2E8CA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Aq_1549
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8cA00
4NXMC 4JI7C 4GKKC 4DV0C 4KHPC 2VQFC 2XR1A 1XNQC 4JV5C 4LFBC 2ATWA 4X66C 3OTOC 1ZB9A 1N36C 2UUBC 1UKKA 2EGTA 4JI4C 4GKJC 1N33C 4JI6C 3T1YC 4DR1C 1XNRC 4DCTA 5BR8C 1FJGC 2D7VA 4JI0C 2JMPA 1I94C 1N32C 3AF6A 2OPLA 4DV1C 4DCUA 1IBLC 3EERA 2PN2A 4B3SC 4DR6C 1JOSA 1N2FA 2ZM6C 4X62C 3J81D 1L2FA 1HH2P 4BSZA 4X65C 4DV7C 2PT7G 4LF4C 1QWIA 4DUZC 1HR0C 3JAMD 4DR5C 1J5EC 1PA4A 2E8CA 5IT9D 1EGAA 1ZB8A 4K0KC 1HNXC 1NYEA 4DV2C 2E8FA 4LFCC 2QL8A 1HNWC 3I07A 4YHHC 4XX2A 2BJOA 1XMOC 4DV3C 4B3RC 4JI5C 2UUCC 5FLXD 1N34C 2DYJA 5IWAC 2UXCC 1VLAA 3LUSA 4LFAC 3J80D 4JI1C 1LQLA 4MH4A 2HHHC 4LF9C 3R9XA 4B3MC 4LF8C 2CXCA 2KZFA 4DCVA 3IEUA 5A2QD 2UUAC 4DR3C 1IBKC 3CJEA 1WH9A 4DR4C 1ML8A 3T1HC 4AQYC 3GKUA 2VQEC 4DV6C 4DR2C 1KKGA 3R9WA 4X64C 4NOZA 5LMNC 4JI3C 2ASBA 2ONFA 1MKYA 1K0RA 4MTNA 4JI8C 4OX9C 4JYAC 4DUYC 2CY1A 4DR7C 3IEVA 3AF5A 1HNZC 2UU9C 4YY3C 1USPA 4LF5C 4JI2C 1WF3A 4LF6C 4NXNC 2HJGA 5LMUC 2E5LC 4LF7C 4DV4C 1IBMC 2YCBA 1XMQC 2F4VC 2UXDC 1USPB 4DCSA 4B3TC 2UXBC 4DV5C 2OPLB 2E7GA 2E8EA
chains in the Genus database with same CATH superfamily
1P7LA 4TPSB 2VQFC 2XR1A 4GXRA 1MXCA 3A25A 1N33C 1V25A 2EGTA 4GKJC 3E7WA 4DR1C 3N54B 2MM9A 5CZXA 2P2MA 4KTTA 5KEIA 4IR7A 4DCUA 3EERA 3TR3A 1N2FA 1L2FA 4PUIA 2YWCA 4X65C 4DV7C 2PT7G 2PROA 3CQ3A 3ETOA 1XS3A 1EGAA 3CQ1A 1ZB8A 1T5HX 2D27A 1HNXC 3PROC 1PG3A 4D56A 1XRBA 4L4QA 4ZLPA 4XX2A 1XMOC 4ISBA 1V60A 5FLXD 1N34C 1RY2A 2UXCC 1VLAA 2VSQA 1FUGA 3UX2A 1LQLA 4MH4A 2BH1X 4LF8C 1RG9A 2UUAC 1UWDA 4DR3C 1WH9A 1ML8A 3FCEA 2VQEC 2WP0C 2OBVA 2MMAB 4JYAC 4DR7C 5K85A 1AMUA 3AF5A 2D1TA 5BSVA 1HNZC 3NYRA 4I9FA 3RV2A 3CQ2A 2HJGA 3C5EA 4G1IA 3PBKA 3GPCA 3DAYA 5BSTA 2E5LC 4DV4C 2YCBA 5K8FA 2UXDC 3O2EA 1USPB 3IPLA 4DCSA 4B3TC 5ADZA 2Y4OA 4JM1A 2YWBA 2E7GA 3I08A 4BC7A 4GKKC 4DV0C 4KHPC 1ULTA 4HPVA 1XNQC 3N2QA 2Y4NA 3OTOC 5T8TA 1N36C 4JI6C 3T1YC 4GXQA 4DCTA 1MDBA 5BSUA 2JMPA 4RVOA 4RLQA 1I94C 4D4IA 3UX3A 4G36A 1IBLC 1MXBA 2PN2A 3A4IA 4WV3A 3A9UA 1MDFA 2ZM6C 4X62C 4LF4C 1HR0C 1XHJA 1J5EC 2ZZNA 2E8CA 2V7BA 5H9UA 3K6RA 4K0KC 1V26A 4BC9A 3GR1A 2P20A 2E8FA 4ZJZA 2QL8A 3I07A 5KYVA 5BUSA 4DV3C 2WD9A 4B3RC 1NY8A 4I9GA 3TUFA 5E7QA 3L8CA 1PG4A 2CXCA 3IEUA 1T5DX 4K0BA 3T1HC 4FTFA 2KDNA 3LAXA 4DR2C 3R9WA 1FLOA 3SO4A 1PU1A 4X64C 3VNRA 4JI8C 4RM3A 4D57A 2Y27A 2OO4A 1XRCA 4NXNC 5CZVA 5A1GA 1IB8A 5A1IA 1P4EC 5KYTA 4LF7C 3RG2A 2QVYX 4R0MA 4L7IA 2UXBC 2P02A 2OPLB 4RM2A 1P4EA 5GTDA 2E8EA 4NXMC 4JI7C 4PROC 4JV5C 4LFBC 2QVZX 3IMLA 5BSMA 1XNRC 1FJGC 4JI0C 5AE3A 1N32C 2OPLA 4DV1C 3ETCA 1M6XA 4DG9A 4DR6C 1JOSA 3J81D 1O9TA 1HH2P 1QWIA 3JAMD 1LCIA 2JNVA 3NPDA 3DLPX 2ZZMA 1O93A 4U5YD 4G37A 4DV2C 1NYEA 4LFCC 1HNWC 3R44A 3GR0A 2KZ0A 3TDEA 2UUCC 4R1MA 3S82A 3LUSA 4LFAC 4JI1C 2HHHC 3UOWA 4LF9C 3R9XA 4PZPA 5AE2A 4DCVA 1QM4A 3CJEA 5BUQA 4DR4C 4AQYC 1KKGA 2ONFA 4MTNA 3NI2A 4OX9C 2CY1A 3A26A 2UU9C 4YY3C 4RVNA 4RMNA 4JI2C 5LMUC 2D1QA 5BSWA 2D1SA 1XMQC 4LE5A 2D1RA 2F4VC 4OXIA 1XRAA 3H2TA 2P2QA 1ZB9A 3TQIA 4KTVA 2P2BA 2ATWA 4X66C 4BCAA 2UUBC 1UKKA 4JI4C 1MXAA 3KXWA 4D4GA 5BR8C 2D7VA 2E0GA 3AF6A 4GS5A 2QVXX 4L2ZA 1VEHA 3UEBA 2QW0X 2M5HA 4B3SC 3A9VA 2NCLA 4BSZA 4BBYA 4DUZC 4DR5C 1PA4A 4PUHA 1O92A 3CW9A 3CW8X 5BSRA 5IT9D 2P2JA 3E7XA 1MD9A 4PHTA 5A19A 3LNVA 4YHHC 3AY0A 4OYCA 2BJOA 2DPLA 3G7SA 1TH5A 4JI5C 1YJ7A 4PUGA 2DYJA 5IWAC 2CU6A 5IFIA 3J80D 1BA3A 5T8SA 4B3MC 5JRHA 2DHMA 2KZFA 5A2QD 1IBKC 3DHVA 1O90A 3PESA 2YX1A 2P2FA 3GKUA 4DV6C 1WCJA 4NDNA 5AE1A 2M5OA 4NOZA 3B7WA 5LMNC 4JI3C 2ASBA 1MKYA 1K0RA 4EATA 4ODJA 3UZ0A 3LNOA 4DG8A 4DUYC 3IEVA 1M6XC 2VZEA 3FCCA 1USPA 4LF5C 3VNQA 1WF3A 4LF6C 4WS9A 5BURA 4FUTA 4IZ6A 3NYQA 3EQ6A 2MCQA 2Z51A 1IBMC 5DV9A 2AYAA 3LGXA 4FUQA 2D28C 5LCIA 3L95X 4R1LA 4RLFA 4DV5C 3VNSA 1GPMA
chains in the Genus database with same CATH topology
1P7LA 4TPSB 2VQFC 2XR1A 4GXRA 1MXCA 1N33C 1V25A 2EGTA 4GKJC 3E7WA 4DR1C 3N54B 5CZXA 2P2MA 4KTTA 5KEIA 4IR7A 4DCUA 3EERA 1N2FA 1L2FA 2YWCA 4X65C 4DV7C 2PT7G 2PROA 3ETOA 1EGAA 1ZB8A 1T5HX 2D27A 1HNXC 3PROC 1PG3A 4D56A 1XRBA 4L4QA 4ZLPA 4XX2A 1XMOC 4ISBA 5FLXD 1N34C 1RY2A 2UXCC 1VLAA 2VSQA 1FUGA 1LQLA 4MH4A 2BH1X 4LF8C 1RG9A 2UUAC 4DR3C 1WH9A 1ML8A 3FCEA 2VQEC 2WP0C 2OBVA 4JYAC 4DR7C 5K85A 1AMUA 3AF5A 2D1TA 5BSVA 1HNZC 3NYRA 4I9FA 3RV2A 2HJGA 3C5EA 4G1IA 3PBKA 3GPCA 3DAYA 5BSTA 2E5LC 4DV4C 2YCBA 5K8FA 2UXDC 1USPB 3IPLA 4DCSA 4B3TC 5ADZA 2Y4OA 4JM1A 2YWBA 2E7GA 3I08A 4BC7A 4GKKC 4DV0C 4KHPC 1ULTA 4HPVA 1XNQC 3N2QA 2Y4NA 3OTOC 5T8TA 1N36C 4JI6C 3T1YC 4GXQA 4DCTA 1MDBA 5BSUA 2JMPA 4RVOA 4RLQA 1I94C 4D4IA 4G36A 1IBLC 1MXBA 2PN2A 3A4IA 4WV3A 3A9UA 1MDFA 2ZM6C 4X62C 4LF4C 1HR0C 1J5EC 2E8CA 2V7BA 5H9UA 4K0KC 1V26A 4BC9A 3GR1A 2P20A 2E8FA 4ZJZA 2QL8A 3I07A 5KYVA 5BUSA 4DV3C 2WD9A 4B3RC 4I9GA 3TUFA 5E7QA 3L8CA 1PG4A 2CXCA 3IEUA 1T5DX 4K0BA 3T1HC 4FTFA 3LAXA 4DR2C 3R9WA 3SO4A 4X64C 3VNRA 4JI8C 4RM3A 4D57A 2Y27A 2OO4A 1XRCA 4NXNC 5CZVA 5A1GA 5A1IA 5KYTA 4LF7C 3RG2A 2QVYX 4R0MA 4L7IA 2UXBC 2P02A 2OPLB 4RM2A 5GTDA 2E8EA 4NXMC 4JI7C 4PROC 4JV5C 4LFBC 2QVZX 3IMLA 5BSMA 1XNRC 1FJGC 4JI0C 5AE3A 1N32C 2OPLA 4DV1C 3ETCA 4DG9A 4DR6C 1JOSA 3J81D 1O9TA 1HH2P 1QWIA 3JAMD 1LCIA 3NPDA 3DLPX 1O93A 4U5YD 4G37A 1NYEA 4DV2C 4LFCC 1HNWC 3R44A 3GR0A 3TDEA 2UUCC 4R1MA 3S82A 3LUSA 4LFAC 4JI1C 2HHHC 3UOWA 4LF9C 3R9XA 4PZPA 5AE2A 4DCVA 1QM4A 3CJEA 5BUQA 4DR4C 4AQYC 1KKGA 2ONFA 4MTNA 4OX9C 3NI2A 2CY1A 2UU9C 4YY3C 4RVNA 4RMNA 4JI2C 5LMUC 2D1QA 5BSWA 2D1SA 1XMQC 4LE5A 2D1RA 2F4VC 4OXIA 1XRAA 3H2TA 2P2QA 1ZB9A 3TQIA 4KTVA 2P2BA 2ATWA 2UUBC 4X66C 4BCAA 1UKKA 4JI4C 1MXAA 3KXWA 4D4GA 5BR8C 2D7VA 2E0GA 3AF6A 4GS5A 2QVXX 4L2ZA 2QW0X 4B3SC 3A9VA 4BSZA 4BBYA 4DUZC 4DR5C 1PA4A 1O92A 3CW9A 3CW8X 5BSRA 5IT9D 2P2JA 3E7XA 1MD9A 4PHTA 5A19A 3LNVA 4YHHC 4OYCA 2BJOA 2DPLA 3G7SA 4JI5C 1YJ7A 2DYJA 5IWAC 5IFIA 3J80D 1BA3A 5T8SA 4B3MC 5JRHA 2KZFA 5A2QD 1IBKC 3DHVA 1O90A 3PESA 2P2FA 3GKUA 4DV6C 4NDNA 5AE1A 4NOZA 3B7WA 5LMNC 4JI3C 2ASBA 1MKYA 1K0RA 4EATA 4ODJA 3UZ0A 4DG8A 4DUYC 3IEVA 2VZEA 3FCCA 1USPA 4LF5C 3VNQA 1WF3A 4LF6C 4WS9A 5BURA 4FUTA 4IZ6A 3NYQA 3EQ6A 1IBMC 5DV9A 2AYAA 3LGXA 4FUQA 2D28C 4DV5C 3L95X 4R1LA 4RLFA 3VNSA 1GPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXM C;  4JI7 C;  4GKK C;  4DV0 C;  4KHP C;  2VQF C;  2XR1 A;  1XNQ C;  4JV5 C;  4LFB C;  2ATW A;  4X66 C;  3OTO C;  1ZB9 A;  1N36 C;  2UUB C;  1UKK A;  2EGT A;  4JI4 C;  4GKJ C;  1N33 C;  4JI6 C;  3T1Y C;  4DR1 C;  1XNR C;  4DCT A;  5BR8 C;  1FJG C;  2D7V A;  4JI0 C;  2JMP A;  1I94 C;  1N32 C;  3AF6 A;  2OPL A;  4DV1 C;  4DCU A;  1IBL C;  3EER A;  2PN2 A;  4B3S C;  4DR6 C;  1JOS A;  1N2F A;  2ZM6 C;  4X62 C;  3J81 D;  1L2F A;  1HH2 P;  4BSZ A;  4X65 C;  4DV7 C;  2PT7 G;  4LF4 C;  1QWI A;  4DUZ C;  1HR0 C;  3JAM D;  4DR5 C;  1J5E C;  1PA4 A;  2E8C A;  5IT9 D;  1EGA A;  1ZB8 A;  4K0K C;  1HNX C;  1NYE A;  4DV2 C;  2E8F A;  4LFC C;  2QL8 A;  1HNW C;  3I07 A;  4YHH C;  4XX2 A;  2BJO A;  1XMO C;  4DV3 C;  4B3R C;  4JI5 C;  2UUC C;  5FLX D;  1N34 C;  2DYJ A;  5IWA C;  2UXC C;  1VLA A;  3LUS A;  4LFA C;  3J80 D;  4JI1 C;  1LQL A;  4MH4 A;  2HHH C;  4LF9 C;  3R9X A;  4B3M C;  4LF8 C;  2CXC A;  2KZF A;  4DCV A;  3IEU A;  5A2Q D;  2UUA C;  4DR3 C;  1IBK C;  3CJE A;  1WH9 A;  4DR4 C;  1ML8 A;  3T1H C;  4AQY C;  3GKU A;  2VQE C;  4DV6 C;  4DR2 C;  1KKG A;  3R9W A;  4X64 C;  4NOZ A;  5LMN C;  4JI3 C;  2ASB A;  2ONF A;  1MKY A;  1K0R A;  4MTN A;  4JI8 C;  4OX9 C;  4JYA C;  4DUY C;  2CY1 A;  4DR7 C;  3IEV A;  3AF5 A;  1HNZ C;  2UU9 C;  4YY3 C;  1USP A;  4LF5 C;  4JI2 C;  1WF3 A;  4LF6 C;  4NXN C;  2HJG A;  5LMU C;  2E5L C;  4LF7 C;  4DV4 C;  1IBM C;  2YCB A;  1XMQ C;  2F4V C;  2UXD C;  1USP B;  4DCS A;  4B3T C;  2UXB C;  4DV5 C;  2OPL B;  2E7G A;  2E8E A; 
#chains in the Genus database with same CATH topology
 1P7L A;  4TPS B;  2VQF C;  2XR1 A;  4GXR A;  1MXC A;  3A25 A;  1N33 C;  1V25 A;  2EGT A;  4GKJ C;  3E7W A;  4DR1 C;  3N54 B;  2MM9 A;  5CZX A;  2P2M A;  4KTT A;  5KEI A;  4IR7 A;  4DCU A;  3EER A;  3TR3 A;  1N2F A;  1L2F A;  4PUI A;  2YWC A;  4X65 C;  4DV7 C;  2PT7 G;  2PRO A;  3CQ3 A;  3ETO A;  1XS3 A;  1EGA A;  3CQ1 A;  1ZB8 A;  1T5H X;  2D27 A;  1HNX C;  3PRO C;  1PG3 A;  4D56 A;  1XRB A;  4L4Q A;  4ZLP A;  4XX2 A;  1XMO C;  4ISB A;  1V60 A;  5FLX D;  1N34 C;  1RY2 A;  2UXC C;  1VLA A;  2VSQ A;  1FUG A;  3UX2 A;  1LQL A;  4MH4 A;  2BH1 X;  4LF8 C;  1RG9 A;  2UUA C;  1UWD A;  4DR3 C;  1WH9 A;  1ML8 A;  3FCE A;  2VQE C;  2WP0 C;  2OBV A;  2MMA B;  4JYA C;  4DR7 C;  5K85 A;  1AMU A;  3AF5 A;  2D1T A;  5BSV A;  1HNZ C;  3NYR A;  4I9F A;  3RV2 A;  3CQ2 A;  2HJG A;  3C5E A;  4G1I A;  3PBK A;  3GPC A;  3DAY A;  5BST A;  2E5L C;  4DV4 C;  2YCB A;  5K8F A;  2UXD C;  3O2E A;  1USP B;  3IPL A;  4DCS A;  4B3T C;  5ADZ A;  2Y4O A;  4JM1 A;  2YWB A;  2E7G A;  3I08 A;  4BC7 A;  4GKK C;  4DV0 C;  4KHP C;  1ULT A;  4HPV A;  1XNQ C;  3N2Q A;  2Y4N A;  3OTO C;  5T8T A;  1N36 C;  4JI6 C;  3T1Y C;  4GXQ A;  4DCT A;  1MDB A;  5BSU A;  2JMP A;  4RVO A;  4RLQ A;  1I94 C;  4D4I A;  3UX3 A;  4G36 A;  1IBL C;  1MXB A;  2PN2 A;  3A4I A;  4WV3 A;  3A9U A;  1MDF A;  2ZM6 C;  4X62 C;  4LF4 C;  1HR0 C;  1XHJ A;  1J5E C;  2ZZN A;  2E8C A;  2V7B A;  5H9U A;  3K6R A;  4K0K C;  1V26 A;  4BC9 A;  3GR1 A;  2P20 A;  2E8F A;  4ZJZ A;  2QL8 A;  3I07 A;  5KYV A;  5BUS A;  4DV3 C;  2WD9 A;  4B3R C;  1NY8 A;  4I9G A;  3TUF A;  5E7Q A;  3L8C A;  1PG4 A;  2CXC A;  3IEU A;  1T5D X;  4K0B A;  3T1H C;  4FTF A;  2KDN A;  3LAX A;  4DR2 C;  3R9W A;  1FLO A;  3SO4 A;  1PU1 A;  4X64 C;  3VNR A;  4JI8 C;  4RM3 A;  4D57 A;  2Y27 A;  2OO4 A;  1XRC A;  4NXN C;  5CZV A;  5A1G A;  1IB8 A;  5A1I A;  1P4E C;  5KYT A;  4LF7 C;  3RG2 A;  2QVY X;  4R0M A;  4L7I A;  2UXB C;  2P02 A;  2OPL B;  4RM2 A;  1P4E A;  5GTD A;  2E8E A;  4NXM C;  4JI7 C;  4PRO C;  4JV5 C;  4LFB C;  2QVZ X;  3IML A;  5BSM A;  1XNR C;  1FJG C;  4JI0 C;  5AE3 A;  1N32 C;  2OPL A;  4DV1 C;  3ETC A;  1M6X A;  4DG9 A;  4DR6 C;  1JOS A;  3J81 D;  1O9T A;  1HH2 P;  1QWI A;  3JAM D;  1LCI A;  2JNV A;  3NPD A;  3DLP X;  2ZZM A;  1O93 A;  4U5Y D;  4G37 A;  4DV2 C;  1NYE A;  4LFC C;  1HNW C;  3R44 A;  3GR0 A;  2KZ0 A;  3TDE A;  2UUC C;  4R1M A;  3S82 A;  3LUS A;  4LFA C;  4JI1 C;  2HHH C;  3UOW A;  4LF9 C;  3R9X A;  4PZP A;  5AE2 A;  4DCV A;  1QM4 A;  3CJE A;  5BUQ A;  4DR4 C;  4AQY C;  1KKG A;  2ONF A;  4MTN A;  3NI2 A;  4OX9 C;  2CY1 A;  3A26 A;  2UU9 C;  4YY3 C;  4RVN A;  4RMN A;  4JI2 C;  5LMU C;  2D1Q A;  5BSW A;  2D1S A;  1XMQ C;  4LE5 A;  2D1R A;  2F4V C;  4OXI A;  1XRA A;  3H2T A;  2P2Q A;  1ZB9 A;  3TQI A;  4KTV A;  2P2B A;  2ATW A;  4X66 C;  4BCA A;  2UUB C;  1UKK A;  4JI4 C;  1MXA A;  3KXW A;  4D4G A;  5BR8 C;  2D7V A;  2E0G A;  3AF6 A;  4GS5 A;  2QVX X;  4L2Z A;  1VEH A;  3UEB A;  2QW0 X;  2M5H A;  4B3S C;  3A9V A;  2NCL A;  4BSZ A;  4BBY A;  4DUZ C;  4DR5 C;  1PA4 A;  4PUH A;  1O92 A;  3CW9 A;  3CW8 X;  5BSR A;  5IT9 D;  2P2J A;  3E7X A;  1MD9 A;  4PHT A;  5A19 A;  3LNV A;  4YHH C;  3AY0 A;  4OYC A;  2BJO A;  2DPL A;  3G7S A;  1TH5 A;  4JI5 C;  1YJ7 A;  4PUG A;  2DYJ A;  5IWA C;  2CU6 A;  5IFI A;  3J80 D;  1BA3 A;  5T8S A;  4B3M C;  5JRH A;  2DHM A;  2KZF A;  5A2Q D;  1IBK C;  3DHV A;  1O90 A;  3PES A;  2YX1 A;  2P2F A;  3GKU A;  4DV6 C;  1WCJ A;  4NDN A;  5AE1 A;  2M5O A;  4NOZ A;  3B7W A;  5LMN C;  4JI3 C;  2ASB A;  1MKY A;  1K0R A;  4EAT A;  4ODJ A;  3UZ0 A;  3LNO A;  4DG8 A;  4DUY C;  3IEV A;  1M6X C;  2VZE A;  3FCC A;  1USP A;  4LF5 C;  3VNQ A;  1WF3 A;  4LF6 C;  4WS9 A;  5BUR A;  4FUT A;  4IZ6 A;  3NYQ A;  3EQ6 A;  2MCQ A;  2Z51 A;  1IBM C;  5DV9 A;  2AYA A;  3LGX A;  4FUQ A;  2D28 C;  5LCI A;  3L95 X;  4R1L A;  4RLF A;  4DV5 C;  3VNS A;  1GPM A; 
#chains in the Genus database with same CATH homology
 1P7L A;  4TPS B;  2VQF C;  2XR1 A;  4GXR A;  1MXC A;  1N33 C;  1V25 A;  2EGT A;  4GKJ C;  3E7W A;  4DR1 C;  3N54 B;  5CZX A;  2P2M A;  4KTT A;  5KEI A;  4IR7 A;  4DCU A;  3EER A;  1N2F A;  1L2F A;  2YWC A;  4X65 C;  4DV7 C;  2PT7 G;  2PRO A;  3ETO A;  1EGA A;  1ZB8 A;  1T5H X;  2D27 A;  1HNX C;  3PRO C;  1PG3 A;  4D56 A;  1XRB A;  4L4Q A;  4ZLP A;  4XX2 A;  1XMO C;  4ISB A;  5FLX D;  1N34 C;  1RY2 A;  2UXC C;  1VLA A;  2VSQ A;  1FUG A;  1LQL A;  4MH4 A;  2BH1 X;  4LF8 C;  1RG9 A;  2UUA C;  4DR3 C;  1WH9 A;  1ML8 A;  3FCE A;  2VQE C;  2WP0 C;  2OBV A;  4JYA C;  4DR7 C;  5K85 A;  1AMU A;  3AF5 A;  2D1T A;  5BSV A;  1HNZ C;  3NYR A;  4I9F A;  3RV2 A;  2HJG A;  3C5E A;  4G1I A;  3PBK A;  3GPC A;  3DAY A;  5BST A;  2E5L C;  4DV4 C;  2YCB A;  5K8F A;  2UXD C;  1USP B;  3IPL A;  4DCS A;  4B3T C;  5ADZ A;  2Y4O A;  4JM1 A;  2YWB A;  2E7G A;  3I08 A;  4BC7 A;  4GKK C;  4DV0 C;  4KHP C;  1ULT A;  4HPV A;  1XNQ C;  3N2Q A;  2Y4N A;  3OTO C;  5T8T A;  1N36 C;  4JI6 C;  3T1Y C;  4GXQ A;  4DCT A;  1MDB A;  5BSU A;  2JMP A;  4RVO A;  4RLQ A;  1I94 C;  4D4I A;  4G36 A;  1IBL C;  1MXB A;  2PN2 A;  3A4I A;  4WV3 A;  3A9U A;  1MDF A;  2ZM6 C;  4X62 C;  4LF4 C;  1HR0 C;  1J5E C;  2E8C A;  2V7B A;  5H9U A;  4K0K C;  1V26 A;  4BC9 A;  3GR1 A;  2P20 A;  2E8F A;  4ZJZ A;  2QL8 A;  3I07 A;  5KYV A;  5BUS A;  4DV3 C;  2WD9 A;  4B3R C;  4I9G A;  3TUF A;  5E7Q A;  3L8C A;  1PG4 A;  2CXC A;  3IEU A;  1T5D X;  4K0B A;  3T1H C;  4FTF A;  3LAX A;  4DR2 C;  3R9W A;  3SO4 A;  4X64 C;  3VNR A;  4JI8 C;  4RM3 A;  4D57 A;  2Y27 A;  2OO4 A;  1XRC A;  4NXN C;  5CZV A;  5A1G A;  5A1I A;  5KYT A;  4LF7 C;  3RG2 A;  2QVY X;  4R0M A;  4L7I A;  2UXB C;  2P02 A;  2OPL B;  4RM2 A;  5GTD A;  2E8E A;  4NXM C;  4JI7 C;  4PRO C;  4JV5 C;  4LFB C;  2QVZ X;  3IML A;  5BSM A;  1XNR C;  1FJG C;  4JI0 C;  5AE3 A;  1N32 C;  2OPL A;  4DV1 C;  3ETC A;  4DG9 A;  4DR6 C;  1JOS A;  3J81 D;  1O9T A;  1HH2 P;  1QWI A;  3JAM D;  1LCI A;  3NPD A;  3DLP X;  1O93 A;  4U5Y D;  4G37 A;  1NYE A;  4DV2 C;  4LFC C;  1HNW C;  3R44 A;  3GR0 A;  3TDE A;  2UUC C;  4R1M A;  3S82 A;  3LUS A;  4LFA C;  4JI1 C;  2HHH C;  3UOW A;  4LF9 C;  3R9X A;  4PZP A;  5AE2 A;  4DCV A;  1QM4 A;  3CJE A;  5BUQ A;  4DR4 C;  4AQY C;  1KKG A;  2ONF A;  4MTN A;  4OX9 C;  3NI2 A;  2CY1 A;  2UU9 C;  4YY3 C;  4RVN A;  4RMN A;  4JI2 C;  5LMU C;  2D1Q A;  5BSW A;  2D1S A;  1XMQ C;  4LE5 A;  2D1R A;  2F4V C;  4OXI A;  1XRA A;  3H2T A;  2P2Q A;  1ZB9 A;  3TQI A;  4KTV A;  2P2B A;  2ATW A;  2UUB C;  4X66 C;  4BCA A;  1UKK A;  4JI4 C;  1MXA A;  3KXW A;  4D4G A;  5BR8 C;  2D7V A;  2E0G A;  3AF6 A;  4GS5 A;  2QVX X;  4L2Z A;  2QW0 X;  4B3S C;  3A9V A;  4BSZ A;  4BBY A;  4DUZ C;  4DR5 C;  1PA4 A;  1O92 A;  3CW9 A;  3CW8 X;  5BSR A;  5IT9 D;  2P2J A;  3E7X A;  1MD9 A;  4PHT A;  5A19 A;  3LNV A;  4YHH C;  4OYC A;  2BJO A;  2DPL A;  3G7S A;  4JI5 C;  1YJ7 A;  2DYJ A;  5IWA C;  5IFI A;  3J80 D;  1BA3 A;  5T8S A;  4B3M C;  5JRH A;  2KZF A;  5A2Q D;  1IBK C;  3DHV A;  1O90 A;  3PES A;  2P2F A;  3GKU A;  4DV6 C;  4NDN A;  5AE1 A;  4NOZ A;  3B7W A;  5LMN C;  4JI3 C;  2ASB A;  1MKY A;  1K0R A;  4EAT A;  4ODJ A;  3UZ0 A;  4DG8 A;  4DUY C;  3IEV A;  2VZE A;  3FCC A;  1USP A;  4LF5 C;  3VNQ A;  1WF3 A;  4LF6 C;  4WS9 A;  5BUR A;  4FUT A;  4IZ6 A;  3NYQ A;  3EQ6 A;  1IBM C;  5DV9 A;  2AYA A;  3LGX A;  4FUQ A;  2D28 C;  4DV5 C;  3L95 X;  4R1L A;  4RLF A;  3VNS A;  1GPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...