1PU1A

Solution structure of the hypothetical protein mth677 from methanothermobacter thermautotrophicus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MSLRKLTEGDLDEISSFLHNTISDFILKRVSAKEIVDIDITVLVEYTDELKVDISAELYLDELSDADPGIVDEAVDAAYRSLESFLDGFRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein MTH677
publication title Solution structure of the hypothetical protein Mth677 from Methanobacterium thermoautotrophicum: A novel {alpha}+{beta} fold
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2003-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11419 DUF3194 Protein of unknown function (DUF3194)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.100 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 MTH677-like 1pu1A00
3UEBA 1PU1A
chains in the Genus database with same CATH superfamily
1MDBA 5FLXD 1N34C 4PZPA 1HNZC 3CW8X 4D57A 5A1GA 2PN2A 1PU1A 5BSMA 1L2FA 1PG4A 2QVZX 4LF5C 2VSQA 1BA3A 2UUBC 5BUQA 5K85A 3A9VA 1WH9A 3L8CA 4LFCC 3DHVA 4DR3C 4NXNC 2E7GA 5BSTA 1IBLC 4GS5A 3DAYA 5KYVA 4ISBA 2HHHC 3FCEA 3IEUA 5KEIA 2BH1X 4JI4C 2DPLA 2OO4A 5BUSA 2DYJA 2NCLA 2E8CA 4DCUA 3SO4A 4JV5C 3KXWA 3LAXA 1J5EC 1I94C 4MH4A 2E8FA 4LF6C 4U5YD 3PESA 4DR2C 2ZZNA 4GKKC 3RV2A 1M6XC 2CXCA 2P2BA 4L4QA 4RVOA 1N36C 1IBMC 4IR7A 4DG9A 4OX9C 2JMPA 4ZJZA 5BURA 4JM1A 5AE1A 1MXAA 2EGTA 5E7QA 3O2EA 1AMUA 3JAMD 2OPLB 1O9TA 2MCQA 3S82A 4RVNA 5K8FA 2UU9C 3ETCA 1XS3A 2D1RA 4BC7A 4JI7C 3CQ3A 3LNVA 1IB8A 2CU6A 2F4VC 4GXQA 1MXCA 3AF6A 4NDNA 1ML8A 3RG2A 1VLAA 3UZ0A 4NXMC 4FTFA 1MD9A 4G37A 4IZ6A 5BSUA 1HH2P 2BJOA 2HJGA 4X66C 1HNWC 5LCIA 2Y4NA 2OPLA 3I08A 4G36A 5CZVA 4D4IA 3GKUA 4DR5C 4JI5C 2P2JA 3UEBA 3IPLA 4MTNA 4DV6C 4X64C 2YWCA 1EGAA 5IWAC 2UXDC 4AQYC 3T1YC 5LMUC 4R1MA 5BSWA 3OTOC 3GR0A 1YJ7A 2MMAB 3ETOA 4ODJA 1V25A 4DCVA 1GPMA 3UX2A 4XX2A 4L7IA 2QVXX 4GXRA 4B3RC 4X62C 3VNRA 1LQLA 5JRHA 1V26A 4TPSB 1XMQC 3PROC 1USPB 4BSZA 4DUYC 1N32C 2Y27A 3C5EA 3R9XA 3EQ6A 2KZ0A 4LF4C 4EATA 4PUHA 2WP0C 1ZB8A 4LF9C 4DUZC 4LF8C 1RY2A 3CQ1A 3GPCA 1MKYA 2UUCC 4K0BA 2E8EA 1KKGA 3VNQA 4YY3C 4BCAA 3TDEA 4JI3C 4R0MA 4I9FA 1PG3A 2UUAC 3I07A 4DCTA 2VQFC 2UXBC 1WF3A 1XRCA 1NY8A 4JI1C 3NPDA 3E7XA 1XMOC 3AF5A 4PUGA 4RLQA 3R44A 4KTTA 4JYAC 5KYTA 3H2TA 2KDNA 2V7BA 2P20A 4LE5A 3J80D 1VEHA 5IFIA 5T8SA 4JI8C 5T8TA 1P4EC 2XR1A 1T5HX 1HNXC 2MM9A 3R9WA 4OYCA 3K6RA 2P2QA 5ADZA 4DV5C 1FJGC 4RLFA 2PROA 5CZXA 1K0RA 3J81D 4RMNA 2D1QA 3A25A 2M5OA 2ONFA 4DG8A 2Z51A 2D27A 4KHPC 2QW0X 2YWBA 1PA4A 3LNOA 4OXIA 1O93A 1XNRC 4LFAC 1N2FA 4FUTA 2VZEA 4B3TC 5GTDA 5LMNC 3CJEA 3IMLA 4JI2C 2P02A 2YX1A 4DR7C 2VQEC 1NYEA 5A19A 2D1TA 4D56A 1P7LA 1LCIA 4GKJC 2ASBA 4PUIA 1ULTA 2OBVA 1IBKC 3A4IA 3PBKA 3VNSA 2WD9A 1O92A 1FLOA 4DV1C 4B3MC 4DV0C 4KTVA 4PROC 1XRBA 2M5HA 1UKKA 4DR6C 1ZB9A 3G7SA 4BC9A 1MDFA 1FUGA 3FCCA 2YCBA 3NI2A 3CW9A 3DLPX 4JI6C 4B3SC 4PHTA 1O90A 4RM2A 3L95X 1USPA 1V60A 3TR3A 3TUFA 4G1IA 5AE3A 1QWIA 3GR1A 1TH5A 4FUQA 3N2QA 3N54B 2PT7G 5DV9A 2ATWA 5BSVA 3IEVA 2DHMA 3AY0A 4RM3A 2D1SA 1M6XA 1QM4A 2E0GA 3UOWA 3B7WA 5H9UA 3EERA 4DV3C 5AE2A 4DR1C 2D7VA 5IT9D 4JI0C 3UX3A 1XNQC 4DV2C 1XHJA 1UWDA 3NYRA 1T5DX 4HPVA 3E7WA 2UXCC 2QL8A 1MXBA 2E5LC 4X65C 4DV4C 4ZLPA 4NOZA 4WS9A 3A9UA 4BBYA 2Y4OA 2ZZMA 1WCJA 1RG9A 4D4GA 2QVYX 2CY1A 3NYQA 2D28C 1P4EA 5A2QD 2ZM6C 1HR0C 3A26A 4L2ZA 3LGXA 2JNVA 5A1IA 4WV3A 3CQ2A 5BR8C 1XRAA 4DCSA 1N33C 3T1HC 2P2FA 4YHHC 2AYAA 4DR4C 4I9GA 5BSRA 4R1LA 4LFBC 3LUSA 2KZFA 4DV7C 2P2MA 4LF7C 4K0KC 3TQIA 1JOSA
chains in the Genus database with same CATH topology
3UEBA 1PU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UEB A;  1PU1 A; 
#chains in the Genus database with same CATH topology
 1MDB A;  5FLX D;  1N34 C;  4PZP A;  1HNZ C;  3CW8 X;  4D57 A;  5A1G A;  2PN2 A;  1PU1 A;  5BSM A;  1L2F A;  1PG4 A;  2QVZ X;  4LF5 C;  2VSQ A;  1BA3 A;  2UUB C;  5BUQ A;  5K85 A;  3A9V A;  1WH9 A;  3L8C A;  4LFC C;  3DHV A;  4DR3 C;  4NXN C;  2E7G A;  5BST A;  1IBL C;  4GS5 A;  3DAY A;  5KYV A;  4ISB A;  2HHH C;  3FCE A;  3IEU A;  5KEI A;  2BH1 X;  4JI4 C;  2DPL A;  2OO4 A;  5BUS A;  2DYJ A;  2NCL A;  2E8C A;  4DCU A;  3SO4 A;  4JV5 C;  3KXW A;  3LAX A;  1J5E C;  1I94 C;  4MH4 A;  2E8F A;  4LF6 C;  4U5Y D;  3PES A;  4DR2 C;  2ZZN A;  4GKK C;  3RV2 A;  1M6X C;  2CXC A;  2P2B A;  4L4Q A;  4RVO A;  1N36 C;  1IBM C;  4IR7 A;  4DG9 A;  4OX9 C;  2JMP A;  4ZJZ A;  5BUR A;  4JM1 A;  5AE1 A;  1MXA A;  2EGT A;  5E7Q A;  3O2E A;  1AMU A;  3JAM D;  2OPL B;  1O9T A;  2MCQ A;  3S82 A;  4RVN A;  5K8F A;  2UU9 C;  3ETC A;  1XS3 A;  2D1R A;  4BC7 A;  4JI7 C;  3CQ3 A;  3LNV A;  1IB8 A;  2CU6 A;  2F4V C;  4GXQ A;  1MXC A;  3AF6 A;  4NDN A;  1ML8 A;  3RG2 A;  1VLA A;  3UZ0 A;  4NXM C;  4FTF A;  1MD9 A;  4G37 A;  4IZ6 A;  5BSU A;  1HH2 P;  2BJO A;  2HJG A;  4X66 C;  1HNW C;  5LCI A;  2Y4N A;  2OPL A;  3I08 A;  4G36 A;  5CZV A;  4D4I A;  3GKU A;  4DR5 C;  4JI5 C;  2P2J A;  3UEB A;  3IPL A;  4MTN A;  4DV6 C;  4X64 C;  2YWC A;  1EGA A;  5IWA C;  2UXD C;  4AQY C;  3T1Y C;  5LMU C;  4R1M A;  5BSW A;  3OTO C;  3GR0 A;  1YJ7 A;  2MMA B;  3ETO A;  4ODJ A;  1V25 A;  4DCV A;  1GPM A;  3UX2 A;  4XX2 A;  4L7I A;  2QVX X;  4GXR A;  4B3R C;  4X62 C;  3VNR A;  1LQL A;  5JRH A;  1V26 A;  4TPS B;  1XMQ C;  3PRO C;  1USP B;  4BSZ A;  4DUY C;  1N32 C;  2Y27 A;  3C5E A;  3R9X A;  3EQ6 A;  2KZ0 A;  4LF4 C;  4EAT A;  4PUH A;  2WP0 C;  1ZB8 A;  4LF9 C;  4DUZ C;  4LF8 C;  1RY2 A;  3CQ1 A;  3GPC A;  1MKY A;  2UUC C;  4K0B A;  2E8E A;  1KKG A;  3VNQ A;  4YY3 C;  4BCA A;  3TDE A;  4JI3 C;  4R0M A;  4I9F A;  1PG3 A;  2UUA C;  3I07 A;  4DCT A;  2VQF C;  2UXB C;  1WF3 A;  1XRC A;  1NY8 A;  4JI1 C;  3NPD A;  3E7X A;  1XMO C;  3AF5 A;  4PUG A;  4RLQ A;  3R44 A;  4KTT A;  4JYA C;  5KYT A;  3H2T A;  2KDN A;  2V7B A;  2P20 A;  4LE5 A;  3J80 D;  1VEH A;  5IFI A;  5T8S A;  4JI8 C;  5T8T A;  1P4E C;  2XR1 A;  1T5H X;  1HNX C;  2MM9 A;  3R9W A;  4OYC A;  3K6R A;  2P2Q A;  5ADZ A;  4DV5 C;  1FJG C;  4RLF A;  2PRO A;  5CZX A;  1K0R A;  3J81 D;  4RMN A;  2D1Q A;  3A25 A;  2M5O A;  2ONF A;  4DG8 A;  2Z51 A;  2D27 A;  4KHP C;  2QW0 X;  2YWB A;  1PA4 A;  3LNO A;  4OXI A;  1O93 A;  1XNR C;  4LFA C;  1N2F A;  4FUT A;  2VZE A;  4B3T C;  5GTD A;  5LMN C;  3CJE A;  3IML A;  4JI2 C;  2P02 A;  2YX1 A;  4DR7 C;  2VQE C;  1NYE A;  5A19 A;  2D1T A;  4D56 A;  1P7L A;  1LCI A;  4GKJ C;  2ASB A;  4PUI A;  1ULT A;  2OBV A;  1IBK C;  3A4I A;  3PBK A;  3VNS A;  2WD9 A;  1O92 A;  1FLO A;  4DV1 C;  4B3M C;  4DV0 C;  4KTV A;  4PRO C;  1XRB A;  2M5H A;  1UKK A;  4DR6 C;  1ZB9 A;  3G7S A;  4BC9 A;  1MDF A;  1FUG A;  3FCC A;  2YCB A;  3NI2 A;  3CW9 A;  3DLP X;  4JI6 C;  4B3S C;  4PHT A;  1O90 A;  4RM2 A;  3L95 X;  1USP A;  1V60 A;  3TR3 A;  3TUF A;  4G1I A;  5AE3 A;  1QWI A;  3GR1 A;  1TH5 A;  4FUQ A;  3N2Q A;  3N54 B;  2PT7 G;  5DV9 A;  2ATW A;  5BSV A;  3IEV A;  2DHM A;  3AY0 A;  4RM3 A;  2D1S A;  1M6X A;  1QM4 A;  2E0G A;  3UOW A;  3B7W A;  5H9U A;  3EER A;  4DV3 C;  5AE2 A;  4DR1 C;  2D7V A;  5IT9 D;  4JI0 C;  3UX3 A;  1XNQ C;  4DV2 C;  1XHJ A;  1UWD A;  3NYR A;  1T5D X;  4HPV A;  3E7W A;  2UXC C;  2QL8 A;  1MXB A;  2E5L C;  4X65 C;  4DV4 C;  4ZLP A;  4NOZ A;  4WS9 A;  3A9U A;  4BBY A;  2Y4O A;  2ZZM A;  1WCJ A;  1RG9 A;  4D4G A;  2QVY X;  2CY1 A;  3NYQ A;  2D28 C;  1P4E A;  5A2Q D;  2ZM6 C;  1HR0 C;  3A26 A;  4L2Z A;  3LGX A;  2JNV A;  5A1I A;  4WV3 A;  3CQ2 A;  5BR8 C;  1XRA A;  4DCS A;  1N33 C;  3T1H C;  2P2F A;  4YHH C;  2AYA A;  4DR4 C;  4I9G A;  5BSR A;  4R1L A;  4LFB C;  3LUS A;  2KZF A;  4DV7 C;  2P2M A;  4LF7 C;  4K0K C;  3TQI A;  1JOS A; 
#chains in the Genus database with same CATH homology
 3UEB A;  1PU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...