2E8CA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Aq_1549
publication title Crystal structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8cA00
2CXCA 5A2QD 1L2FA 1QWIA 5LMNC 2BJOA 4DCUA 2E8CA 2PT7G 4DR2C 2VQEC 4JI7C 3J80D 2UXBC 4JI5C 1ZB8A 4LFAC 4DUYC 1XNQC 2UUBC 4LF7C 2UU9C 3AF5A 4JI2C 3T1YC 2E8FA 1NYEA 4LFBC 3R9WA 1N2FA 4B3SC 4LFCC 3IEVA 4MTNA 4JI4C 1XNRC 4JI0C 1USPA 4X64C 4DV2C 4K0KC 4JI6C 1USPB 2E7GA 3JAMD 4YHHC 4DV5C 4DV1C 4JI1C 3AF6A 4DCVA 4B3TC 3OTOC 4XX2A 2D7VA 1WF3A 3IEUA 2ASBA 1ZB9A 4DV0C 4KHPC 4JV5C 4DR4C 3R9XA 1N36C 1MKYA 2UUCC 5LMUC 1J5EC 4LF6C 4LF5C 4DV6C 5IWAC 4DV7C 2CY1A 1VLAA 1N34C 5BR8C 1IBLC 4DR5C 3GKUA 4X62C 1JOSA 4NXNC 2UUAC 4GKJC 1HNZC 3J81D 1N33C 2EGTA 4JI8C 1HR0C 2JMPA 2YCBA 4DCSA 4MH4A 2ZM6C 2UXCC 3EERA 3T1HC 4NOZA 1FJGC 4B3RC 4LF8C 2E8EA 1LQLA 2F4VC 2ATWA 4DR3C 2ONFA 2VQFC 1I94C 4DR7C 1XMOC 1HNXC 4DR6C 4X66C 4DV3C 3LUSA 4LF9C 4B3MC 1KKGA 1HH2P 1XMQC 4AQYC 4X65C 3CJEA 1WH9A 1K0RA 2DYJA 4YY3C 2E5LC 4BSZA 5IT9D 1HNWC 2UXDC 2OPLA 5FLXD 1IBMC 4LF4C 4NXMC 1EGAA 2HJGA 2OPLB 1UKKA 2KZFA 4DR1C 4JI3C 4DCTA 1IBKC 4DV4C 2HHHC 4GKKC 4OX9C 2PN2A 4DUZC 1N32C 3I07A 4JYAC 2XR1A 1ML8A 2QL8A 1PA4A
chains in the Genus database with same CATH superfamily
2CXCA 4G1IA 3RV2A 1MDFA 2AYAA 2BJOA 3A9VA 1O92A 2E8CA 4FUTA 2UXBC 4LFAC 1ZB8A 1TH5A 2M5HA 2UU9C 3AF5A 3DAYA 2WP0C 2D1RA 4D4GA 5A1GA 4KTTA 3VNSA 4PZPA 4PHTA 4JI6C 3DLPX 4DV5C 4DV1C 3ETOA 2D7VA 3UZ0A 2P20A 3IEUA 2QVZX 4PUIA 4KHPC 4NDNA 1FLOA 3L95X 1MKYA 2D27A 5LMUC 4LF6C 2CY1A 1NY8A 1VLAA 1UWDA 3GKUA 3PROC 1JOSA 4NXNC 1HNZC 3J81D 1N33C 3UX2A 2YCBA 1IB8A 3N2QA 3FCEA 1O93A 3VNRA 4GXRA 2OO4A 2ATWA 2P2QA 3K6RA 1M6XC 1I94C 5BSUA 5H9UA 4RLQA 4DR6C 3LUSA 1KKGA 4R1MA 1XMQC 1O90A 5JRHA 1WH9A 5BUQA 2DPLA 1K0RA 5A1IA 4BSZA 5IT9D 2ZZNA 3UX3A 5FLXD 1IBMC 2JNVA 1ULTA 3VNQA 2QVXX 4JI3C 5KYVA 1IBKC 3H2TA 2YX1A 3IPLA 2XR1A 4K0BA 1ML8A 1N34C 3N54B 1L2FA 2QW0X 4JI5C 4R1LA 1XNQC 2PROA 4JI2C 4FTFA 2E8FA 2M5OA 4LFBC 3S82A 4B3SC 4MTNA 4JI4C 1V60A 4ISBA 1USPA 2V7BA 4X64C 1V25A 1MXAA 2E7GA 3LAXA 1M6XA 4I9FA 4U5YD 4JI1C 1V26A 3ETCA 2P2MA 3OTOC 3AY0A 1O9TA 4XX2A 3CW9A 1XRAA 5K85A 1WF3A 1MD9A 4DV0C 4JV5C 3R44A 4GS5A 1BA3A 5BURA 3PESA 2UUCC 5KEIA 4DV6C 5IWAC 1P7LA 3UOWA 4DR5C 4RVNA 2P2BA 3CQ2A 4RM2A 2EGTA 2JMPA 2ZM6C 1XRCA 1AMUA 2D28C 3KXWA 4NOZA 3T1HC 5T8TA 2E0GA 2E8EA 1LQLA 4I9GA 4IZ6A 3NYQA 2D1QA 2ONFA 2KZ0A 3L8CA 1FUGA 4PUGA 4DR7C 1XMOC 3TQIA 4DV3C 4FUQA 2P2JA 2KDNA 2D1TA 3CQ1A 5BSVA 2VZEA 5KYTA 3A4IA 1HNWC 3DHVA 2OPLA 2YWCA 3A26A 4LF4C 1XHJA 4NXMC 1EGAA 4R0MA 1VEHA 4OX9C 2PN2A 4DUZC 5AE1A 4WV3A 4JM1A 4EATA 3LNOA 4BC9A 1QWIA 4DCUA 3E7WA 5BSRA 2PT7G 5BUSA 4JI7C 4DUYC 4LF7C 4D4IA 1T5HX 4RLFA 3R9WA 4GXQA 1N2FA 2QVYX 3A9UA 3CQ3A 3IMLA 3IEVA 3RG2A 1PU1A 4ZJZA 4LE5A 3B7WA 2D1SA 4K0KC 1MXCA 4IR7A 5GTDA 4DCVA 5E7QA 4B3TC 5CZXA 3NPDA 2Y27A 2Y4OA 4G37A 1ZB9A 3R9XA 1GPMA 3I08A 1N36C 2MMAB 3LGXA 1MXBA 4RVOA 5K8FA 4PROC 3FCCA 4X62C 2WD9A 2UUAC 4OYCA 4JI8C 5A19A 4DCSA 5LCIA 3PBKA 4MH4A 3EERA 5ADZA 4KTVA 4B3RC 4LF8C 1T5DX 5AE2A 4L2ZA 2VQFC 2CU6A 1HNXC 3G7SA 3GR1A 4X66C 3NYRA 2BH1X 2VSQA 4LF9C 1XRBA 3O2EA 1HH2P 2Z51A 4X65C 2MCQA 4TPSB 4BCAA 2DYJA 4YY3C 2E5LC 2NCLA 4WS9A 4L7IA 1WCJA 4G36A 2HJGA 1QM4A 1UKKA 4DG8A 2Y4NA 4DCTA 4DV4C 3NI2A 2HHHC 1N32C 1P4EC 3I07A 4JYAC 2DHMA 2KZFA 5CZVA 5A2QD 5LMNC 4BBYA 2YWBA 3LNVA 3TDEA 4DR2C 5IFIA 4RMNA 1RY2A 2VQEC 3J80D 2UUBC 3TUFA 5DV9A 3T1YC 1NYEA 4LFCC 1XNRC 4JI0C 4DG9A 4DV2C 4OXIA 1USPB 3JAMD 4YHHC 2OBVA 3A25A 3TR3A 3AF6A 1XS3A 3C5EA 3GR0A 3E7XA 2ZZMA 4BC7A 3CW8X 1PG4A 2ASBA 4ZLPA 4PUHA 4DR4C 1LCIA 1J5EC 2MM9A 3SO4A 4LF5C 4DV7C 1PG3A 5AE3A 5BR8C 1IBLC 1YJ7A 4GKJC 1P4EA 1HR0C 4HPVA 2UXCC 4L4QA 5BSMA 4RM3A 5BSTA 1FJGC 1MDBA 2F4VC 5BSWA 4DR3C 4D57A 1RG9A 4B3MC 4ODJA 4AQYC 3CJEA 3GPCA 4D56A 3UEBA 2P2FA 2UXDC 3EQ6A 5T8SA 2OPLB 4DR1C 4GKKC 2QL8A 2P02A 1PA4A
chains in the Genus database with same CATH topology
2CXCA 4G1IA 3RV2A 1MDFA 2AYAA 2BJOA 3A9VA 1O92A 2E8CA 4FUTA 2UXBC 4LFAC 1ZB8A 2UU9C 3AF5A 3DAYA 2WP0C 2D1RA 4D4GA 5A1GA 4KTTA 3VNSA 4PZPA 4PHTA 4JI6C 3DLPX 4DV5C 4DV1C 3ETOA 2D7VA 3UZ0A 2P20A 3IEUA 2QVZX 4KHPC 4NDNA 3L95X 1MKYA 2D27A 5LMUC 4LF6C 2CY1A 1VLAA 3GKUA 3PROC 1JOSA 4NXNC 1HNZC 3J81D 1N33C 2YCBA 3N2QA 3FCEA 1O93A 3VNRA 4GXRA 2OO4A 2ATWA 2P2QA 1I94C 5BSUA 5H9UA 4RLQA 4DR6C 3LUSA 1KKGA 4R1MA 1XMQC 1O90A 5JRHA 1WH9A 5BUQA 2DPLA 1K0RA 5A1IA 4BSZA 5IT9D 5FLXD 1IBMC 1ULTA 3VNQA 2QVXX 4JI3C 5KYVA 1IBKC 3H2TA 3IPLA 2XR1A 4K0BA 1ML8A 1N34C 3N54B 1L2FA 2QW0X 4JI5C 4R1LA 1XNQC 2PROA 4JI2C 4FTFA 2E8FA 4LFBC 3S82A 4B3SC 4MTNA 4JI4C 4ISBA 1USPA 2V7BA 4X64C 1V25A 1MXAA 2E7GA 3LAXA 4I9FA 4U5YD 4JI1C 1V26A 3ETCA 2P2MA 3OTOC 1O9TA 4XX2A 3CW9A 1XRAA 5K85A 1WF3A 1MD9A 4DV0C 4JV5C 3R44A 4GS5A 1BA3A 5BURA 3PESA 2UUCC 5KEIA 4DV6C 5IWAC 1P7LA 3UOWA 4DR5C 4RVNA 2P2BA 4RM2A 2EGTA 2JMPA 2ZM6C 1XRCA 1AMUA 3T1HC 2D28C 3KXWA 4NOZA 5T8TA 2E0GA 2E8EA 1LQLA 4I9GA 4IZ6A 3NYQA 2D1QA 2ONFA 3L8CA 1FUGA 4DR7C 1XMOC 3TQIA 4DV3C 4FUQA 2P2JA 2D1TA 5BSVA 2VZEA 5KYTA 3A4IA 1HNWC 3DHVA 2OPLA 2YWCA 4LF4C 4NXMC 1EGAA 4R0MA 4OX9C 2PN2A 4DUZC 5AE1A 4WV3A 4JM1A 4EATA 4BC9A 1QWIA 4DCUA 3E7WA 5BSRA 2PT7G 5BUSA 4JI7C 4DUYC 4LF7C 4D4IA 1T5HX 4RLFA 3R9WA 4GXQA 1N2FA 2QVYX 3A9UA 3IMLA 3IEVA 3RG2A 4ZJZA 4LE5A 3B7WA 2D1SA 4K0KC 1MXCA 4IR7A 5GTDA 4DCVA 5E7QA 4B3TC 5CZXA 3NPDA 2Y27A 2Y4OA 4G37A 1ZB9A 3R9XA 1GPMA 3I08A 1N36C 3LGXA 1MXBA 4RVOA 5K8FA 4PROC 3FCCA 4X62C 2WD9A 2UUAC 4OYCA 4JI8C 5A19A 4DCSA 3PBKA 4MH4A 3EERA 5ADZA 4KTVA 4B3RC 4LF8C 1T5DX 5AE2A 4L2ZA 2VQFC 1HNXC 3G7SA 3GR1A 4X66C 3NYRA 2BH1X 2VSQA 4LF9C 1XRBA 1HH2P 4X65C 4TPSB 4BCAA 2DYJA 4YY3C 2E5LC 4WS9A 4L7IA 4G36A 2HJGA 1QM4A 1UKKA 4DG8A 2Y4NA 4DCTA 4DV4C 3NI2A 2HHHC 1N32C 3I07A 4JYAC 2KZFA 5CZVA 5A2QD 5LMNC 4BBYA 2YWBA 3LNVA 3TDEA 4DR2C 5IFIA 4RMNA 1RY2A 2VQEC 3J80D 2UUBC 3TUFA 5DV9A 3T1YC 1NYEA 4LFCC 1XNRC 4JI0C 4DG9A 4DV2C 4OXIA 1USPB 3JAMD 4YHHC 2OBVA 3AF6A 3C5EA 3GR0A 3E7XA 4BC7A 3CW8X 1PG4A 2ASBA 4ZLPA 4DR4C 1LCIA 1J5EC 3SO4A 4LF5C 4DV7C 1PG3A 5AE3A 5BR8C 1IBLC 1YJ7A 4GKJC 1HR0C 4HPVA 2UXCC 4L4QA 5BSMA 4RM3A 5BSTA 1FJGC 1MDBA 2F4VC 5BSWA 4DR3C 4D57A 1RG9A 4B3MC 4ODJA 4AQYC 3CJEA 3GPCA 4D56A 2P2FA 2UXDC 3EQ6A 5T8SA 2OPLB 4DR1C 4GKKC 2QL8A 2P02A 1PA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CXC A;  5A2Q D;  1L2F A;  1QWI A;  5LMN C;  2BJO A;  4DCU A;  2E8C A;  2PT7 G;  4DR2 C;  2VQE C;  4JI7 C;  3J80 D;  2UXB C;  4JI5 C;  1ZB8 A;  4LFA C;  4DUY C;  1XNQ C;  2UUB C;  4LF7 C;  2UU9 C;  3AF5 A;  4JI2 C;  3T1Y C;  2E8F A;  1NYE A;  4LFB C;  3R9W A;  1N2F A;  4B3S C;  4LFC C;  3IEV A;  4MTN A;  4JI4 C;  1XNR C;  4JI0 C;  1USP A;  4X64 C;  4DV2 C;  4K0K C;  4JI6 C;  1USP B;  2E7G A;  3JAM D;  4YHH C;  4DV5 C;  4DV1 C;  4JI1 C;  3AF6 A;  4DCV A;  4B3T C;  3OTO C;  4XX2 A;  2D7V A;  1WF3 A;  3IEU A;  2ASB A;  1ZB9 A;  4DV0 C;  4KHP C;  4JV5 C;  4DR4 C;  3R9X A;  1N36 C;  1MKY A;  2UUC C;  5LMU C;  1J5E C;  4LF6 C;  4LF5 C;  4DV6 C;  5IWA C;  4DV7 C;  2CY1 A;  1VLA A;  1N34 C;  5BR8 C;  1IBL C;  4DR5 C;  3GKU A;  4X62 C;  1JOS A;  4NXN C;  2UUA C;  4GKJ C;  1HNZ C;  3J81 D;  1N33 C;  2EGT A;  4JI8 C;  1HR0 C;  2JMP A;  2YCB A;  4DCS A;  4MH4 A;  2ZM6 C;  2UXC C;  3EER A;  3T1H C;  4NOZ A;  1FJG C;  4B3R C;  4LF8 C;  2E8E A;  1LQL A;  2F4V C;  2ATW A;  4DR3 C;  2ONF A;  2VQF C;  1I94 C;  4DR7 C;  1XMO C;  1HNX C;  4DR6 C;  4X66 C;  4DV3 C;  3LUS A;  4LF9 C;  4B3M C;  1KKG A;  1HH2 P;  1XMQ C;  4AQY C;  4X65 C;  3CJE A;  1WH9 A;  1K0R A;  2DYJ A;  4YY3 C;  2E5L C;  4BSZ A;  5IT9 D;  1HNW C;  2UXD C;  2OPL A;  5FLX D;  1IBM C;  4LF4 C;  4NXM C;  1EGA A;  2HJG A;  2OPL B;  1UKK A;  2KZF A;  4DR1 C;  4JI3 C;  4DCT A;  1IBK C;  4DV4 C;  2HHH C;  4GKK C;  4OX9 C;  2PN2 A;  4DUZ C;  1N32 C;  3I07 A;  4JYA C;  2XR1 A;  1ML8 A;  2QL8 A;  1PA4 A; 
#chains in the Genus database with same CATH topology
 2CXC A;  4G1I A;  3RV2 A;  1MDF A;  2AYA A;  2BJO A;  3A9V A;  1O92 A;  2E8C A;  4FUT A;  2UXB C;  4LFA C;  1ZB8 A;  1TH5 A;  2M5H A;  2UU9 C;  3AF5 A;  3DAY A;  2WP0 C;  2D1R A;  4D4G A;  5A1G A;  4KTT A;  3VNS A;  4PZP A;  4PHT A;  4JI6 C;  3DLP X;  4DV5 C;  4DV1 C;  3ETO A;  2D7V A;  3UZ0 A;  2P20 A;  3IEU A;  2QVZ X;  4PUI A;  4KHP C;  4NDN A;  1FLO A;  3L95 X;  1MKY A;  2D27 A;  5LMU C;  4LF6 C;  2CY1 A;  1NY8 A;  1VLA A;  1UWD A;  3GKU A;  3PRO C;  1JOS A;  4NXN C;  1HNZ C;  3J81 D;  1N33 C;  3UX2 A;  2YCB A;  1IB8 A;  3N2Q A;  3FCE A;  1O93 A;  3VNR A;  4GXR A;  2OO4 A;  2ATW A;  2P2Q A;  3K6R A;  1M6X C;  1I94 C;  5BSU A;  5H9U A;  4RLQ A;  4DR6 C;  3LUS A;  1KKG A;  4R1M A;  1XMQ C;  1O90 A;  5JRH A;  1WH9 A;  5BUQ A;  2DPL A;  1K0R A;  5A1I A;  4BSZ A;  5IT9 D;  2ZZN A;  3UX3 A;  5FLX D;  1IBM C;  2JNV A;  1ULT A;  3VNQ A;  2QVX X;  4JI3 C;  5KYV A;  1IBK C;  3H2T A;  2YX1 A;  3IPL A;  2XR1 A;  4K0B A;  1ML8 A;  1N34 C;  3N54 B;  1L2F A;  2QW0 X;  4JI5 C;  4R1L A;  1XNQ C;  2PRO A;  4JI2 C;  4FTF A;  2E8F A;  2M5O A;  4LFB C;  3S82 A;  4B3S C;  4MTN A;  4JI4 C;  1V60 A;  4ISB A;  1USP A;  2V7B A;  4X64 C;  1V25 A;  1MXA A;  2E7G A;  3LAX A;  1M6X A;  4I9F A;  4U5Y D;  4JI1 C;  1V26 A;  3ETC A;  2P2M A;  3OTO C;  3AY0 A;  1O9T A;  4XX2 A;  3CW9 A;  1XRA A;  5K85 A;  1WF3 A;  1MD9 A;  4DV0 C;  4JV5 C;  3R44 A;  4GS5 A;  1BA3 A;  5BUR A;  3PES A;  2UUC C;  5KEI A;  4DV6 C;  5IWA C;  1P7L A;  3UOW A;  4DR5 C;  4RVN A;  2P2B A;  3CQ2 A;  4RM2 A;  2EGT A;  2JMP A;  2ZM6 C;  1XRC A;  1AMU A;  2D28 C;  3KXW A;  4NOZ A;  3T1H C;  5T8T A;  2E0G A;  2E8E A;  1LQL A;  4I9G A;  4IZ6 A;  3NYQ A;  2D1Q A;  2ONF A;  2KZ0 A;  3L8C A;  1FUG A;  4PUG A;  4DR7 C;  1XMO C;  3TQI A;  4DV3 C;  4FUQ A;  2P2J A;  2KDN A;  2D1T A;  3CQ1 A;  5BSV A;  2VZE A;  5KYT A;  3A4I A;  1HNW C;  3DHV A;  2OPL A;  2YWC A;  3A26 A;  4LF4 C;  1XHJ A;  4NXM C;  1EGA A;  4R0M A;  1VEH A;  4OX9 C;  2PN2 A;  4DUZ C;  5AE1 A;  4WV3 A;  4JM1 A;  4EAT A;  3LNO A;  4BC9 A;  1QWI A;  4DCU A;  3E7W A;  5BSR A;  2PT7 G;  5BUS A;  4JI7 C;  4DUY C;  4LF7 C;  4D4I A;  1T5H X;  4RLF A;  3R9W A;  4GXQ A;  1N2F A;  2QVY X;  3A9U A;  3CQ3 A;  3IML A;  3IEV A;  3RG2 A;  1PU1 A;  4ZJZ A;  4LE5 A;  3B7W A;  2D1S A;  4K0K C;  1MXC A;  4IR7 A;  5GTD A;  4DCV A;  5E7Q A;  4B3T C;  5CZX A;  3NPD A;  2Y27 A;  2Y4O A;  4G37 A;  1ZB9 A;  3R9X A;  1GPM A;  3I08 A;  1N36 C;  2MMA B;  3LGX A;  1MXB A;  4RVO A;  5K8F A;  4PRO C;  3FCC A;  4X62 C;  2WD9 A;  2UUA C;  4OYC A;  4JI8 C;  5A19 A;  4DCS A;  5LCI A;  3PBK A;  4MH4 A;  3EER A;  5ADZ A;  4KTV A;  4B3R C;  4LF8 C;  1T5D X;  5AE2 A;  4L2Z A;  2VQF C;  2CU6 A;  1HNX C;  3G7S A;  3GR1 A;  4X66 C;  3NYR A;  2BH1 X;  2VSQ A;  4LF9 C;  1XRB A;  3O2E A;  1HH2 P;  2Z51 A;  4X65 C;  2MCQ A;  4TPS B;  4BCA A;  2DYJ A;  4YY3 C;  2E5L C;  2NCL A;  4WS9 A;  4L7I A;  1WCJ A;  4G36 A;  2HJG A;  1QM4 A;  1UKK A;  4DG8 A;  2Y4N A;  4DCT A;  4DV4 C;  3NI2 A;  2HHH C;  1N32 C;  1P4E C;  3I07 A;  4JYA C;  2DHM A;  2KZF A;  5CZV A;  5A2Q D;  5LMN C;  4BBY A;  2YWB A;  3LNV A;  3TDE A;  4DR2 C;  5IFI A;  4RMN A;  1RY2 A;  2VQE C;  3J80 D;  2UUB C;  3TUF A;  5DV9 A;  3T1Y C;  1NYE A;  4LFC C;  1XNR C;  4JI0 C;  4DG9 A;  4DV2 C;  4OXI A;  1USP B;  3JAM D;  4YHH C;  2OBV A;  3A25 A;  3TR3 A;  3AF6 A;  1XS3 A;  3C5E A;  3GR0 A;  3E7X A;  2ZZM A;  4BC7 A;  3CW8 X;  1PG4 A;  2ASB A;  4ZLP A;  4PUH A;  4DR4 C;  1LCI A;  1J5E C;  2MM9 A;  3SO4 A;  4LF5 C;  4DV7 C;  1PG3 A;  5AE3 A;  5BR8 C;  1IBL C;  1YJ7 A;  4GKJ C;  1P4E A;  1HR0 C;  4HPV A;  2UXC C;  4L4Q A;  5BSM A;  4RM3 A;  5BST A;  1FJG C;  1MDB A;  2F4V C;  5BSW A;  4DR3 C;  4D57 A;  1RG9 A;  4B3M C;  4ODJ A;  4AQY C;  3CJE A;  3GPC A;  4D56 A;  3UEB A;  2P2F A;  2UXD C;  3EQ6 A;  5T8S A;  2OPL B;  4DR1 C;  4GKK C;  2QL8 A;  2P02 A;  1PA4 A; 
#chains in the Genus database with same CATH homology
 2CXC A;  4G1I A;  3RV2 A;  1MDF A;  2AYA A;  2BJO A;  3A9V A;  1O92 A;  2E8C A;  4FUT A;  2UXB C;  4LFA C;  1ZB8 A;  2UU9 C;  3AF5 A;  3DAY A;  2WP0 C;  2D1R A;  4D4G A;  5A1G A;  4KTT A;  3VNS A;  4PZP A;  4PHT A;  4JI6 C;  3DLP X;  4DV5 C;  4DV1 C;  3ETO A;  2D7V A;  3UZ0 A;  2P20 A;  3IEU A;  2QVZ X;  4KHP C;  4NDN A;  3L95 X;  1MKY A;  2D27 A;  5LMU C;  4LF6 C;  2CY1 A;  1VLA A;  3GKU A;  3PRO C;  1JOS A;  4NXN C;  1HNZ C;  3J81 D;  1N33 C;  2YCB A;  3N2Q A;  3FCE A;  1O93 A;  3VNR A;  4GXR A;  2OO4 A;  2ATW A;  2P2Q A;  1I94 C;  5BSU A;  5H9U A;  4RLQ A;  4DR6 C;  3LUS A;  1KKG A;  4R1M A;  1XMQ C;  1O90 A;  5JRH A;  1WH9 A;  5BUQ A;  2DPL A;  1K0R A;  5A1I A;  4BSZ A;  5IT9 D;  5FLX D;  1IBM C;  1ULT A;  3VNQ A;  2QVX X;  4JI3 C;  5KYV A;  1IBK C;  3H2T A;  3IPL A;  2XR1 A;  4K0B A;  1ML8 A;  1N34 C;  3N54 B;  1L2F A;  2QW0 X;  4JI5 C;  4R1L A;  1XNQ C;  2PRO A;  4JI2 C;  4FTF A;  2E8F A;  4LFB C;  3S82 A;  4B3S C;  4MTN A;  4JI4 C;  4ISB A;  1USP A;  2V7B A;  4X64 C;  1V25 A;  1MXA A;  2E7G A;  3LAX A;  4I9F A;  4U5Y D;  4JI1 C;  1V26 A;  3ETC A;  2P2M A;  3OTO C;  1O9T A;  4XX2 A;  3CW9 A;  1XRA A;  5K85 A;  1WF3 A;  1MD9 A;  4DV0 C;  4JV5 C;  3R44 A;  4GS5 A;  1BA3 A;  5BUR A;  3PES A;  2UUC C;  5KEI A;  4DV6 C;  5IWA C;  1P7L A;  3UOW A;  4DR5 C;  4RVN A;  2P2B A;  4RM2 A;  2EGT A;  2JMP A;  2ZM6 C;  1XRC A;  1AMU A;  3T1H C;  2D28 C;  3KXW A;  4NOZ A;  5T8T A;  2E0G A;  2E8E A;  1LQL A;  4I9G A;  4IZ6 A;  3NYQ A;  2D1Q A;  2ONF A;  3L8C A;  1FUG A;  4DR7 C;  1XMO C;  3TQI A;  4DV3 C;  4FUQ A;  2P2J A;  2D1T A;  5BSV A;  2VZE A;  5KYT A;  3A4I A;  1HNW C;  3DHV A;  2OPL A;  2YWC A;  4LF4 C;  4NXM C;  1EGA A;  4R0M A;  4OX9 C;  2PN2 A;  4DUZ C;  5AE1 A;  4WV3 A;  4JM1 A;  4EAT A;  4BC9 A;  1QWI A;  4DCU A;  3E7W A;  5BSR A;  2PT7 G;  5BUS A;  4JI7 C;  4DUY C;  4LF7 C;  4D4I A;  1T5H X;  4RLF A;  3R9W A;  4GXQ A;  1N2F A;  2QVY X;  3A9U A;  3IML A;  3IEV A;  3RG2 A;  4ZJZ A;  4LE5 A;  3B7W A;  2D1S A;  4K0K C;  1MXC A;  4IR7 A;  5GTD A;  4DCV A;  5E7Q A;  4B3T C;  5CZX A;  3NPD A;  2Y27 A;  2Y4O A;  4G37 A;  1ZB9 A;  3R9X A;  1GPM A;  3I08 A;  1N36 C;  3LGX A;  1MXB A;  4RVO A;  5K8F A;  4PRO C;  3FCC A;  4X62 C;  2WD9 A;  2UUA C;  4OYC A;  4JI8 C;  5A19 A;  4DCS A;  3PBK A;  4MH4 A;  3EER A;  5ADZ A;  4KTV A;  4B3R C;  4LF8 C;  1T5D X;  5AE2 A;  4L2Z A;  2VQF C;  1HNX C;  3G7S A;  3GR1 A;  4X66 C;  3NYR A;  2BH1 X;  2VSQ A;  4LF9 C;  1XRB A;  1HH2 P;  4X65 C;  4TPS B;  4BCA A;  2DYJ A;  4YY3 C;  2E5L C;  4WS9 A;  4L7I A;  4G36 A;  2HJG A;  1QM4 A;  1UKK A;  4DG8 A;  2Y4N A;  4DCT A;  4DV4 C;  3NI2 A;  2HHH C;  1N32 C;  3I07 A;  4JYA C;  2KZF A;  5CZV A;  5A2Q D;  5LMN C;  4BBY A;  2YWB A;  3LNV A;  3TDE A;  4DR2 C;  5IFI A;  4RMN A;  1RY2 A;  2VQE C;  3J80 D;  2UUB C;  3TUF A;  5DV9 A;  3T1Y C;  1NYE A;  4LFC C;  1XNR C;  4JI0 C;  4DG9 A;  4DV2 C;  4OXI A;  1USP B;  3JAM D;  4YHH C;  2OBV A;  3AF6 A;  3C5E A;  3GR0 A;  3E7X A;  4BC7 A;  3CW8 X;  1PG4 A;  2ASB A;  4ZLP A;  4DR4 C;  1LCI A;  1J5E C;  3SO4 A;  4LF5 C;  4DV7 C;  1PG3 A;  5AE3 A;  5BR8 C;  1IBL C;  1YJ7 A;  4GKJ C;  1HR0 C;  4HPV A;  2UXC C;  4L4Q A;  5BSM A;  4RM3 A;  5BST A;  1FJG C;  1MDB A;  2F4V C;  5BSW A;  4DR3 C;  4D57 A;  1RG9 A;  4B3M C;  4ODJ A;  4AQY C;  3CJE A;  3GPC A;  4D56 A;  2P2F A;  2UXD C;  3EQ6 A;  5T8S A;  2OPL B;  4DR1 C;  4GKK C;  2QL8 A;  2P02 A;  1PA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...