYEA 4X65C 4K0KC 2V8KA 4JYAC 1S7MA 1WCJA 1XRCA 4BBYA 3UX3A 1P4EA 4RVFA 1K0RA 3BG1B 4ZLPA 1YJ91 1N33C 4K0BA 1MXAA 3CJEA 4DCTA 5IWAC 3IR7A 2JA6I 3VB9A 2ASBA 1RG9A 2QLVB 3RZDI 1QM4A 1XNQC 4DK1A 3D2LA 2O4HA 5BR8C 2GTHA 2HF1A 5IFIA 4DCVA 3VTNA 1VQ8Z 4RVOA 1YUKA 1L2FA 3CCV1 3CC41 3SO4A 3S14I 1UWDA 4MH4A 3L95X 1Z03A 2MCQA 1IBLC 1JOSA 5K85A 1VQ71 1M6XA 1XRAA 1I6HI 2D27A 4NXMC 1K8A1 3GTMI 1X0TA 4RV9A 4LF9C 3CCE1 4FTFA 1Q822 1KC82 1I94C 2E9HA 3G4S1 1ULTA 3CMEZ 5A2Qf 1VQ9Z 4DR2C 3RV2A 5D1OB 3ESWA 2D1SA 3B7WA 4PUHA 3OW2Y 2DPLA 3IEVA 4BY1I 1VQLZ 4JI6C 4ODJA 4HGZA 3CCL1 2CXCA 3S1QI 2PMZA 3K7AI 1Q811 3G711 3TE5B 3GTMS 1USPB 3EQ6A 2Y4OA 1LCIA 2QVYX 2YWBA 1K83I 1MXCA 2OBVA 2F4VC 2JUBA 2LIYA 1TWGI 2P02A 1K8A2 4AQYC 4D57A 4NH1C 3LUSA 2WP0C 4R1LA 3T1HC 4RLFA 3AF6A 3P5JB 1YJ7A 4L2ZA 2OOYB 1VQN1 1WF3A 4WS9A 2YADA 3IEUA 4B3SC 2K5RA 1VQ6Z 2W03A 4DCUA 4E2WA 4RM3A 5H9UA 3H0GI 4E31A 3OTOC 4B3MC 3CC2Z 2ZZNA 2QEXZ 3S2HI 5IP7I 4A3BI 4LE5A 3GTQI 1O92A 3CCR1 4DUZC 1RO4A 4NBGA 3VMIA 4MTNA 1VQM1 5FLXD 1MDFA 3I4MI 4RVNA 2OPLA 3CCS1 2IZ4A 4TNUA 3GTOI 4G37A 5FLXf 5IT9D 2JNVA 1Y1VI 3F3PC 1J5EC 2VPYA 5IT9f 3NYRA 1QYPA 2JIQA 2YX1A 3GKUA 4DQYB 1P7LA 4RM2A 2P2FA 4DV1C 4LF4C 1VEHA 3NDIA 3G6E1 2PM9A 3OW2Z 3GR1A 3A9VA 4BBSI 2OTL1 2QREB 2VPXA 5A2Qb 2M48A 3CD6Z 3A4IA 1WIIA 1TWCI 3GTJI 1ZB8A 5BUQA 4YY3C 1VQ51 4L7IA 2JMPA 4JV5C 5IP9I 4RVDA 2V7BA 4RMNA 1TFIA 1NP6A 3S1RI 3JAMf 1M902 4JI7C 4GKKC 4DR3C 1RLYA 3DLPX 4MD8A 4AYBA 4GKJC 3KIHA 1N32C 1VQO1 4G36A 2QRCB 5AN9F 4A3GI 4DUYC 4LFCC 3DHVA 4E32A 3E7XA 5T6BA 3A25A 4B3TC 3CCJ1 4D4GA 1KD12 4Y7NI 4BY7I 3IPLA 2Q4ZA 4XX2A 3VNRA 2O53A 2ZM6C 3R9XA 2QKDA 2ZAEB 1NJI1 3GPCA 1WH9A 2D28C 3CCUZ 1KRLA 2R6MA 2KZ0A 2QRDB 4A3KI 4OX9C 5E7QA 1FLOA 4MD9A 2UXBC 1MDBA 3CC71 3M3YI 1Y1WI 2E8FA 2QW0X 1YIT1 1S721 2QVZX 2JIRA 2YWCA 2JMOA 3CXCZ 1PA4A 2OPLB 3NYQA 4DV6C 1V60A 2E7GA 2RBLA 2D1TA 1TH5A 3CCMZ 2P2JA 2E2JI 5FLXb 4DV4C 2JA8I 4BC9A 1QVFZ 1YI21 2DE7A 5IT9b 2E7ZA 1Y8CA 3FCEA 4MD7A 3LNVA 4DR4C 1GPMA 2XR1A 2D7VA 1IBKC 3TR3A 1R9TI 3CPWY 4MRIA 2UXCC 4LF6C 1MXBA 3GTLI 3J7A4 1IBMC 3D6WA 1YJW1 1Z02A 2V45A 2GTIA 2AYDA 1AA6A 1K731 2K3RA 2LFUA 3S82A 5A2QD 1WW9A 4JI8C 3I561 1MKYA 3I07A 3TDHB 3CMAZ 3D9XA 3JAMb 2CU6A 2AKLA 2UUAC 4MONA 1SIWA 2R93I 4NB8A 2P2MA 2JNYA 4I9GA 4A3CI 4RS4A 5LL6f 4KHPC 1FUGA 1N34C 5C4JI 3I4NI 1L1OC 2F4MA 3HOXI 2P20A 3TDEA 3IF8A 3A9UA 2ATWA 3UOWA 3H3VJ 3I08A 1TWFI 3RG2A 1VQ81 5KYVA 1YIJZ 4BC7A 1ZH1A 4DV0C 4MXUA 2ZZMA 1YHQZ 3KXWA 4PUIA 1X3WA 5AE1A 2QA4Z 3M4OI 4U5YD 4DV3C 4YHHC 4DR6C 4S1TA 1HNXC 1YJNZ 2V8JA 4CL1A 1XMQC 1XNRC 1P9NA 2NVTI 4DV7C 3T4NB 2QR1B 2HJGA 1JJ2Y 1Q861 2D1QA 3UZ0A 1V26A 1Q812 1PU1A 1Q7Y1 3DAYA 3HOWI 5BSWA 4ZJZA 3CME1 1VQ91 4BCAA 1N8R1 4D4IA 1N36C 3T1YC 4DR7C 3AY0A 2OZKA 3QWUA 1VQL1 5D1PA 3I55Z 4KTVA 4JI0C 1TWAI 1V25A 3C5EA 2NVQI 4NBEA 5GTDA 4LFBC 3PROC 1QVGY
chains in the Genus database with same CATH topology
2P2BA 4LF8C 4G1IA 4TPSB 2P2QA 4E2XA 1Q862 1RY2A 3NI2A 3AF5A 2QVXX 2VQEC 4FUQA 1K9M1 1VQ4Z 2WD9A 3PBKA 4OXIA 1I3QI 3F3FC 1VQPZ 4RVGA 1PG3A 3PO3I 1BA3A 1VQKZ 1Y1VS 1VQ61 1RQFA 3JAMD 4RVHA 5CM2M 2G2KA 2QEX1 3S16I 3NH8A 3GTKI 4JI2C 2NVXI 3NPDA 2OO4A 2JR6A 4NDNA 4NBAA 4Y52I 3IX0A 2OTJZ 3E7WA 2KZFA 5LMNC 4X6AI 3CW9A 3IMLA 3TUFA 1SFOI 3GKQA 4DV5C 2P3YA 3GTGI 3N54B 5BSRA 1YJ9Z 1O90A 1HNZC 1PFTA 5FLMI 3S2DI 2KPIA 3HOYI 4DV2C 2PN2A 5T8TA 2VQFC 1M1K1 4JI1C 2R92I 5BUSA 3FKII 2YCBA 3MZKB 4NBFA 3CD61 1RO2A 3LAXA 5BSVA 3CQZI 3PO2I 4RLQA 5BURA 3CCVZ 2D1RA 3CC4Z 1MD9A 3NDJA 4IZ6A 3FCCA 2E5LC 1W2BY 5C4XI 4OYCA 2RT9A 1VQ7Z 1KQSY 2DE6A 5CZXA 4PHTA 4BBRI 4A3JI 3G7SA 4FUTA 3NFZA 2NVYI 2UXDC 1RO0A 1NJI2 3CCEZ 2J6AA 3PESA 3G4SZ 3VNQA 4D56A 1X3ZA 4KTTA 5DV9A 1T5DX 2H85A 4NOZA 3HOVI 2P28A 3CCLZ 3CCU1 5BSUA 3G71Z 1Q821 1KC81 4PZPA 4JI5C 2JS4A 3CCQ1 4HPVA 4A3EI 5KEIA 4HGYA 5KYTA 4LFAC 2VF1A 4QTUA 5BSTA 2UUBC 1JWHC 1O9TA 4E2ZA 3VMGA 4A3MI 2BH1X 4BXXI 4A3II 3H2TA 1I50I 1WCMI 4NB9A 1HR0C 4DG9A 1XMOC 3S15I 2BJOA 3CCM1 2PK7A 2F4OA 1VQNZ 5BSMA 1VLAA 3ETCA 4LF7C 5JRHA 4R1MA 4PROC 1K732 3ETOA 1TWHI 3S1NI 4IR7A 2PROA 3EERA 4GS5A 3CCRZ 3U50C 1W2BZ 4EATA 1VQMZ 3S1MI 1KQSZ 1O93A 3NH4A 2ONFA 5LMUC 3CCSZ 2Y0SA 1YUAA 2DE5A 4E33A 1PG4A 2HHHC 3CW8X 4WV3A 5A1IA 1EGAA 3CMA1 2RHBA 3S17I 1UKKA 4JI4C 3VMHA 4B3RC 5AE2A 4X64C 4L4QA 3VNSA 2E8EA 5A1GA 3J80D 4NXNC 4GXRA 2PT7G 3CPWZ 5A19A 4DG8A 3J80f 1N2FA 2WB1A 2I3CA 5ADZA 3G6EZ 1ML8A 2RPRA 1AMUA 4A3FI 2M6NA 2B63I 2OTLZ 2E0GA 3J81D 4GXQA 4DR5C 1VQ5Z 2E2HI 3GTPI 3J81f 1Z01A 2Y27A 1YIJ1 4DGLA 2Q51A 1YHQ1 3R9WA 2AYAA 2QA41 3FQQA 1Q7Y2 4R0MA 3RZOI 3HOZI 2VUMI 4EWCA 3IFUA 3KIFA 1VQOZ 1YJN1 1N8R2 2UUCC 2DYJA 4I9FA 2Y4NA 3CXCY 1M901 2VZEA 1HH2P 3CCJZ 3FQMA 3CC21 2OOXB 3LGXA 2WAQA 2GU2A 2R7ZI 3R44A 2E8CA 4QTTA 4A93I 5C3EI 3Q87A 3N2QA 4X62C 5T64A 1KKGA 3I551 4DR1C 4X66C 2V8IA 2CY1A 5K8FA 1QVFY 4A3DI 3PO3S 2VSQA 3TQIA 3CC7Z 2RIQA 1QF8A 1KD11 2VUGA 1JJ2Z 1K9M2 1YITZ 5C44I 1S72Z 1T5HX 3BG0B 2JA7I 5T8SA 4NBDA 4LF5C 2E2II 2YU9I 2KI7B 3EEDA 2IZ3A 4NFRA 4NBBA 3NH5A 1HNWC 3HKZA 4NBCA 2W04A 4E2YA 5T67A 1VQ41 5AE3A 3HOUI 2JA5I 1LQLA 1VQP1 1NUIA 1YI2Z 2EGTA 4NBHA 3GR0A 3GCFA 5D1OA 1VQK1 3MZLB 4BSZA 1QVGZ 3J80b 5CZVA 1QWIA 4DCSA 2UU9C 1XRBA 1ZB9A 4E30A 1YJWZ 1FJGC 1USPA 3MONA 2QL8A 3L8CA 4ISBA 2OTJ1 3J81b 2HU9A 4A3LI 4JM1A 1DL6A 3CCQZ 1RNIA 1M1K2 3I56Z 4JI3C 4HH4A 1NYEA 4X65C 4K0KC 2V8KA 4JYAC 1S7MA 1XRCA 4BBYA 4RVFA 1K0RA 3BG1B 4ZLPA 1YJ91 1N33C 4K0BA 1MXAA 3CJEA 4DCTA 5IWAC 2JA6I 3VB9A 2ASBA 1RG9A 2QLVB 3RZDI 1QM4A 1XNQC 4DK1A 2O4HA 5BR8C 2GTHA 2HF1A 5IFIA 4DCVA 3VTNA 1VQ8Z 4RVOA 1YUKA 1L2FA 3CCV1 3CC41 3SO4A 3S14I 4MH4A 3L95X 1Z03A 1IBLC 1JOSA 5K85A 1VQ71 1XRAA 1I6HI 2D27A 4NXMC 1K8A1 3GTMI 1X0TA 4RV9A 4LF9C 3CCE1 4FTFA 1Q822 1KC82 1I94C 2E9HA 3G4S1 1ULTA 3CMEZ 5A2Qf 1VQ9Z 4DR2C 3RV2A 5D1OB 3ESWA 2D1SA 3B7WA 3OW2Y 2DPLA 3IEVA 4BY1I 1VQLZ 4JI6C 4ODJA 4HGZA 3CCL1 2CXCA 3S1QI 2PMZA 3K7AI 1Q811 3G711 3TE5B 3GTMS 1USPB 3EQ6A 2Y4OA 1LCIA 2QVYX 2YWBA 1K83I 1MXCA 2OBVA 2F4VC 2JUBA 2LIYA 1TWGI 2P02A 1K8A2 4AQYC 4D57A 4NH1C 3LUSA 2WP0C 4R1LA 3T1HC 4RLFA 3AF6A 3P5JB 1YJ7A 4L2ZA 2OOYB 1VQN1 1WF3A 4WS9A 2YADA 3IEUA 4B3SC 2K5RA 1VQ6Z 2W03A 4DCUA 4E2WA 4RM3A 5H9UA 3H0GI 4E31A 3OTOC 4B3MC 3CC2Z 2QEXZ 3S2HI 5IP7I 4A3BI 4LE5A 3GTQI 1O92A 3CCR1 4DUZC 1RO4A 4NBGA 3VMIA 4MTNA 1VQM1 5FLXD 1MDFA 3I4MI 4RVNA 2OPLA 3CCS1 2IZ4A 4TNUA 3GTOI 4G37A 5FLXf 5IT9D 1Y1VI 3F3PC 1J5EC 5IT9f 3NYRA 1QYPA 3GKUA 4RM2A 4DQYB 1P7LA 2P2FA 4DV1C 4LF4C 3NDIA 3G6E1 2PM9A 3OW2Z 3GR1A 3A9VA 4BBSI 2OTL1 2QREB 5A2Qb 2M48A 3CD6Z 3A4IA 1WIIA 1TWCI 3GTJI 1ZB8A 5BUQA 4YY3C 1VQ51 4L7IA 2JMPA 4JV5C 5IP9I 4RVDA 2V7BA 4RMNA 1TFIA 1NP6A 3S1RI 3JAMf 1M902 4JI7C 4GKKC 4DR3C 1RLYA 3DLPX 4MD8A 4AYBA 4GKJC 3KIHA 1N32C 1VQO1 4G36A 2QRCB 5AN9F 4A3GI 4DUYC 4LFCC 3DHVA 4E32A 3E7XA 5T6BA 4B3TC 3CCJ1 4D4GA 1KD12 4Y7NI 4BY7I 3IPLA 2Q4ZA 4XX2A 3VNRA 2O53A 2ZM6C 3R9XA 2QKDA 2ZAEB 1NJI1 3GPCA 1WH9A 2D28C 3CCUZ 1KRLA 2R6MA 2QRDB 4A3KI 4OX9C 5E7QA 2UXBC 4MD9A 1MDBA 3CC71 3M3YI 1Y1WI 2E8FA 2QW0X 1YIT1 1S721 2QVZX 2YWCA 2JMOA 3CXCZ 1PA4A 2OPLB 3NYQA 4DV6C 2E7GA 2RBLA 2D1TA 2P2JA 3CCMZ 2E2JI 5FLXb 4DV4C 2JA8I 4BC9A 1QVFZ 1YI21 2DE7A 5IT9b 3FCEA 4MD7A 3LNVA 4DR4C 1GPMA 2XR1A 2D7VA 1IBKC 1R9TI 3CPWY 4MRIA 2UXCC 4LF6C 1MXBA 3GTLI 3J7A4 1IBMC 3D6WA 1YJW1 1Z02A 2GTIA 3S82A 1K731 2K3RA 2LFUA 5A2QD 1WW9A 4JI8C 3I561 1MKYA 3I07A 3TDHB 3CMAZ 3D9XA 3JAMb 2AKLA 2UUAC 4MONA 2R93I 4NB8A 2P2MA 2JNYA 4I9GA 4A3CI 4RS4A 5LL6f 4KHPC 1FUGA 1N34C 5C4JI 3I4NI 1L1OC 2F4MA 3HOXI 2P20A 3TDEA 3IF8A 3A9UA 2ATWA 3UOWA 3H3VJ 3I08A 1TWFI 3RG2A 1VQ81 5KYVA 1YIJZ 4BC7A 1ZH1A 4DV0C 4MXUA 1YHQZ 3KXWA 5AE1A 1X3WA 2QA4Z 3M4OI 4U5YD 4DV3C 4YHHC 4DR6C 4S1TA 1HNXC 1YJNZ 2V8JA 4CL1A 1XMQC 1XNRC 1P9NA 2NVTI 4DV7C 3T4NB 2QR1B 2HJGA 1JJ2Y 1Q861 2D1QA 3UZ0A 1V26A 1Q812 1Q7Y1 3DAYA 3HOWI 5BSWA 4ZJZA 3CME1 1VQ91 4BCAA 1N8R1 4D4IA 1N36C 3T1YC 4DR7C 2OZKA 3QWUA 1VQL1 5D1PA 3I55Z 4KTVA 4JI0C 1TWAI 1V25A 3C5EA 2NVQI 4NBEA 5GTDA 4LFBC 3PROC 1QVGY
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EER A;  4DUY C;  4LF8 C;  4LFC C;  1XNQ C;  5BR8 C;  4B3T C;  2ONF A;  4DCV A;  3AF5 A;  4XX2 A;  2ZM6 C;  2VQE C;  5LMU C;  1L2F A;  3R9X A;  2HHH C;  1WH9 A;  1EGA A;  1UKK A;  4JI4 C;  4MH4 A;  4B3R C;  4X64 C;  3J80 D;  1IBL C;  4OX9 C;  2E8E A;  2UXB C;  4NXN C;  1JOS A;  2PT7 G;  3JAM D;  1N2F A;  2E8F A;  4NXM C;  1ML8 A;  4JI2 C;  4LF9 C;  1PA4 A;  2OPL B;  4DV6 C;  3J81 D;  1I94 C;  4DR5 C;  2E7G A;  2KZF A;  4DR2 C;  5LMN C;  4DV4 C;  3IEV A;  4DV5 C;  4JI6 C;  2CXC A;  3R9W A;  1HNZ C;  4DR4 C;  1IBK C;  2XR1 A;  2D7V A;  1USP B;  2UUC C;  2DYJ A;  4DV2 C;  2PN2 A;  2VQF C;  4JI1 C;  2UXC C;  4LF6 C;  2F4V C;  1IBM C;  2YCB A;  4AQY C;  1HH2 P;  3T1H C;  3LUS A;  5A2Q D;  3AF6 A;  4JI8 C;  2E8C A;  4X62 C;  1MKY A;  3I07 A;  1WF3 A;  1KKG A;  2E5L C;  4DR1 C;  4X66 C;  2UUA C;  2CY1 A;  3IEU A;  4B3S C;  4DCU A;  3OTO C;  4B3M C;  4KHP C;  2UXD C;  1N34 C;  4LF5 C;  4DUZ C;  2ATW A;  4MTN A;  5FLX D;  1HNW C;  2OPL A;  4DV0 C;  4NOZ A;  5IT9 D;  1LQL A;  2EGT A;  1J5E C;  4DV3 C;  4YHH C;  4JI5 C;  4DR6 C;  4BSZ A;  3GKU A;  1HNX C;  1XMQ C;  1XNR C;  4DV7 C;  4DV1 C;  4LF4 C;  4LFA C;  2UU9 C;  1QWI A;  4DCS A;  1ZB9 A;  2HJG A;  2UUB C;  1FJG C;  1USP A;  2QL8 A;  4JV5 C;  4YY3 C;  1ZB8 A;  1HR0 C;  1XMO C;  2JMP A;  2BJO A;  1N36 C;  4JI3 C;  3T1Y C;  4DR7 C;  1NYE A;  4X65 C;  4K0K C;  4JYA C;  4JI0 C;  1VLA A;  1K0R A;  4JI7 C;  4LF7 C;  4DR3 C;  4GKK C;  4LFB C;  4GKJ C;  1N33 C;  1N32 C;  3CJE A;  4DCT A;  5IWA C;  2ASB A; 
#chains in the Genus database with same CATH topology
 2P2B A;  4LF8 C;  1NY8 A;  4G1I A;  4TPS B;  2P2Q A;  4E2X A;  1Q86 2;  1RY2 A;  2Z51 A;  3NI2 A;  3AF5 A;  2QVX X;  2LEX A;  1XS3 A;  4FUQ A;  2VQE C;  1K9M 1;  1VQ4 Z;  2WD9 A;  3PBK A;  4OXI A;  1I3Q I;  3F3F C;  1VQP Z;  2HHH C;  4RVG A;  1PG3 A;  3PO3 I;  1BA3 A;  1VQK Z;  1Y1V S;  1VQ6 1;  1RQF A;  3JAM D;  4RVH A;  5CM2 M;  2VPW A;  2G2K A;  2QEX 1;  3S16 I;  3NH8 A;  3GTK I;  4JI2 C;  2NVX I;  3NPD A;  2OO4 A;  2JR6 A;  4NDN A;  4NBA A;  4Y52 I;  3IX0 A;  2OTJ Z;  3E7W A;  2KZF A;  5LMN C;  4X6A I;  3CW9 A;  3IML A;  3TUF A;  1SFO I;  3GKQ A;  4DV5 C;  2P3Y A;  2JIP A;  3GTG I;  3N54 B;  5BSR A;  2NCL A;  1YJ9 Z;  1O90 A;  1HNZ C;  1PFT A;  5FLM I;  1QXF A;  3S2D I;  2KPI A;  3HOY I;  4DV2 C;  2PN2 A;  5T8T A;  2VQF C;  1M1K 1;  4JI1 C;  3A26 A;  2R92 I;  5BUS A;  2KDN A;  2JIO A;  3FKI I;  2YCB A;  3MZK B;  4NBF A;  3CD6 1;  1RO2 A;  3LAX A;  5BSV A;  3CQZ I;  3PO2 I;  4RLQ A;  5BUR A;  3CCV Z;  2D1R A;  3CC4 Z;  1MD9 A;  3NDJ A;  4IZ6 A;  2MM9 A;  3FCC A;  2E5L C;  1W2B Y;  5C4X I;  4OYC A;  1Q16 A;  2RT9 A;  1VQ7 Z;  2DE6 A;  1KQS Y;  5CZX A;  4PHT A;  1P4E C;  4BBR I;  4A3J I;  3G7S A;  4FUT A;  3NFZ A;  2NVY I;  2UXD C;  1RO0 A;  1NJI 2;  3CCE Z;  2J6A A;  3PES A;  3G4S Z;  3VNQ A;  4D56 A;  1IB8 A;  1X3Z A;  4KTT A;  5DV9 A;  1T5D X;  3O2E A;  2H85 A;  4NOZ A;  3HOV I;  2P28 A;  3CCL Z;  3CCU 1;  1XHJ A;  5BSU A;  3G71 Z;  1Q82 1;  1KC8 1;  4PZP A;  3LNO A;  4JI5 C;  2JS4 A;  3CCQ 1;  4HPV A;  4A3E I;  5KEI A;  4HGY A;  5KYT A;  4LFA C;  2IV2 X;  2VF1 A;  1M6X C;  4QTU A;  5BST A;  2UUB C;  1JWH C;  1O9T A;  2M5O A;  3K6R A;  4E2Z A;  3VMG A;  4A3M I;  2BH1 X;  4BXX I;  4A3I I;  3H2T A;  1I50 I;  1WCM I;  4NB9 A;  1HR0 C;  4DG9 A;  1XMO C;  3S15 I;  2BJO A;  3CCM 1;  2PK7 A;  2F4O A;  1VQN Z;  3CQ3 A;  5BSM A;  1VLA A;  3ETC A;  4LF7 C;  5LCI A;  5JRH A;  4R1M A;  1FDI A;  4PRO C;  1K73 2;  3ETO A;  1TWH I;  3S1N I;  1WZN A;  4IR7 A;  2PRO A;  3EER A;  4GS5 A;  3CCR Z;  3U50 C;  1W2B Z;  4EAT A;  1FDO A;  1VQM Z;  3S1M I;  1KQS Z;  1O93 A;  3NH4 A;  2ONF A;  5LMU C;  3CCS Z;  2Y0S A;  1YUA A;  2DE5 A;  4E33 A;  1PG4 A;  2DHM A;  3CW8 X;  4WV3 A;  5A1I A;  1EGA A;  3CMA 1;  2RHB A;  3S17 I;  1UKK A;  4JI4 C;  3VMH A;  4B3R C;  5AE2 A;  4X64 C;  4L4Q A;  3VNS A;  2E8E A;  5A1G A;  3J80 D;  4NXN C;  4GXR A;  2PT7 G;  3CPW Z;  5A19 A;  4DG8 A;  3J80 f;  1N2F A;  2WB1 A;  2I3C A;  5ADZ A;  3G6E Z;  1ML8 A;  2RPR A;  1AMU A;  4A3F I;  3UEB A;  2M6N A;  2B63 I;  2OTL Z;  2E0G A;  3J81 D;  4GXQ A;  4DR5 C;  1VQ5 Z;  2E2H I;  2NAP A;  3GTP I;  3J81 f;  1Z01 A;  2Y27 A;  1YIJ 1;  3CQ2 A;  4DGL A;  2Q51 A;  1YHQ 1;  3R9W A;  2AYA A;  2QA4 1;  3FQQ A;  1Q7Y 2;  4R0M A;  3RZO I;  3HOZ I;  2VUM I;  4EWC A;  3IFU A;  3KIF A;  3CQ1 A;  1VQO Z;  1YJN 1;  1N8R 2;  2UUC C;  2DYJ A;  4I9F A;  4PUG A;  2JIM A;  2Y4N A;  3CXC Y;  1M90 1;  2M5H A;  1HH2 P;  2VZE A;  3CCJ Z;  3CC2 1;  3FQM A;  2VPZ A;  2OOX B;  3LGX A;  2WAQ A;  2GU2 A;  2R7Z I;  3R44 A;  2E8C A;  4QTT A;  4A93 I;  5C3E I;  3Q87 A;  3N2Q A;  4X62 C;  5T64 A;  1KKG A;  3I55 1;  4DR1 C;  4X66 C;  2V8I A;  2CY1 A;  5K8F A;  1QVF Y;  4A3D I;  3PO3 S;  2VSQ A;  3TQI A;  3CC7 Z;  2RIQ A;  1QF8 A;  1KD1 1;  2VUG A;  1JJ2 Z;  1K9M 2;  1YIT Z;  5C44 I;  1S72 Z;  1T5H X;  3BG0 B;  2JA7 I;  5T8S A;  3UX2 A;  4NBD A;  4LF5 C;  2E2I I;  2YU9 I;  2KI7 B;  3EED A;  2IZ3 A;  4NFR A;  4NBB A;  3NH5 A;  1HNW C;  3HKZ A;  4NBC A;  2W04 A;  4E2Y A;  5T67 A;  1VQ4 1;  2MMA B;  5AE3 A;  3HOU I;  2JA5 I;  1LQL A;  1NUI A;  1VQP 1;  1YI2 Z;  2EGT A;  4NBH A;  3GR0 A;  3GCF A;  5D1O A;  1VQK 1;  3MZL B;  4BSZ A;  1QVG Z;  3J80 b;  2V3V A;  5CZV A;  1QWI A;  4DCS A;  2UU9 C;  1XRB A;  1ZB9 A;  4E30 A;  1YJW Z;  1FJG C;  1USP A;  3MON A;  2QL8 A;  3L8C A;  4ISB A;  2OTJ 1;  3J81 b;  2HU9 A;  4A3L I;  4JM1 A;  1DL6 A;  3CCQ Z;  1RNI A;  1M1K 2;  3I56 Z;  4JI3 C;  1WJ2 A;  4HH4 A;  1NYE A;  4X65 C;  4K0K C;  2V8K A;  4JYA C;  1S7M A;  1WCJ A;  1XRC A;  4BBY A;  3UX3 A;  1P4E A;  4RVF A;  1K0R A;  3BG1 B;  4ZLP A;  1YJ9 1;  1N33 C;  4K0B A;  1MXA A;  3CJE A;  4DCT A;  5IWA C;  3IR7 A;  2JA6 I;  3VB9 A;  2ASB A;  1RG9 A;  2QLV B;  3RZD I;  1QM4 A;  1XNQ C;  4DK1 A;  3D2L A;  2O4H A;  5BR8 C;  2GTH A;  2HF1 A;  5IFI A;  4DCV A;  3VTN A;  1VQ8 Z;  4RVO A;  1YUK A;  1L2F A;  3CCV 1;  3CC4 1;  3SO4 A;  3S14 I;  1UWD A;  4MH4 A;  3L95 X;  1Z03 A;  2MCQ A;  1IBL C;  1JOS A;  5K85 A;  1VQ7 1;  1M6X A;  1XRA A;  1I6H I;  2D27 A;  4NXM C;  1K8A 1;  3GTM I;  1X0T A;  4RV9 A;  4LF9 C;  3CCE 1;  4FTF A;  1Q82 2;  1KC8 2;  1I94 C;  2E9H A;  3G4S 1;  1ULT A;  3CME Z;  5A2Q f;  1VQ9 Z;  4DR2 C;  3RV2 A;  5D1O B;  3ESW A;  2D1S A;  3B7W A;  4PUH A;  3OW2 Y;  2DPL A;  3IEV A;  4BY1 I;  1VQL Z;  4JI6 C;  4ODJ A;  4HGZ A;  3CCL 1;  2CXC A;  3S1Q I;  2PMZ A;  3K7A I;  1Q81 1;  3G71 1;  3TE5 B;  3GTM S;  1USP B;  3EQ6 A;  2Y4O A;  1LCI A;  2QVY X;  2YWB A;  1K83 I;  1MXC A;  2OBV A;  2F4V C;  2JUB A;  2LIY A;  1TWG I;  2P02 A;  1K8A 2;  4AQY C;  4D57 A;  4NH1 C;  3LUS A;  2WP0 C;  4R1L A;  3T1H C;  4RLF A;  3AF6 A;  3P5J B;  1YJ7 A;  4L2Z A;  2OOY B;  1VQN 1;  1WF3 A;  4WS9 A;  2YAD A;  3IEU A;  4B3S C;  2K5R A;  1VQ6 Z;  2W03 A;  4DCU A;  4E2W A;  4RM3 A;  5H9U A;  3H0G I;  4E31 A;  3OTO C;  4B3M C;  3CC2 Z;  2ZZN A;  2QEX Z;  3S2H I;  5IP7 I;  4A3B I;  4LE5 A;  3GTQ I;  1O92 A;  3CCR 1;  4DUZ C;  1RO4 A;  4NBG A;  3VMI A;  4MTN A;  1VQM 1;  5FLX D;  1MDF A;  3I4M I;  4RVN A;  2OPL A;  3CCS 1;  2IZ4 A;  4TNU A;  3GTO I;  4G37 A;  5FLX f;  5IT9 D;  2JNV A;  1Y1V I;  3F3P C;  1J5E C;  2VPY A;  5IT9 f;  3NYR A;  1QYP A;  2JIQ A;  2YX1 A;  3GKU A;  4DQY B;  1P7L A;  4RM2 A;  2P2F A;  4DV1 C;  4LF4 C;  1VEH A;  3NDI A;  3G6E 1;  2PM9 A;  3OW2 Z;  3GR1 A;  3A9V A;  4BBS I;  2OTL 1;  2QRE B;  2VPX A;  5A2Q b;  2M48 A;  3CD6 Z;  3A4I A;  1WII A;  1TWC I;  3GTJ I;  1ZB8 A;  5BUQ A;  4YY3 C;  1VQ5 1;  4L7I A;  2JMP A;  4JV5 C;  5IP9 I;  4RVD A;  2V7B A;  4RMN A;  1TFI A;  1NP6 A;  3S1R I;  3JAM f;  1M90 2;  4JI7 C;  4GKK C;  4DR3 C;  1RLY A;  3DLP X;  4MD8 A;  4AYB A;  4GKJ C;  3KIH A;  1N32 C;  1VQO 1;  4G36 A;  2QRC B;  5AN9 F;  4A3G I;  4DUY C;  4LFC C;  3DHV A;  4E32 A;  3E7X A;  5T6B A;  3A25 A;  4B3T C;  3CCJ 1;  4D4G A;  1KD1 2;  4Y7N I;  4BY7 I;  3IPL A;  2Q4Z A;  4XX2 A;  3VNR A;  2O53 A;  2ZM6 C;  3R9X A;  2QKD A;  2ZAE B;  1NJI 1;  3GPC A;  1WH9 A;  2D28 C;  3CCU Z;  1KRL A;  2R6M A;  2KZ0 A;  2QRD B;  4A3K I;  4OX9 C;  5E7Q A;  1FLO A;  4MD9 A;  2UXB C;  1MDB A;  3CC7 1;  3M3Y I;  1Y1W I;  2E8F A;  2QW0 X;  1YIT 1;  1S72 1;  2QVZ X;  2JIR A;  2YWC A;  2JMO A;  3CXC Z;  1PA4 A;  2OPL B;  3NYQ A;  4DV6 C;  1V60 A;  2E7G A;  2RBL A;  2D1T A;  1TH5 A;  3CCM Z;  2P2J A;  2E2J I;  5FLX b;  4DV4 C;  2JA8 I;  4BC9 A;  1QVF Z;  1YI2 1;  2DE7 A;  5IT9 b;  2E7Z A;  1Y8C A;  3FCE A;  4MD7 A;  3LNV A;  4DR4 C;  1GPM A;  2XR1 A;  2D7V A;  1IBK C;  3TR3 A;  1R9T I;  3CPW Y;  4MRI A;  2UXC C;  4LF6 C;  1MXB A;  3GTL I;  3J7A 4;  1IBM C;  3D6W A;  1YJW 1;  1Z02 A;  2V45 A;  2GTI A;  2AYD A;  1AA6 A;  1K73 1;  2K3R A;  2LFU A;  3S82 A;  5A2Q D;  1WW9 A;  4JI8 C;  3I56 1;  1MKY A;  3I07 A;  3TDH B;  3CMA Z;  3D9X A;  3JAM b;  2CU6 A;  2AKL A;  2UUA C;  4MON A;  1SIW A;  2R93 I;  4NB8 A;  2P2M A;  2JNY A;  4I9G A;  4A3C I;  4RS4 A;  5LL6 f;  4KHP C;  1FUG A;  1N34 C;  5C4J I;  3I4N I;  1L1O C;  2F4M A;  3HOX I;  2P20 A;  3TDE A;  3IF8 A;  3A9U A;  2ATW A;  3UOW A;  3H3V J;  3I08 A;  1TWF I;  3RG2 A;  1VQ8 1;  5KYV A;  1YIJ Z;  4BC7 A;  1ZH1 A;  4DV0 C;  4MXU A;  2ZZM A;  1YHQ Z;  3KXW A;  4PUI A;  1X3W A;  5AE1 A;  2QA4 Z;  3M4O I;  4U5Y D;  4DV3 C;  4YHH C;  4DR6 C;  4S1T A;  1HNX C;  1YJN Z;  2V8J A;  4CL1 A;  1XMQ C;  1XNR C;  1P9N A;  2NVT I;  4DV7 C;  3T4N B;  2QR1 B;  2HJG A;  1JJ2 Y;  1Q86 1;  2D1Q A;  3UZ0 A;  1V26 A;  1Q81 2;  1PU1 A;  1Q7Y 1;  3DAY A;  3HOW I;  5BSW A;  4ZJZ A;  3CME 1;  1VQ9 1;  4BCA A;  1N8R 1;  4D4I A;  1N36 C;  3T1Y C;  4DR7 C;  3AY0 A;  2OZK A;  3QWU A;  1VQL 1;  5D1P A;  3I55 Z;  4KTV A;  4JI0 C;  1TWA I;  1V25 A;  3C5E A;  2NVQ I;  4NBE A;  5GTD A;  4LFB C;  3PRO C;  1QVG Y; 
#chains in the Genus database with same CATH homology
 2P2B A;  4LF8 C;  4G1I A;  4TPS B;  2P2Q A;  4E2X A;  1Q86 2;  1RY2 A;  3NI2 A;  3AF5 A;  2QVX X;  2VQE C;  4FUQ A;  1K9M 1;  1VQ4 Z;  2WD9 A;  3PBK A;  4OXI A;  1I3Q I;  3F3F C;  1VQP Z;  4RVG A;  1PG3 A;  3PO3 I;  1BA3 A;  1VQK Z;  1Y1V S;  1VQ6 1;  1RQF A;  3JAM D;  4RVH A;  5CM2 M;  2G2K A;  2QEX 1;  3S16 I;  3NH8 A;  3GTK I;  4JI2 C;  2NVX I;  3NPD A;  2OO4 A;  2JR6 A;  4NDN A;  4NBA A;  4Y52 I;  3IX0 A;  2OTJ Z;  3E7W A;  2KZF A;  5LMN C;  4X6A I;  3CW9 A;  3IML A;  3TUF A;  1SFO I;  3GKQ A;  4DV5 C;  2P3Y A;  3GTG I;  3N54 B;  5BSR A;  1YJ9 Z;  1O90 A;  1HNZ C;  1PFT A;  5FLM I;  3S2D I;  2KPI A;  3HOY I;  4DV2 C;  2PN2 A;  5T8T A;  2VQF C;  1M1K 1;  4JI1 C;  2R92 I;  5BUS A;  3FKI I;  2YCB A;  3MZK B;  4NBF A;  3CD6 1;  1RO2 A;  3LAX A;  5BSV A;  3CQZ I;  3PO2 I;  4RLQ A;  5BUR A;  3CCV Z;  2D1R A;  3CC4 Z;  1MD9 A;  3NDJ A;  4IZ6 A;  3FCC A;  2E5L C;  1W2B Y;  5C4X I;  4OYC A;  2RT9 A;  1VQ7 Z;  1KQS Y;  2DE6 A;  5CZX A;  4PHT A;  4BBR I;  4A3J I;  3G7S A;  4FUT A;  3NFZ A;  2NVY I;  2UXD C;  1RO0 A;  1NJI 2;  3CCE Z;  2J6A A;  3PES A;  3G4S Z;  3VNQ A;  4D56 A;  1X3Z A;  4KTT A;  5DV9 A;  1T5D X;  2H85 A;  4NOZ A;  3HOV I;  2P28 A;  3CCL Z;  3CCU 1;  5BSU A;  3G71 Z;  1Q82 1;  1KC8 1;  4PZP A;  4JI5 C;  2JS4 A;  3CCQ 1;  4HPV A;  4A3E I;  5KEI A;  4HGY A;  5KYT A;  4LFA C;  2VF1 A;  4QTU A;  5BST A;  2UUB C;  1JWH C;  1O9T A;  4E2Z A;  3VMG A;  4A3M I;  2BH1 X;  4BXX I;  4A3I I;  3H2T A;  1I50 I;  1WCM I;  4NB9 A;  1HR0 C;  4DG9 A;  1XMO C;  3S15 I;  2BJO A;  3CCM 1;  2PK7 A;  2F4O A;  1VQN Z;  5BSM A;  1VLA A;  3ETC A;  4LF7 C;  5JRH A;  4R1M A;  4PRO C;  1K73 2;  3ETO A;  1TWH I;  3S1N I;  4IR7 A;  2PRO A;  3EER A;  4GS5 A;  3CCR Z;  3U50 C;  1W2B Z;  4EAT A;  1VQM Z;  3S1M I;  1KQS Z;  1O93 A;  3NH4 A;  2ONF A;  5LMU C;  3CCS Z;  2Y0S A;  1YUA A;  2DE5 A;  4E33 A;  1PG4 A;  2HHH C;  3CW8 X;  4WV3 A;  5A1I A;  1EGA A;  3CMA 1;  2RHB A;  3S17 I;  1UKK A;  4JI4 C;  3VMH A;  4B3R C;  5AE2 A;  4X64 C;  4L4Q A;  3VNS A;  2E8E A;  5A1G A;  3J80 D;  4NXN C;  4GXR A;  2PT7 G;  3CPW Z;  5A19 A;  4DG8 A;  3J80 f;  1N2F A;  2WB1 A;  2I3C A;  5ADZ A;  3G6E Z;  1ML8 A;  2RPR A;  1AMU A;  4A3F I;  2M6N A;  2B63 I;  2OTL Z;  2E0G A;  3J81 D;  4GXQ A;  4DR5 C;  1VQ5 Z;  2E2H I;  3GTP I;  3J81 f;  1Z01 A;  2Y27 A;  1YIJ 1;  4DGL A;  2Q51 A;  1YHQ 1;  3R9W A;  2AYA A;  2QA4 1;  3FQQ A;  1Q7Y 2;  4R0M A;  3RZO I;  3HOZ I;  2VUM I;  4EWC A;  3IFU A;  3KIF A;  1VQO Z;  1YJN 1;  1N8R 2;  2UUC C;  2DYJ A;  4I9F A;  2Y4N A;  3CXC Y;  1M90 1;  2VZE A;  1HH2 P;  3CCJ Z;  3FQM A;  3CC2 1;  2OOX B;  3LGX A;  2WAQ A;  2GU2 A;  2R7Z I;  3R44 A;  2E8C A;  4QTT A;  4A93 I;  5C3E I;  3Q87 A;  3N2Q A;  4X62 C;  5T64 A;  1KKG A;  3I55 1;  4DR1 C;  4X66 C;  2V8I A;  2CY1 A;  5K8F A;  1QVF Y;  4A3D I;  3PO3 S;  2VSQ A;  3TQI A;  3CC7 Z;  2RIQ A;  1QF8 A;  1KD1 1;  2VUG A;  1JJ2 Z;  1K9M 2;  1YIT Z;  5C44 I;  1S72 Z;  1T5H X;  3BG0 B;  2JA7 I;  5T8S A;  4NBD A;  4LF5 C;  2E2I I;  2YU9 I;  2KI7 B;  3EED A;  2IZ3 A;  4NFR A;  4NBB A;  3NH5 A;  1HNW C;  3HKZ A;  4NBC A;  2W04 A;  4E2Y A;  5T67 A;  1VQ4 1;  5AE3 A;  3HOU I;  2JA5 I;  1LQL A;  1VQP 1;  1NUI A;  1YI2 Z;  2EGT A;  4NBH A;  3GR0 A;  3GCF A;  5D1O A;  1VQK 1;  3MZL B;  4BSZ A;  1QVG Z;  3J80 b;  5CZV A;  1QWI A;  4DCS A;  2UU9 C;  1XRB A;  1ZB9 A;  4E30 A;  1YJW Z;  1FJG C;  1USP A;  3MON A;  2QL8 A;  3L8C A;  4ISB A;  2OTJ 1;  3J81 b;  2HU9 A;  4A3L I;  4JM1 A;  1DL6 A;  3CCQ Z;  1RNI A;  1M1K 2;  3I56 Z;  4JI3 C;  4HH4 A;  1NYE A;  4X65 C;  4K0K C;  2V8K A;  4JYA C;  1S7M A;  1XRC A;  4BBY A;  4RVF A;  1K0R A;  3BG1 B;  4ZLP A;  1YJ9 1;  1N33 C;  4K0B A;  1MXA A;  3CJE A;  4DCT A;  5IWA C;  2JA6 I;  3VB9 A;  2ASB A;  1RG9 A;  2QLV B;  3RZD I;  1QM4 A;  1XNQ C;  4DK1 A;  2O4H A;  5BR8 C;  2GTH A;  2HF1 A;  5IFI A;  4DCV A;  3VTN A;  1VQ8 Z;  4RVO A;  1YUK A;  1L2F A;  3CCV 1;  3CC4 1;  3SO4 A;  3S14 I;  4MH4 A;  3L95 X;  1Z03 A;  1IBL C;  1JOS A;  5K85 A;  1VQ7 1;  1XRA A;  1I6H I;  2D27 A;  4NXM C;  1K8A 1;  3GTM I;  1X0T A;  4RV9 A;  4LF9 C;  3CCE 1;  4FTF A;  1Q82 2;  1KC8 2;  1I94 C;  2E9H A;  3G4S 1;  1ULT A;  3CME Z;  5A2Q f;  1VQ9 Z;  4DR2 C;  3RV2 A;  5D1O B;  3ESW A;  2D1S A;  3B7W A;  3OW2 Y;  2DPL A;  3IEV A;  4BY1 I;  1VQL Z;  4JI6 C;  4ODJ A;  4HGZ A;  3CCL 1;  2CXC A;  3S1Q I;  2PMZ A;  3K7A I;  1Q81 1;  3G71 1;  3TE5 B;  3GTM S;  1USP B;  3EQ6 A;  2Y4O A;  1LCI A;  2QVY X;  2YWB A;  1K83 I;  1MXC A;  2OBV A;  2F4V C;  2JUB A;  2LIY A;  1TWG I;  2P02 A;  1K8A 2;  4AQY C;  4D57 A;  4NH1 C;  3LUS A;  2WP0 C;  4R1L A;  3T1H C;  4RLF A;  3AF6 A;  3P5J B;  1YJ7 A;  4L2Z A;  2OOY B;  1VQN 1;  1WF3 A;  4WS9 A;  2YAD A;  3IEU A;  4B3S C;  2K5R A;  1VQ6 Z;  2W03 A;  4DCU A;  4E2W A;  4RM3 A;  5H9U A;  3H0G I;  4E31 A;  3OTO C;  4B3M C;  3CC2 Z;  2QEX Z;  3S2H I;  5IP7 I;  4A3B I;  4LE5 A;  3GTQ I;  1O92 A;  3CCR 1;  4DUZ C;  1RO4 A;  4NBG A;  3VMI A;  4MTN A;  1VQM 1;  5FLX D;  1MDF A;  3I4M I;  4RVN A;  2OPL A;  3CCS 1;  2IZ4 A;  4TNU A;  3GTO I;  4G37 A;  5FLX f;  5IT9 D;  1Y1V I;  3F3P C;  1J5E C;  5IT9 f;  3NYR A;  1QYP A;  3GKU A;  4RM2 A;  4DQY B;  1P7L A;  2P2F A;  4DV1 C;  4LF4 C;  3NDI A;  3G6E 1;  2PM9 A;  3OW2 Z;  3GR1 A;  3A9V A;  4BBS I;  2OTL 1;  2QRE B;  5A2Q b;  2M48 A;  3CD6 Z;  3A4I A;  1WII A;  1TWC I;  3GTJ I;  1ZB8 A;  5BUQ A;  4YY3 C;  1VQ5 1;  4L7I A;  2JMP A;  4JV5 C;  5IP9 I;  4RVD A;  2V7B A;  4RMN A;  1TFI A;  1NP6 A;  3S1R I;  3JAM f;  1M90 2;  4JI7 C;  4GKK C;  4DR3 C;  1RLY A;  3DLP X;  4MD8 A;  4AYB A;  4GKJ C;  3KIH A;  1N32 C;  1VQO 1;  4G36 A;  2QRC B;  5AN9 F;  4A3G I;  4DUY C;  4LFC C;  3DHV A;  4E32 A;  3E7X A;  5T6B A;  4B3T C;  3CCJ 1;  4D4G A;  1KD1 2;  4Y7N I;  4BY7 I;  3IPL A;  2Q4Z A;  4XX2 A;  3VNR A;  2O53 A;  2ZM6 C;  3R9X A;  2QKD A;  2ZAE B;  1NJI 1;  3GPC A;  1WH9 A;  2D28 C;  3CCU Z;  1KRL A;  2R6M A;  2QRD B;  4A3K I;  4OX9 C;  5E7Q A;  2UXB C;  4MD9 A;  1MDB A;  3CC7 1;  3M3Y I;  1Y1W I;  2E8F A;  2QW0 X;  1YIT 1;  1S72 1;  2QVZ X;  2YWC A;  2JMO A;  3CXC Z;  1PA4 A;  2OPL B;  3NYQ A;  4DV6 C;  2E7G A;  2RBL A;  2D1T A;  2P2J A;  3CCM Z;  2E2J I;  5FLX b;  4DV4 C;  2JA8 I;  4BC9 A;  1QVF Z;  1YI2 1;  2DE7 A;  5IT9 b;  3FCE A;  4MD7 A;  3LNV A;  4DR4 C;  1GPM A;  2XR1 A;  2D7V A;  1IBK C;  1R9T I;  3CPW Y;  4MRI A;  2UXC C;  4LF6 C;  1MXB A;  3GTL I;  3J7A 4;  1IBM C;  3D6W A;  1YJW 1;  1Z02 A;  2GTI A;  3S82 A;  1K73 1;  2K3R A;  2LFU A;  5A2Q D;  1WW9 A;  4JI8 C;  3I56 1;  1MKY A;  3I07 A;  3TDH B;  3CMA Z;  3D9X A;  3JAM b;  2AKL A;  2UUA C;  4MON A;  2R93 I;  4NB8 A;  2P2M A;  2JNY A;  4I9G A;  4A3C I;  4RS4 A;  5LL6 f;  4KHP C;  1FUG A;  1N34 C;  5C4J I;  3I4N I;  1L1O C;  2F4M A;  3HOX I;  2P20 A;  3TDE A;  3IF8 A;  3A9U A;  2ATW A;  3UOW A;  3H3V J;  3I08 A;  1TWF I;  3RG2 A;  1VQ8 1;  5KYV A;  1YIJ Z;  4BC7 A;  1ZH1 A;  4DV0 C;  4MXU A;  1YHQ Z;  3KXW A;  5AE1 A;  1X3W A;  2QA4 Z;  3M4O I;  4U5Y D;  4DV3 C;  4YHH C;  4DR6 C;  4S1T A;  1HNX C;  1YJN Z;  2V8J A;  4CL1 A;  1XMQ C;  1XNR C;  1P9N A;  2NVT I;  4DV7 C;  3T4N B;  2QR1 B;  2HJG A;  1JJ2 Y;  1Q86 1;  2D1Q A;  3UZ0 A;  1V26 A;  1Q81 2;  1Q7Y 1;  3DAY A;  3HOW I;  5BSW A;  4ZJZ A;  3CME 1;  1VQ9 1;  4BCA A;  1N8R 1;  4D4I A;  1N36 C;  3T1Y C;  4DR7 C;  2OZK A;  3QWU A;  1VQL 1;  5D1P A;  3I55 Z;  4KTV A;  4JI0 C;  1TWA I;  1V25 A;  3C5E A;  2NVQ I;  4NBE A;  5GTD A;  4LFB C;  3PRO C;  1QVG Y; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...