2EGTA

Crystal structure of hypothetical protein (aq1549) from aquifex aeolicus
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Hypothetical protein (AQ1549) from Aquifex aeolicus
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AQ_1549
total genus 42
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.300 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2egtA01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2egtA02
3GKUA 1JOSA 4LF4C 3R9XA 4X66C 4DR6C 4LF9C 4DR7C 2PN2A 4YY3C 4XX2A 1HNXC 1QWIA 2D7VA 2E8EA 3AF6A 1WH9A 3T1YC 5LMNC 2E8CA 4DV6C 4BSZA 4JI2C 1I94C 3J80D 4DCSA 5LMUC 1KKGA 4MH4A 5FLXD 2E5LC 5A2QD 1XMQC 4DR5C 4LFCC 4LF8C 2QL8A 2ONFA 3JAMD 2UXDC 1UKKA 4DV0C 4B3TC 4DCTA 3LUSA 4LFBC 4JI4C 3IEUA 4AQYC 1EGAA 4X64C 1ML8A 4DR4C 2EGTA 4DV5C 1NYEA 2BJOA 4JI0C 2ASBA 1FJGC 4DR1C 4DV7C 2CY1A 4GKJC 5IWAC 3J81D 4DV2C 2CXCA 4KHPC 2E7GA 1N34C 1ZB8A 2UXCC 1MKYA 2JMPA 2UXBC 4B3RC 3AF5A 4B3MC 2YCBA 5BR8C 4LF5C 1VLAA 4DUZC 2UU9C 3R9WA 1LQLA 4JI8C 1N32C 4DR2C 2KZFA 3CJEA 4JV5C 1HH2P 1HNZC 4DCUA 2DYJA 4YHHC 1L2FA 4OX9C 1N36C 2VQFC 4GKKC 1N2FA 1N33C 4DV1C 3T1HC 1XNQC 4DV3C 1IBKC 3EERA 1K0RA 5IT9D 2UUBC 2ATWA 4LF7C 4NXMC 4DV4C 1HNWC 4JI6C 2PT7G 3OTOC 4DCVA 2E8FA 1PA4A 2XR1A 4JI1C 4JI5C 2OPLA 4MTNA 2OPLB 4LFAC 4JI3C 2F4VC 4NOZA 4LF6C 4JYAC 1IBMC 4X62C 2HHHC 4X65C 2UUCC 1HR0C 2VQEC 4K0KC 4DR3C 2UUAC 1WF3A 1ZB9A 1IBLC 1USPB 4JI7C 3IEVA 2HJGA 3I07A 1XMOC 1USPA 4B3SC 4NXNC 1XNRC 1J5EC 4DUYC 2ZM6C
chains in the Genus database with same CATH superfamily
3CMEZ 3TDEA 3R9XA 2QA4Z 2E9HA 4MD7A 5AE2A 1W2BZ 4YY3C 3HKZA 5T8TA 3GTMI 4G1IA 1PFTA 4NBGA 1QWIA 5AE3A 2Y0SA 2CU6A 5BUQA 1K8A1 5D1OB 4OXIA 3CCUZ 5D1PA 3R44A 4E31A 3PO2I 4D57A 3NDIA 3VMGA 5K85A 3CCLZ 5LMNC 2V7BA 2R7ZI 1VQ9Z 3A25A 1M902 4DCSA 2D1SA 3J80D 5LMUC 5FLXD 4NH1C 5A2QD 1I3QI 3BG0B 3CCS1 1DL6A 4ZJZA 2JS4A 4LFCC 1V60A 1NJI2 1VQN1 4A3II 1YHQZ 2QL8A 2ONFA 3NH4A 1FUGA 2OZKA 2E0GA 2UXDC 3T4NB 4B3TC 3CCQ1 4JI4C 3G4S1 3IEUA 1NUIA 3G4SZ 1EGAA 1Y1VS 4RM3A 3TE5B 4JI0C 1Y1WI 1FJGC 1VQNZ 2ZAEB 3O2EA 4GKJC 5T64A 5IT9b 1KQSZ 2NAPA 1T5DX 4L4QA 1QM4A 2WAQA 5LL6f 1MXCA 3LGXA 4GXQA 2CXCA 5IP9I 1FDOA 1Q7Y1 4Y52I 2YX1A 5AN9F 1R9TI 3TQIA 4RV9A 3EQ6A 3DHVA 1YUAA 1Q861 3G7SA 4OYCA 4RVOA 4B3MC 2E2JI 1MXAA 2YCBA 3I4MI 4A3CI 3NI2A 3CC7Z 5BR8C 1VLAA 4LF5C 3CCQZ 1YJNZ 5FLMI 1S7MA 4E2YA 1SIWA 1Q811 2PK7A 4FTFA 4JI8C 2AYDA 3VTNA 1VQ8Z 4DR2C 3ETCA 1QVFZ 1Q862 3CC2Z 1YJ91 5KYTA 1HH2P 3F3PC 4TNUA 1HNZC 2DYJA 4OX9C 2D1RA 4DG9A 4GKKC 2VPWA 3GTLI 2K5RA 2JMOA 2V3VA 2WB1A 2VUGA 4RVHA 1UWDA 1XRCA 1S72Z 2Z51A 2OOXB 3M3YI 3CQ1A 4RVNA 2QEXZ 2HF1A 2E2II 1XRAA 1I50I 3S1MI 3CQ2A 4ODJA 4PZPA 3UOWA 4DV1C 3CCU1 2E2HI 1M1K2 1VQM1 4MXUA 1GPMA 5IT9D 1VEHA 4NXMC 5JRHA 1YJ7A 1N8R1 1HNWC 1WZNA 2D1QA 2KDNA 4DGLA 4QTTA 1PA4A 4D4IA 3C5EA 1S721 4JI5C 3NH8A 4KTVA 2YWCA 2WD9A 2NVTI 4LFAC 4LF6C 3CQZI 3MZKB 3NPDA 3IF8A 1QVFY 1YJWZ 4RVFA 1YIJ1 4X65C 3TDHB 3H3VJ 5KEIA 4NBCA 3CW8X 4BY7I 1VQ81 3GTQI 1IBLC 1USPB 1RO4A 4JI7C 3I07A 4A3BI 1YI2Z 5D1OA 3CC71 3CW9A 3KXWA 4PUIA 4HGZA 4DUYC 2F4MA 1VQ71 3PBKA 2QW0X 1PG4A 2QLVB 1RNIA 4LF9C 2K3RA 2P2QA 2D7VA 2E8EA 1VQ7Z 2QR1B 2Q51A 3AF6A 2RIQA 4RVDA 1XS3A 3MONA 2JIRA 3AY0A 4DV6C 4JI2C 1I94C 5KYVA 2VF1A 4NB9A 3CC4Z 4X6AI 4IZ6A 2G2KA 3EEDA 3IFUA 4NBDA 4BBRI 5A1GA 1X3ZA 2P2MA 4NDNA 4E30A 4A3KI 1NP6A 4NFRA 4LF8C 3B7WA 3FQMA 3I08A 1UKKA 2QRDB 1PG3A 2AKLA 3VNRA 3CCR1 3LUSA 1TWCI 2QKDA 3FKII 5CM2M 5C3EI 3PO3S 4X64C 2ZZNA 1Z01A 4DR4C 4E2XA 2EGTA 3A4IA 3J80f 1SFOI 3CMA1 2BJOA 2RPRA 4BY1I 1NYEA 3LNVA 1VQMZ 5BURA 2ASBA 1WW9A 4RVGA 3HOWI 3E7WA 4BCAA 5IWAC 3J81D 3UZ0A 4DV2C 3D9XA 1QVGZ 1QXFA 5FLXb 1YI21 3H2TA 2DE6A 1RY2A 1N34C 4BBSI 3NDJA 2UXCC 1KQSY 3KIHA 3P5JB 3CME1 5DV9A 4L7IA 2IZ4A 4B3RC 1K8A2 2R6MA 4PHTA 1PU1A 2DE7A 4DK1A 2QRCB 4HH4A 3R9WA 3IPLA 2GTHA 3Q87A 2P20A 1N32C 3S17I 3NFZA 4PROC 5K8FA 3GTJI 2P2BA 2MM9A 3LNOA 5LCIA 4DCUA 2LIYA 1L2FA 2VUMI 2OTLZ 4NBFA 1RG9A 1N2FA 1N33C 3CD61 2E7ZA 3J81f 3A9VA 3S82A 3HOUI 2JNYA 4DV3C 3GCFA 1YIT1 1K0RA 3GR0A 2JIOA 4HPVA 3I561 4LF7C 2ATWA 3A9UA 2JIPA 1Q821 3OTOC 2GTIA 2O4HA 4NBHA 5CZVA 2E8FA 3CC21 1QF8A 2OPLA 4G37A 2BH1X 1V25A 1ZH1A 4HGYA 4NOZA 3CCMZ 1VQ5Z 3FQQA 5C44I 4NB8A 1IBMC 3JAMb 4X62C 5ADZA 1K9M1 3I55Z 1V26A 2VQEC 1MD9A 3CCJZ 4D4GA 2O53A 3NYQA 2M48A 4DR3C 1VQK1 1ZB9A 2WP0C 3IEVA 3OW2Z 1VQKZ 2HJGA 3VNQA 4B3SC 3OW2Y 4E2ZA 1VQOZ 3LAXA 5AE1A 2ZM6C 4PUHA 3GKUA 1RO0A 1QYPA 5E7QA 4LF4C 3CCRZ 1X3WA 1W2BY 2R92I 4DR7C 2PN2A 3S1QI 3RG2A 2QA41 3FCEA 2YU9I 4FUQA 4U5YD 2LFUA 1WH9A 2M6NA 3T1YC 2JR6A 4NBBA 4NBAA 4R1LA 4BSZA 4MH4A 3ESWA 3CC41 1P7LA 2NVYI 2AYAA 1XMQC 3TR3A 4A3DI 4CL1A 4DG8A 3S1NI 4RMNA 4DR5C 1VQ41 2B63I 5A19A 5CZXA 2GU2A 3JAMD 2IZ3A 1MDFA 1O93A 2Y4NA 4LFBC 1WCJA 2VPXA 4EATA 3S2HI 1WJ2A 3KIFA 1VQPZ 4DV5C 2VPYA 1VQLZ 1AA6A 1RO2A 2JA8I 1X0TA 3CPWZ 1VQ4Z 4IR7A 4DV7C 1WCMI 2I3CA 3J7A4 2V8KA 4RLFA 4BC9A 1K732 3GTKI 3D2LA 2QVYX 3IMLA 1TWAI 4E2WA 2HU9A 4ZLPA 1M901 3HOZI 3N2QA 4DQYB 2Q4ZA 4MRIA 2E7GA 5IT9f 2RT9A 3A26A 3S16I 1MKYA 4ISBA 1VQP1 2MCQA 3L8CA 4G36A 1YUKA 4PUGA 4DUZC 5A1IA 3CXCZ 3CXCY 3CMAZ 1MXBA 2LEXA 3DAYA 3NH5A 5T8SA 2PROA 4JV5C 1P4EA 1RLYA 3RZOI 4YHHC 2DPLA 2V8JA 3GKQA 2RBLA 4RM2A 3S2DI 3S1RI 3IR7A 3CCJ1 3RZDI 4EWCA 5BSMA 2P28A 4MD9A 3S14I 1K83I 1XNQC 2VSQA 2KI7B 2P2JA 3QWUA 4NBEA 4A3JI 1VQ6Z 3VMIA 1YJN1 3GTPI 2D1TA 2H85A 5BSUA 4DCVA 2P2FA 3CCSZ 2D27A 2XR1A 1VQO1 4JI1C 4Y7NI 5T6BA 4LE5A 3E7XA 2F4VC 4JI3C 3H0GI 5BUSA 3CCL1 2OOYB 4JYAC 5C4XI 2QVZX 2HHHC 1O90A 1HR0C 3I551 5A2Qb 2UUCC 5T67A 1M6XA 4MD8A 2RHBA 3IX0A 1WF3A 1AMUA 3S15I 3U50C 4A93I 3CCE1 3GR1A 1KRLA 3UEBA 2OTJ1 4RS4A 1NJI1 1JOSA 4KTTA 4X66C 4QTUA 3VB9A 3UX3A 3ETOA 1T5HX 4DR6C 1N8R2 4XX2A 1HNXC 3MZLB 1KD12 3HOXI 1Z02A 1RQFA 2NVQI 1XHJA 2VPZA 2W04A 2QVXX 2W03A 3CPWY 2Y27A 1P9NA 2QREB 4A3GI 2E8CA 4A3MI 1VQL1 2M5OA 2VZEA 1KKGA 2E5LC 3PO3I 2D28C 2DHMA 1O9TA 4I9FA 1M6XC 3D6WA 2PM9A 2JA7I 1L1OC 4R1MA 2QEX1 1MDBA 3VNSA 4TPSB 3GTOI 1ULTA 2P02A 3F3FC 2YWBA 3N54B 4DV0C 3BG1B 4DCTA 1Q7Y2 3DLPX 1IB8A 4AQYC 3G71Z 2M5HA 3CQ3A 1ML8A 2JUBA 1WIIA 1FLOA 4WS9A 3M4OI 3L95X 4E33A 1Z03A 4DR1C 2CY1A 2V8IA 3G6EZ 3PESA 1TWHI 1JWHC 2JIQA 2NVXI 5H9UA 3CCVZ 3CCEZ 3HOYI 4KHPC 3GTGI 3JAMf 1ZB8A 2JMPA 2YADA 5A2Qf 2UXBC 3AF5A 4BC7A 3PROC 4R0MA 1P4EC 1FDIA 1TWGI 2UU9C 3SO4A 1KD11 1LQLA 2J6AA 2NCLA 4FUTA 2JNVA 3TUFA 4S1TA 2KPIA 4GS5A 1K731 1XRBA 2KZFA 5C4JI 5IFIA 3CCV1 1Q812 3CJEA 5BSVA 4AYBA 4E32A 4I9GA 3FCCA 2ZZMA 1VQ61 3CCM1 1VQ51 1N36C 2VQFC 2V45A 4L2ZA 2JA5I 5BSWA 5IP7I 4A3FI 1KC81 1YHQ1 1JJ2Y 2P3YA 1YJW1 3G711 2OBVA 4JM1A 3K7AI 1Y8CA 3VMHA 2KZ0A 4BBYA 3T1HC 2OO4A 2JA6I 3GTMS 1NY8A 3RV2A 1IBKC 3EERA 1QVGY 3I56Z 2Y4OA 3I4NI 5BSTA 2UUBC 3J81b 1YITZ 1VQ91 1KC82 4A3EI 3K6RA 4DV4C 4JI6C 3J80b 1I6HI 2PT7G 2R93I 1BA3A 4K0BA 3CD6Z 3HOVI 1Q16A 1TH5A 4RLQA 4A3LI 3UX2A 2PMZA 4MTNA 2OPLB 2OTL1 1JJ2Z 5FLXf 4BXXI 1Q822 2IV2X 2MMAB 5BSRA 1O92A 4GXRA 4MONA 1YIJZ 3NYRA 1TFIA 4WV3A 5GTDA 3G6E1 2F4OA 3GPCA 4K0KC 2UUAC 1M1K1 1LCIA 2JIMA 1TWFI 1XMOC 1USPA 1Y1VI 4NXNC 1XNRC 2DE5A 4D56A 1J5EC 1K9M2 1YJ9Z 2OTJZ
chains in the Genus database with same CATH topology
3CMEZ 3TDEA 3R9XA 2QA4Z 2E9HA 4MD7A 5AE2A 1W2BZ 4YY3C 3HKZA 5T8TA 3GTMI 4G1IA 1PFTA 4NBGA 1QWIA 5AE3A 2Y0SA 5BUQA 1K8A1 5D1OB 4OXIA 3CCUZ 5D1PA 3R44A 4E31A 3PO2I 4D57A 3NDIA 3VMGA 5K85A 3CCLZ 5LMNC 2V7BA 2R7ZI 1VQ9Z 3J80D 1M902 4DCSA 2D1SA 5LMUC 5FLXD 4NH1C 5A2QD 1I3QI 3BG0B 3CCS1 1DL6A 4ZJZA 2JS4A 4LFCC 1NJI2 1VQN1 4A3II 1YHQZ 2QL8A 2ONFA 3NH4A 1FUGA 2OZKA 2E0GA 2UXDC 3T4NB 4B3TC 3CCQ1 4JI4C 3G4S1 3IEUA 1NUIA 3G4SZ 1EGAA 1Y1VS 4RM3A 3TE5B 4JI0C 1Y1WI 1FJGC 1VQNZ 2ZAEB 4GKJC 5T64A 5IT9b 1KQSZ 1T5DX 4L4QA 1QM4A 2WAQA 5LL6f 1MXCA 3LGXA 4GXQA 2CXCA 5IP9I 1Q7Y1 4Y52I 5AN9F 1R9TI 3TQIA 4RV9A 3EQ6A 3DHVA 1YUAA 1Q861 3G7SA 4OYCA 4RVOA 4B3MC 2E2JI 1MXAA 2YCBA 3I4MI 4A3CI 3NI2A 3CC7Z 5BR8C 1VLAA 4LF5C 3CCQZ 1YJNZ 1S7MA 4E2YA 5FLMI 1Q811 4FTFA 2PK7A 4JI8C 3VTNA 1VQ8Z 4DR2C 3ETCA 1QVFZ 1Q862 3CC2Z 1YJ91 5KYTA 1HH2P 3F3PC 4TNUA 1HNZC 2DYJA 4OX9C 2D1RA 4DG9A 4GKKC 3GTLI 2K5RA 2JMOA 2WB1A 1XRCA 2VUGA 4RVHA 3LAXA 1S72Z 4RVNA 2OOXB 3M3YI 2QEXZ 2HF1A 2E2II 1XRAA 1I50I 3S1MI 4ODJA 4PZPA 3UOWA 4DV1C 3CCU1 2E2HI 1M1K2 1VQM1 4MXUA 1GPMA 5IT9D 4NXMC 5JRHA 1YJ7A 1N8R1 1HNWC 2D1QA 4DGLA 4QTTA 1PA4A 4D4IA 3C5EA 1S721 4JI5C 3NH8A 4KTVA 2YWCA 2WD9A 2NVTI 4LFAC 4LF6C 3CQZI 3MZKB 3NPDA 3IF8A 1QVFY 1YJWZ 4RVFA 1YIJ1 4X65C 3TDHB 3H3VJ 5KEIA 4NBCA 3CW8X 4BY7I 1VQ81 3GTQI 1IBLC 1USPB 1RO4A 4JI7C 3I07A 4A3BI 1YI2Z 5D1OA 3CC71 3CW9A 3KXWA 4HGZA 4DUYC 2F4MA 1VQ71 3PBKA 2QW0X 1PG4A 2QLVB 1RNIA 4LF9C 2K3RA 2P2QA 2D7VA 2E8EA 1VQ7Z 2QR1B 2Q51A 3AF6A 2RIQA 4RVDA 3MONA 4DV6C 4JI2C 1I94C 5KYVA 2VF1A 4NB9A 3CC4Z 4X6AI 4IZ6A 2G2KA 3EEDA 3IFUA 4NBDA 4BBRI 5A1GA 1X3ZA 2P2MA 4NDNA 4E30A 4A3KI 1NP6A 4NFRA 4LF8C 3B7WA 3FQMA 3I08A 1UKKA 2QRDB 1PG3A 2AKLA 3VNRA 3CCR1 3LUSA 1TWCI 2QKDA 3FKII 5CM2M 5C3EI 3PO3S 4X64C 1Z01A 4DR4C 4E2XA 2EGTA 3A4IA 3J80f 1SFOI 3CMA1 2BJOA 2RPRA 4BY1I 1NYEA 3LNVA 1VQMZ 5BURA 2ASBA 1WW9A 4RVGA 3HOWI 3E7WA 4BCAA 5IWAC 3J81D 3UZ0A 4DV2C 3D9XA 1QVGZ 5FLXb 1YI21 3H2TA 2DE6A 1RY2A 1N34C 4BBSI 3NDJA 2UXCC 1KQSY 3KIHA 3P5JB 3CME1 5DV9A 4L7IA 2IZ4A 4B3RC 1K8A2 2R6MA 4PHTA 2DE7A 4DK1A 2QRCB 4HH4A 3R9WA 3IPLA 2GTHA 3Q87A 2P20A 1N32C 3S17I 3NFZA 4PROC 5K8FA 3GTJI 2P2BA 4DCUA 2LIYA 1L2FA 2VUMI 2OTLZ 4NBFA 1RG9A 1N2FA 1N33C 3CD61 3J81f 3A9VA 3S82A 3HOUI 2JNYA 4DV3C 3GCFA 1YIT1 1K0RA 3GR0A 4HPVA 2ATWA 3I561 4LF7C 3A9UA 1Q821 3OTOC 2GTIA 2O4HA 4NBHA 5CZVA 2E8FA 3CC21 1QF8A 2OPLA 4G37A 2BH1X 1V25A 1ZH1A 4HGYA 4NOZA 3CCMZ 1VQ5Z 3FQQA 5C44I 4NB8A 1IBMC 3JAMb 4X62C 5ADZA 1K9M1 3I55Z 1V26A 2VQEC 1MD9A 3CCJZ 4D4GA 2O53A 3NYQA 2M48A 4DR3C 1VQK1 1ZB9A 2WP0C 3IEVA 3OW2Z 1VQKZ 2HJGA 3VNQA 4B3SC 3OW2Y 4E2ZA 1VQOZ 5AE1A 2ZM6C 3GKUA 1RO0A 1QYPA 5E7QA 4LF4C 3CCRZ 1X3WA 1W2BY 2R92I 4DR7C 2PN2A 3S1QI 3RG2A 2QA41 3FCEA 2YU9I 4FUQA 4U5YD 2LFUA 1WH9A 2M6NA 3T1YC 2JR6A 4NBBA 4NBAA 4R1LA 4BSZA 4MH4A 3ESWA 3CC41 1P7LA 2NVYI 2AYAA 1XMQC 4A3DI 4CL1A 4DG8A 3S1NI 4RMNA 4DR5C 1VQ41 2B63I 5A19A 5CZXA 2GU2A 3JAMD 2IZ3A 1MDFA 1O93A 2Y4NA 4LFBC 4EATA 3S2HI 3KIFA 1VQPZ 4DV5C 1VQLZ 1RO2A 2JA8I 1X0TA 3CPWZ 1VQ4Z 4IR7A 4DV7C 1WCMI 2I3CA 3J7A4 2V8KA 4RLFA 4BC9A 1K732 3GTKI 2QVYX 3IMLA 1TWAI 4E2WA 2HU9A 4ZLPA 1M901 3HOZI 3N2QA 4DQYB 2Q4ZA 4MRIA 2E7GA 5IT9f 2RT9A 3S16I 1MKYA 4ISBA 1VQP1 3L8CA 4G36A 1YUKA 4DUZC 5A1IA 3CXCZ 3CXCY 3CMAZ 1MXBA 3DAYA 3NH5A 5T8SA 2PROA 4JV5C 1RLYA 3RZOI 4YHHC 2DPLA 2V8JA 3GKQA 2RBLA 4RM2A 3S2DI 3S1RI 3CCJ1 3RZDI 4EWCA 5BSMA 2P28A 4MD9A 3S14I 1K83I 1XNQC 2VSQA 2KI7B 2P2JA 3QWUA 4NBEA 4A3JI 1VQ6Z 3VMIA 1YJN1 3GTPI 2D1TA 2H85A 5BSUA 4DCVA 2P2FA 3CCSZ 2D27A 2XR1A 1VQO1 4JI1C 4Y7NI 5T6BA 4LE5A 3E7XA 2F4VC 4JI3C 3H0GI 5BUSA 3CCL1 2OOYB 4JYAC 5C4XI 2QVZX 2HHHC 1O90A 1HR0C 3I551 5A2Qb 2UUCC 5T67A 4MD8A 2RHBA 3IX0A 1WF3A 1AMUA 3S15I 3U50C 4A93I 3CCE1 3GR1A 1KRLA 2OTJ1 4RS4A 1NJI1 1JOSA 4KTTA 4X66C 4QTUA 3VB9A 4DR6C 3ETOA 1T5HX 1N8R2 4XX2A 1HNXC 3MZLB 1KD12 3HOXI 1Z02A 1RQFA 2NVQI 2QVXX 2W04A 2W03A 3CPWY 2Y27A 1P9NA 2QREB 4A3GI 2E8CA 4A3MI 1VQL1 2VZEA 1KKGA 2E5LC 3PO3I 2D28C 4I9FA 1O9TA 3D6WA 2PM9A 2JA7I 1L1OC 4R1MA 2QEX1 1MDBA 3VNSA 4TPSB 3GTOI 1ULTA 2P02A 3F3FC 2YWBA 3N54B 4DV0C 3BG1B 4DCTA 1Q7Y2 3DLPX 4AQYC 3G71Z 1ML8A 2JUBA 1WIIA 4WS9A 3M4OI 3L95X 4E33A 1Z03A 4DR1C 2CY1A 2V8IA 3G6EZ 3PESA 1TWHI 1JWHC 2NVXI 5H9UA 3CCVZ 3CCEZ 3HOYI 4KHPC 3GTGI 3JAMf 1ZB8A 2JMPA 2YADA 5A2Qf 2UXBC 3AF5A 4BC7A 3PROC 4R0MA 1TWGI 2UU9C 3SO4A 1KD11 1LQLA 2J6AA 3TUFA 4FUTA 4S1TA 2KPIA 4GS5A 1K731 1XRBA 2KZFA 5C4JI 5IFIA 3CCV1 1Q812 3CJEA 5BSVA 4AYBA 4E32A 4I9GA 3FCCA 1VQ61 3CCM1 1VQ51 1N36C 2VQFC 4L2ZA 2JA5I 5BSWA 5IP7I 1KC81 4A3FI 1YHQ1 1JJ2Y 2P3YA 1YJW1 3G711 2OBVA 4JM1A 3K7AI 4BBYA 3VMHA 3T1HC 2OO4A 2JA6I 3GTMS 3RV2A 1IBKC 3EERA 1QVGY 3I56Z 2Y4OA 3I4NI 5BSTA 2UUBC 3J81b 1YITZ 1VQ91 1KC82 4A3EI 4DV4C 4JI6C 3J80b 1I6HI 2PT7G 2R93I 1BA3A 4K0BA 3CD6Z 3HOVI 4RLQA 4A3LI 2PMZA 4MTNA 2OPLB 2OTL1 1JJ2Z 5FLXf 4BXXI 1Q822 5BSRA 1O92A 4GXRA 4MONA 1YIJZ 3NYRA 1TFIA 4WV3A 5GTDA 3G6E1 2F4OA 3GPCA 4K0KC 2UUAC 1M1K1 1LCIA 1TWFI 1XMOC 1USPA 1Y1VI 4NXNC 1XNRC 2DE5A 4D56A 1J5EC 1K9M2 1YJ9Z 2OTJZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKU A;  1JOS A;  4LF4 C;  3R9X A;  4X66 C;  4DR6 C;  4LF9 C;  4DR7 C;  2PN2 A;  4YY3 C;  4XX2 A;  1HNX C;  1QWI A;  2D7V A;  2E8E A;  3AF6 A;  1WH9 A;  3T1Y C;  5LMN C;  2E8C A;  4DV6 C;  4BSZ A;  4JI2 C;  1I94 C;  3J80 D;  4DCS A;  5LMU C;  1KKG A;  4MH4 A;  5FLX D;  2E5L C;  5A2Q D;  1XMQ C;  4DR5 C;  4LFC C;  4LF8 C;  2QL8 A;  2ONF A;  3JAM D;  2UXD C;  1UKK A;  4DV0 C;  4B3T C;  4DCT A;  3LUS A;  4LFB C;  4JI4 C;  3IEU A;  4AQY C;  1EGA A;  4X64 C;  1ML8 A;  4DR4 C;  2EGT A;  4DV5 C;  1NYE A;  2BJO A;  4JI0 C;  2ASB A;  1FJG C;  4DR1 C;  4DV7 C;  2CY1 A;  4GKJ C;  5IWA C;  3J81 D;  4DV2 C;  2CXC A;  4KHP C;  2E7G A;  1N34 C;  1ZB8 A;  2UXC C;  1MKY A;  2JMP A;  2UXB C;  4B3R C;  3AF5 A;  4B3M C;  2YCB A;  5BR8 C;  4LF5 C;  1VLA A;  4DUZ C;  2UU9 C;  3R9W A;  1LQL A;  4JI8 C;  1N32 C;  4DR2 C;  2KZF A;  3CJE A;  4JV5 C;  1HH2 P;  1HNZ C;  4DCU A;  2DYJ A;  4YHH C;  1L2F A;  4OX9 C;  1N36 C;  2VQF C;  4GKK C;  1N2F A;  1N33 C;  4DV1 C;  3T1H C;  1XNQ C;  4DV3 C;  1IBK C;  3EER A;  1K0R A;  5IT9 D;  2UUB C;  2ATW A;  4LF7 C;  4NXM C;  4DV4 C;  1HNW C;  4JI6 C;  2PT7 G;  3OTO C;  4DCV A;  2E8F A;  1PA4 A;  2XR1 A;  4JI1 C;  4JI5 C;  2OPL A;  4MTN A;  2OPL B;  4LFA C;  4JI3 C;  2F4V C;  4NOZ A;  4LF6 C;  4JYA C;  1IBM C;  4X62 C;  2HHH C;  4X65 C;  2UUC C;  1HR0 C;  2VQE C;  4K0K C;  4DR3 C;  2UUA C;  1WF3 A;  1ZB9 A;  1IBL C;  1USP B;  4JI7 C;  3IEV A;  2HJG A;  3I07 A;  1XMO C;  1USP A;  4B3S C;  4NXN C;  1XNR C;  1J5E C;  4DUY C;  2ZM6 C; 
#chains in the Genus database with same CATH topology
 3CME Z;  3TDE A;  3R9X A;  2QA4 Z;  2E9H A;  4MD7 A;  5AE2 A;  1W2B Z;  4YY3 C;  3HKZ A;  5T8T A;  3GTM I;  4G1I A;  1PFT A;  4NBG A;  1QWI A;  5AE3 A;  2Y0S A;  2CU6 A;  5BUQ A;  1K8A 1;  5D1O B;  4OXI A;  3CCU Z;  5D1P A;  3R44 A;  4E31 A;  3PO2 I;  4D57 A;  3NDI A;  3VMG A;  5K85 A;  3CCL Z;  5LMN C;  2V7B A;  2R7Z I;  1VQ9 Z;  3A25 A;  1M90 2;  4DCS A;  2D1S A;  3J80 D;  5LMU C;  5FLX D;  4NH1 C;  5A2Q D;  1I3Q I;  3BG0 B;  3CCS 1;  1DL6 A;  4ZJZ A;  2JS4 A;  4LFC C;  1V60 A;  1NJI 2;  1VQN 1;  4A3I I;  1YHQ Z;  2QL8 A;  2ONF A;  3NH4 A;  1FUG A;  2OZK A;  2E0G A;  2UXD C;  3T4N B;  4B3T C;  3CCQ 1;  4JI4 C;  3G4S 1;  3IEU A;  1NUI A;  3G4S Z;  1EGA A;  1Y1V S;  4RM3 A;  3TE5 B;  4JI0 C;  1Y1W I;  1FJG C;  1VQN Z;  2ZAE B;  3O2E A;  4GKJ C;  5T64 A;  5IT9 b;  1KQS Z;  2NAP A;  1T5D X;  4L4Q A;  1QM4 A;  2WAQ A;  5LL6 f;  1MXC A;  3LGX A;  4GXQ A;  2CXC A;  5IP9 I;  1FDO A;  1Q7Y 1;  4Y52 I;  2YX1 A;  5AN9 F;  1R9T I;  3TQI A;  4RV9 A;  3EQ6 A;  3DHV A;  1YUA A;  1Q86 1;  3G7S A;  4OYC A;  4RVO A;  4B3M C;  2E2J I;  1MXA A;  2YCB A;  3I4M I;  4A3C I;  3NI2 A;  3CC7 Z;  5BR8 C;  1VLA A;  4LF5 C;  3CCQ Z;  1YJN Z;  5FLM I;  1S7M A;  4E2Y A;  1SIW A;  1Q81 1;  2PK7 A;  4FTF A;  4JI8 C;  2AYD A;  3VTN A;  1VQ8 Z;  4DR2 C;  3ETC A;  1QVF Z;  1Q86 2;  3CC2 Z;  1YJ9 1;  5KYT A;  1HH2 P;  3F3P C;  4TNU A;  1HNZ C;  2DYJ A;  4OX9 C;  2D1R A;  4DG9 A;  4GKK C;  2VPW A;  3GTL I;  2K5R A;  2JMO A;  2V3V A;  2WB1 A;  2VUG A;  4RVH A;  1UWD A;  1XRC A;  1S72 Z;  2Z51 A;  2OOX B;  3M3Y I;  3CQ1 A;  4RVN A;  2QEX Z;  2HF1 A;  2E2I I;  1XRA A;  1I50 I;  3S1M I;  3CQ2 A;  4ODJ A;  4PZP A;  3UOW A;  4DV1 C;  3CCU 1;  2E2H I;  1M1K 2;  1VQM 1;  4MXU A;  1GPM A;  5IT9 D;  1VEH A;  4NXM C;  5JRH A;  1YJ7 A;  1N8R 1;  1HNW C;  1WZN A;  2D1Q A;  2KDN A;  4DGL A;  4QTT A;  1PA4 A;  4D4I A;  3C5E A;  1S72 1;  4JI5 C;  3NH8 A;  4KTV A;  2YWC A;  2WD9 A;  2NVT I;  4LFA C;  4LF6 C;  3CQZ I;  3MZK B;  3NPD A;  3IF8 A;  1QVF Y;  1YJW Z;  4RVF A;  1YIJ 1;  4X65 C;  3TDH B;  3H3V J;  5KEI A;  4NBC A;  3CW8 X;  4BY7 I;  1VQ8 1;  3GTQ I;  1IBL C;  1USP B;  1RO4 A;  4JI7 C;  3I07 A;  4A3B I;  1YI2 Z;  5D1O A;  3CC7 1;  3CW9 A;  3KXW A;  4PUI A;  4HGZ A;  4DUY C;  2F4M A;  1VQ7 1;  3PBK A;  2QW0 X;  1PG4 A;  2QLV B;  1RNI A;  4LF9 C;  2K3R A;  2P2Q A;  2D7V A;  2E8E A;  1VQ7 Z;  2QR1 B;  2Q51 A;  3AF6 A;  2RIQ A;  4RVD A;  1XS3 A;  3MON A;  2JIR A;  3AY0 A;  4DV6 C;  4JI2 C;  1I94 C;  5KYV A;  2VF1 A;  4NB9 A;  3CC4 Z;  4X6A I;  4IZ6 A;  2G2K A;  3EED A;  3IFU A;  4NBD A;  4BBR I;  5A1G A;  1X3Z A;  2P2M A;  4NDN A;  4E30 A;  4A3K I;  1NP6 A;  4NFR A;  4LF8 C;  3B7W A;  3FQM A;  3I08 A;  1UKK A;  2QRD B;  1PG3 A;  2AKL A;  3VNR A;  3CCR 1;  3LUS A;  1TWC I;  2QKD A;  3FKI I;  5CM2 M;  5C3E I;  3PO3 S;  4X64 C;  2ZZN A;  1Z01 A;  4DR4 C;  4E2X A;  2EGT A;  3A4I A;  3J80 f;  1SFO I;  3CMA 1;  2BJO A;  2RPR A;  4BY1 I;  1NYE A;  3LNV A;  1VQM Z;  5BUR A;  2ASB A;  1WW9 A;  4RVG A;  3HOW I;  3E7W A;  4BCA A;  5IWA C;  3J81 D;  3UZ0 A;  4DV2 C;  3D9X A;  1QVG Z;  1QXF A;  5FLX b;  1YI2 1;  3H2T A;  2DE6 A;  1RY2 A;  1N34 C;  4BBS I;  3NDJ A;  2UXC C;  1KQS Y;  3KIH A;  3P5J B;  3CME 1;  5DV9 A;  4L7I A;  2IZ4 A;  4B3R C;  1K8A 2;  2R6M A;  4PHT A;  1PU1 A;  2DE7 A;  4DK1 A;  2QRC B;  4HH4 A;  3R9W A;  3IPL A;  2GTH A;  3Q87 A;  2P20 A;  1N32 C;  3S17 I;  3NFZ A;  4PRO C;  5K8F A;  3GTJ I;  2P2B A;  2MM9 A;  3LNO A;  5LCI A;  4DCU A;  2LIY A;  1L2F A;  2VUM I;  2OTL Z;  4NBF A;  1RG9 A;  1N2F A;  1N33 C;  3CD6 1;  2E7Z A;  3J81 f;  3A9V A;  3S82 A;  3HOU I;  2JNY A;  4DV3 C;  3GCF A;  1YIT 1;  1K0R A;  3GR0 A;  2JIO A;  4HPV A;  3I56 1;  4LF7 C;  2ATW A;  3A9U A;  2JIP A;  1Q82 1;  3OTO C;  2GTI A;  2O4H A;  4NBH A;  5CZV A;  2E8F A;  3CC2 1;  1QF8 A;  2OPL A;  4G37 A;  2BH1 X;  1V25 A;  1ZH1 A;  4HGY A;  4NOZ A;  3CCM Z;  1VQ5 Z;  3FQQ A;  5C44 I;  4NB8 A;  1IBM C;  3JAM b;  4X62 C;  5ADZ A;  1K9M 1;  3I55 Z;  1V26 A;  2VQE C;  1MD9 A;  3CCJ Z;  4D4G A;  2O53 A;  3NYQ A;  2M48 A;  4DR3 C;  1VQK 1;  1ZB9 A;  2WP0 C;  3IEV A;  3OW2 Z;  1VQK Z;  2HJG A;  3VNQ A;  4B3S C;  3OW2 Y;  4E2Z A;  1VQO Z;  3LAX A;  5AE1 A;  2ZM6 C;  4PUH A;  3GKU A;  1RO0 A;  1QYP A;  5E7Q A;  4LF4 C;  3CCR Z;  1X3W A;  1W2B Y;  2R92 I;  4DR7 C;  2PN2 A;  3S1Q I;  3RG2 A;  2QA4 1;  3FCE A;  2YU9 I;  4FUQ A;  4U5Y D;  2LFU A;  1WH9 A;  2M6N A;  3T1Y C;  2JR6 A;  4NBB A;  4NBA A;  4R1L A;  4BSZ A;  4MH4 A;  3ESW A;  3CC4 1;  1P7L A;  2NVY I;  2AYA A;  1XMQ C;  3TR3 A;  4A3D I;  4CL1 A;  4DG8 A;  3S1N I;  4RMN A;  4DR5 C;  1VQ4 1;  2B63 I;  5A19 A;  5CZX A;  2GU2 A;  3JAM D;  2IZ3 A;  1MDF A;  1O93 A;  2Y4N A;  4LFB C;  1WCJ A;  2VPX A;  4EAT A;  3S2H I;  1WJ2 A;  3KIF A;  1VQP Z;  4DV5 C;  2VPY A;  1VQL Z;  1AA6 A;  1RO2 A;  2JA8 I;  1X0T A;  3CPW Z;  1VQ4 Z;  4IR7 A;  4DV7 C;  1WCM I;  2I3C A;  3J7A 4;  2V8K A;  4RLF A;  4BC9 A;  1K73 2;  3GTK I;  3D2L A;  2QVY X;  3IML A;  1TWA I;  4E2W A;  2HU9 A;  4ZLP A;  1M90 1;  3HOZ I;  3N2Q A;  4DQY B;  2Q4Z A;  4MRI A;  2E7G A;  5IT9 f;  2RT9 A;  3A26 A;  3S16 I;  1MKY A;  4ISB A;  1VQP 1;  2MCQ A;  3L8C A;  4G36 A;  1YUK A;  4PUG A;  4DUZ C;  5A1I A;  3CXC Z;  3CXC Y;  3CMA Z;  1MXB A;  2LEX A;  3DAY A;  3NH5 A;  5T8S A;  2PRO A;  4JV5 C;  1P4E A;  1RLY A;  3RZO I;  4YHH C;  2DPL A;  2V8J A;  3GKQ A;  2RBL A;  4RM2 A;  3S2D I;  3S1R I;  3IR7 A;  3CCJ 1;  3RZD I;  4EWC A;  5BSM A;  2P28 A;  4MD9 A;  3S14 I;  1K83 I;  1XNQ C;  2VSQ A;  2KI7 B;  2P2J A;  3QWU A;  4NBE A;  4A3J I;  1VQ6 Z;  3VMI A;  1YJN 1;  3GTP I;  2D1T A;  2H85 A;  5BSU A;  4DCV A;  2P2F A;  3CCS Z;  2D27 A;  2XR1 A;  1VQO 1;  4JI1 C;  4Y7N I;  5T6B A;  4LE5 A;  3E7X A;  2F4V C;  4JI3 C;  3H0G I;  5BUS A;  3CCL 1;  2OOY B;  4JYA C;  5C4X I;  2QVZ X;  2HHH C;  1O90 A;  1HR0 C;  3I55 1;  5A2Q b;  2UUC C;  5T67 A;  1M6X A;  4MD8 A;  2RHB A;  3IX0 A;  1WF3 A;  1AMU A;  3S15 I;  3U50 C;  4A93 I;  3CCE 1;  3GR1 A;  1KRL A;  3UEB A;  2OTJ 1;  4RS4 A;  1NJI 1;  1JOS A;  4KTT A;  4X66 C;  4QTU A;  3VB9 A;  3UX3 A;  3ETO A;  1T5H X;  4DR6 C;  1N8R 2;  4XX2 A;  1HNX C;  3MZL B;  1KD1 2;  3HOX I;  1Z02 A;  1RQF A;  2NVQ I;  1XHJ A;  2VPZ A;  2W04 A;  2QVX X;  2W03 A;  3CPW Y;  2Y27 A;  1P9N A;  2QRE B;  4A3G I;  2E8C A;  4A3M I;  1VQL 1;  2M5O A;  2VZE A;  1KKG A;  2E5L C;  3PO3 I;  2D28 C;  2DHM A;  1O9T A;  4I9F A;  1M6X C;  3D6W A;  2PM9 A;  2JA7 I;  1L1O C;  4R1M A;  2QEX 1;  1MDB A;  3VNS A;  4TPS B;  3GTO I;  1ULT A;  2P02 A;  3F3F C;  2YWB A;  3N54 B;  4DV0 C;  3BG1 B;  4DCT A;  1Q7Y 2;  3DLP X;  1IB8 A;  4AQY C;  3G71 Z;  2M5H A;  3CQ3 A;  1ML8 A;  2JUB A;  1WII A;  1FLO A;  4WS9 A;  3M4O I;  3L95 X;  4E33 A;  1Z03 A;  4DR1 C;  2CY1 A;  2V8I A;  3G6E Z;  3PES A;  1TWH I;  1JWH C;  2JIQ A;  2NVX I;  5H9U A;  3CCV Z;  3CCE Z;  3HOY I;  4KHP C;  3GTG I;  3JAM f;  1ZB8 A;  2JMP A;  2YAD A;  5A2Q f;  2UXB C;  3AF5 A;  4BC7 A;  3PRO C;  4R0M A;  1P4E C;  1FDI A;  1TWG I;  2UU9 C;  3SO4 A;  1KD1 1;  1LQL A;  2J6A A;  2NCL A;  4FUT A;  2JNV A;  3TUF A;  4S1T A;  2KPI A;  4GS5 A;  1K73 1;  1XRB A;  2KZF A;  5C4J I;  5IFI A;  3CCV 1;  1Q81 2;  3CJE A;  5BSV A;  4AYB A;  4E32 A;  4I9G A;  3FCC A;  2ZZM A;  1VQ6 1;  3CCM 1;  1VQ5 1;  1N36 C;  2VQF C;  2V45 A;  4L2Z A;  2JA5 I;  5BSW A;  5IP7 I;  4A3F I;  1KC8 1;  1YHQ 1;  1JJ2 Y;  2P3Y A;  1YJW 1;  3G71 1;  2OBV A;  4JM1 A;  3K7A I;  1Y8C A;  3VMH A;  2KZ0 A;  4BBY A;  3T1H C;  2OO4 A;  2JA6 I;  3GTM S;  1NY8 A;  3RV2 A;  1IBK C;  3EER A;  1QVG Y;  3I56 Z;  2Y4O A;  3I4N I;  5BST A;  2UUB C;  3J81 b;  1YIT Z;  1VQ9 1;  1KC8 2;  4A3E I;  3K6R A;  4DV4 C;  4JI6 C;  3J80 b;  1I6H I;  2PT7 G;  2R93 I;  1BA3 A;  4K0B A;  3CD6 Z;  3HOV I;  1Q16 A;  1TH5 A;  4RLQ A;  4A3L I;  3UX2 A;  2PMZ A;  4MTN A;  2OPL B;  2OTL 1;  1JJ2 Z;  5FLX f;  4BXX I;  1Q82 2;  2IV2 X;  2MMA B;  5BSR A;  1O92 A;  4GXR A;  4MON A;  1YIJ Z;  3NYR A;  1TFI A;  4WV3 A;  5GTD A;  3G6E 1;  2F4O A;  3GPC A;  4K0K C;  2UUA C;  1M1K 1;  1LCI A;  2JIM A;  1TWF I;  1XMO C;  1USP A;  1Y1V I;  4NXN C;  1XNR C;  2DE5 A;  4D56 A;  1J5E C;  1K9M 2;  1YJ9 Z;  2OTJ Z; 
#chains in the Genus database with same CATH homology
 3CME Z;  3TDE A;  3R9X A;  2QA4 Z;  2E9H A;  4MD7 A;  5AE2 A;  1W2B Z;  4YY3 C;  3HKZ A;  5T8T A;  3GTM I;  4G1I A;  1PFT A;  4NBG A;  1QWI A;  5AE3 A;  2Y0S A;  5BUQ A;  1K8A 1;  5D1O B;  4OXI A;  3CCU Z;  5D1P A;  3R44 A;  4E31 A;  3PO2 I;  4D57 A;  3NDI A;  3VMG A;  5K85 A;  3CCL Z;  5LMN C;  2V7B A;  2R7Z I;  1VQ9 Z;  3J80 D;  1M90 2;  4DCS A;  2D1S A;  5LMU C;  5FLX D;  4NH1 C;  5A2Q D;  1I3Q I;  3BG0 B;  3CCS 1;  1DL6 A;  4ZJZ A;  2JS4 A;  4LFC C;  1NJI 2;  1VQN 1;  4A3I I;  1YHQ Z;  2QL8 A;  2ONF A;  3NH4 A;  1FUG A;  2OZK A;  2E0G A;  2UXD C;  3T4N B;  4B3T C;  3CCQ 1;  4JI4 C;  3G4S 1;  3IEU A;  1NUI A;  3G4S Z;  1EGA A;  1Y1V S;  4RM3 A;  3TE5 B;  4JI0 C;  1Y1W I;  1FJG C;  1VQN Z;  2ZAE B;  4GKJ C;  5T64 A;  5IT9 b;  1KQS Z;  1T5D X;  4L4Q A;  1QM4 A;  2WAQ A;  5LL6 f;  1MXC A;  3LGX A;  4GXQ A;  2CXC A;  5IP9 I;  1Q7Y 1;  4Y52 I;  5AN9 F;  1R9T I;  3TQI A;  4RV9 A;  3EQ6 A;  3DHV A;  1YUA A;  1Q86 1;  3G7S A;  4OYC A;  4RVO A;  4B3M C;  2E2J I;  1MXA A;  2YCB A;  3I4M I;  4A3C I;  3NI2 A;  3CC7 Z;  5BR8 C;  1VLA A;  4LF5 C;  3CCQ Z;  1YJN Z;  1S7M A;  4E2Y A;  5FLM I;  1Q81 1;  4FTF A;  2PK7 A;  4JI8 C;  3VTN A;  1VQ8 Z;  4DR2 C;  3ETC A;  1QVF Z;  1Q86 2;  3CC2 Z;  1YJ9 1;  5KYT A;  1HH2 P;  3F3P C;  4TNU A;  1HNZ C;  2DYJ A;  4OX9 C;  2D1R A;  4DG9 A;  4GKK C;  3GTL I;  2K5R A;  2JMO A;  2WB1 A;  1XRC A;  2VUG A;  4RVH A;  3LAX A;  1S72 Z;  4RVN A;  2OOX B;  3M3Y I;  2QEX Z;  2HF1 A;  2E2I I;  1XRA A;  1I50 I;  3S1M I;  4ODJ A;  4PZP A;  3UOW A;  4DV1 C;  3CCU 1;  2E2H I;  1M1K 2;  1VQM 1;  4MXU A;  1GPM A;  5IT9 D;  4NXM C;  5JRH A;  1YJ7 A;  1N8R 1;  1HNW C;  2D1Q A;  4DGL A;  4QTT A;  1PA4 A;  4D4I A;  3C5E A;  1S72 1;  4JI5 C;  3NH8 A;  4KTV A;  2YWC A;  2WD9 A;  2NVT I;  4LFA C;  4LF6 C;  3CQZ I;  3MZK B;  3NPD A;  3IF8 A;  1QVF Y;  1YJW Z;  4RVF A;  1YIJ 1;  4X65 C;  3TDH B;  3H3V J;  5KEI A;  4NBC A;  3CW8 X;  4BY7 I;  1VQ8 1;  3GTQ I;  1IBL C;  1USP B;  1RO4 A;  4JI7 C;  3I07 A;  4A3B I;  1YI2 Z;  5D1O A;  3CC7 1;  3CW9 A;  3KXW A;  4HGZ A;  4DUY C;  2F4M A;  1VQ7 1;  3PBK A;  2QW0 X;  1PG4 A;  2QLV B;  1RNI A;  4LF9 C;  2K3R A;  2P2Q A;  2D7V A;  2E8E A;  1VQ7 Z;  2QR1 B;  2Q51 A;  3AF6 A;  2RIQ A;  4RVD A;  3MON A;  4DV6 C;  4JI2 C;  1I94 C;  5KYV A;  2VF1 A;  4NB9 A;  3CC4 Z;  4X6A I;  4IZ6 A;  2G2K A;  3EED A;  3IFU A;  4NBD A;  4BBR I;  5A1G A;  1X3Z A;  2P2M A;  4NDN A;  4E30 A;  4A3K I;  1NP6 A;  4NFR A;  4LF8 C;  3B7W A;  3FQM A;  3I08 A;  1UKK A;  2QRD B;  1PG3 A;  2AKL A;  3VNR A;  3CCR 1;  3LUS A;  1TWC I;  2QKD A;  3FKI I;  5CM2 M;  5C3E I;  3PO3 S;  4X64 C;  1Z01 A;  4DR4 C;  4E2X A;  2EGT A;  3A4I A;  3J80 f;  1SFO I;  3CMA 1;  2BJO A;  2RPR A;  4BY1 I;  1NYE A;  3LNV A;  1VQM Z;  5BUR A;  2ASB A;  1WW9 A;  4RVG A;  3HOW I;  3E7W A;  4BCA A;  5IWA C;  3J81 D;  3UZ0 A;  4DV2 C;  3D9X A;  1QVG Z;  5FLX b;  1YI2 1;  3H2T A;  2DE6 A;  1RY2 A;  1N34 C;  4BBS I;  3NDJ A;  2UXC C;  1KQS Y;  3KIH A;  3P5J B;  3CME 1;  5DV9 A;  4L7I A;  2IZ4 A;  4B3R C;  1K8A 2;  2R6M A;  4PHT A;  2DE7 A;  4DK1 A;  2QRC B;  4HH4 A;  3R9W A;  3IPL A;  2GTH A;  3Q87 A;  2P20 A;  1N32 C;  3S17 I;  3NFZ A;  4PRO C;  5K8F A;  3GTJ I;  2P2B A;  4DCU A;  2LIY A;  1L2F A;  2VUM I;  2OTL Z;  4NBF A;  1RG9 A;  1N2F A;  1N33 C;  3CD6 1;  3J81 f;  3A9V A;  3S82 A;  3HOU I;  2JNY A;  4DV3 C;  3GCF A;  1YIT 1;  1K0R A;  3GR0 A;  4HPV A;  2ATW A;  3I56 1;  4LF7 C;  3A9U A;  1Q82 1;  3OTO C;  2GTI A;  2O4H A;  4NBH A;  5CZV A;  2E8F A;  3CC2 1;  1QF8 A;  2OPL A;  4G37 A;  2BH1 X;  1V25 A;  1ZH1 A;  4HGY A;  4NOZ A;  3CCM Z;  1VQ5 Z;  3FQQ A;  5C44 I;  4NB8 A;  1IBM C;  3JAM b;  4X62 C;  5ADZ A;  1K9M 1;  3I55 Z;  1V26 A;  2VQE C;  1MD9 A;  3CCJ Z;  4D4G A;  2O53 A;  3NYQ A;  2M48 A;  4DR3 C;  1VQK 1;  1ZB9 A;  2WP0 C;  3IEV A;  3OW2 Z;  1VQK Z;  2HJG A;  3VNQ A;  4B3S C;  3OW2 Y;  4E2Z A;  1VQO Z;  5AE1 A;  2ZM6 C;  3GKU A;  1RO0 A;  1QYP A;  5E7Q A;  4LF4 C;  3CCR Z;  1X3W A;  1W2B Y;  2R92 I;  4DR7 C;  2PN2 A;  3S1Q I;  3RG2 A;  2QA4 1;  3FCE A;  2YU9 I;  4FUQ A;  4U5Y D;  2LFU A;  1WH9 A;  2M6N A;  3T1Y C;  2JR6 A;  4NBB A;  4NBA A;  4R1L A;  4BSZ A;  4MH4 A;  3ESW A;  3CC4 1;  1P7L A;  2NVY I;  2AYA A;  1XMQ C;  4A3D I;  4CL1 A;  4DG8 A;  3S1N I;  4RMN A;  4DR5 C;  1VQ4 1;  2B63 I;  5A19 A;  5CZX A;  2GU2 A;  3JAM D;  2IZ3 A;  1MDF A;  1O93 A;  2Y4N A;  4LFB C;  4EAT A;  3S2H I;  3KIF A;  1VQP Z;  4DV5 C;  1VQL Z;  1RO2 A;  2JA8 I;  1X0T A;  3CPW Z;  1VQ4 Z;  4IR7 A;  4DV7 C;  1WCM I;  2I3C A;  3J7A 4;  2V8K A;  4RLF A;  4BC9 A;  1K73 2;  3GTK I;  2QVY X;  3IML A;  1TWA I;  4E2W A;  2HU9 A;  4ZLP A;  1M90 1;  3HOZ I;  3N2Q A;  4DQY B;  2Q4Z A;  4MRI A;  2E7G A;  5IT9 f;  2RT9 A;  3S16 I;  1MKY A;  4ISB A;  1VQP 1;  3L8C A;  4G36 A;  1YUK A;  4DUZ C;  5A1I A;  3CXC Z;  3CXC Y;  3CMA Z;  1MXB A;  3DAY A;  3NH5 A;  5T8S A;  2PRO A;  4JV5 C;  1RLY A;  3RZO I;  4YHH C;  2DPL A;  2V8J A;  3GKQ A;  2RBL A;  4RM2 A;  3S2D I;  3S1R I;  3CCJ 1;  3RZD I;  4EWC A;  5BSM A;  2P28 A;  4MD9 A;  3S14 I;  1K83 I;  1XNQ C;  2VSQ A;  2KI7 B;  2P2J A;  3QWU A;  4NBE A;  4A3J I;  1VQ6 Z;  3VMI A;  1YJN 1;  3GTP I;  2D1T A;  2H85 A;  5BSU A;  4DCV A;  2P2F A;  3CCS Z;  2D27 A;  2XR1 A;  1VQO 1;  4JI1 C;  4Y7N I;  5T6B A;  4LE5 A;  3E7X A;  2F4V C;  4JI3 C;  3H0G I;  5BUS A;  3CCL 1;  2OOY B;  4JYA C;  5C4X I;  2QVZ X;  2HHH C;  1O90 A;  1HR0 C;  3I55 1;  5A2Q b;  2UUC C;  5T67 A;  4MD8 A;  2RHB A;  3IX0 A;  1WF3 A;  1AMU A;  3S15 I;  3U50 C;  4A93 I;  3CCE 1;  3GR1 A;  1KRL A;  2OTJ 1;  4RS4 A;  1NJI 1;  1JOS A;  4KTT A;  4X66 C;  4QTU A;  3VB9 A;  4DR6 C;  3ETO A;  1T5H X;  1N8R 2;  4XX2 A;  1HNX C;  3MZL B;  1KD1 2;  3HOX I;  1Z02 A;  1RQF A;  2NVQ I;  2QVX X;  2W04 A;  2W03 A;  3CPW Y;  2Y27 A;  1P9N A;  2QRE B;  4A3G I;  2E8C A;  4A3M I;  1VQL 1;  2VZE A;  1KKG A;  2E5L C;  3PO3 I;  2D28 C;  4I9F A;  1O9T A;  3D6W A;  2PM9 A;  2JA7 I;  1L1O C;  4R1M A;  2QEX 1;  1MDB A;  3VNS A;  4TPS B;  3GTO I;  1ULT A;  2P02 A;  3F3F C;  2YWB A;  3N54 B;  4DV0 C;  3BG1 B;  4DCT A;  1Q7Y 2;  3DLP X;  4AQY C;  3G71 Z;  1ML8 A;  2JUB A;  1WII A;  4WS9 A;  3M4O I;  3L95 X;  4E33 A;  1Z03 A;  4DR1 C;  2CY1 A;  2V8I A;  3G6E Z;  3PES A;  1TWH I;  1JWH C;  2NVX I;  5H9U A;  3CCV Z;  3CCE Z;  3HOY I;  4KHP C;  3GTG I;  3JAM f;  1ZB8 A;  2JMP A;  2YAD A;  5A2Q f;  2UXB C;  3AF5 A;  4BC7 A;  3PRO C;  4R0M A;  1TWG I;  2UU9 C;  3SO4 A;  1KD1 1;  1LQL A;  2J6A A;  3TUF A;  4FUT A;  4S1T A;  2KPI A;  4GS5 A;  1K73 1;  1XRB A;  2KZF A;  5C4J I;  5IFI A;  3CCV 1;  1Q81 2;  3CJE A;  5BSV A;  4AYB A;  4E32 A;  4I9G A;  3FCC A;  1VQ6 1;  3CCM 1;  1VQ5 1;  1N36 C;  2VQF C;  4L2Z A;  2JA5 I;  5BSW A;  5IP7 I;  1KC8 1;  4A3F I;  1YHQ 1;  1JJ2 Y;  2P3Y A;  1YJW 1;  3G71 1;  2OBV A;  4JM1 A;  3K7A I;  4BBY A;  3VMH A;  3T1H C;  2OO4 A;  2JA6 I;  3GTM S;  3RV2 A;  1IBK C;  3EER A;  1QVG Y;  3I56 Z;  2Y4O A;  3I4N I;  5BST A;  2UUB C;  3J81 b;  1YIT Z;  1VQ9 1;  1KC8 2;  4A3E I;  4DV4 C;  4JI6 C;  3J80 b;  1I6H I;  2PT7 G;  2R93 I;  1BA3 A;  4K0B A;  3CD6 Z;  3HOV I;  4RLQ A;  4A3L I;  2PMZ A;  4MTN A;  2OPL B;  2OTL 1;  1JJ2 Z;  5FLX f;  4BXX I;  1Q82 2;  5BSR A;  1O92 A;  4GXR A;  4MON A;  1YIJ Z;  3NYR A;  1TFI A;  4WV3 A;  5GTD A;  3G6E 1;  2F4O A;  3GPC A;  4K0K C;  2UUA C;  1M1K 1;  1LCI A;  1TWF I;  1XMO C;  1USP A;  1Y1V I;  4NXN C;  1XNR C;  2DE5 A;  4D56 A;  1J5E C;  1K9M 2;  1YJ9 Z;  2OTJ Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...