2E8CA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
b'MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Aq_1549
publication title Crystal structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8cA00
2UUBC 3IEVA 1KKGA 2EGTA 2F4VC 1HNWC 3LUSA 4LF5C 1L2FA 1XNQC 4OX9C 4AQYC 4JYAC 3AF5A 1N36C 2E8FA 2HJGA 2UXBC 3T1YC 4X62C 4DV0C 4B3SC 4LF7C 2PN2A 5LMUC 4DV5C 1VLAA 1FJGC 4JI2C 5IT9D 3GKUA 4JI5C 1HNZC 1N32C 3T1HC 4JI4C 4JV5C 1LQLA 1HNXC 4DV7C 2E5LC 2UUAC 4NOZA 5A2QD 1JOSA 5IWAC 4JI7C 2XR1A 1I94C 1PA4A 4LFAC 1ZB9A 4YHHC 3OTOC 2ASBA 1N33C 2D7VA 4JI3C 3R9XA 4XX2A 4GKJC 1IBLC 4MH4A 1HH2P 4X66C 4DUZC 1NYEA 2KZFA 2VQEC 2UXCC 4LFBC 1WF3A 2E8EA 3R9WA 4DR1C 4DR6C 4YY3C 4DV1C 3J81D 1XNRC 1K0RA 4JI0C 4X64C 5LMNC 1QWIA 2UUCC 4DR4C 2HHHC 4B3RC 4DR5C 1MKYA 4LF6C 4DV6C 4DR2C 3EERA 2CY1A 4K0KC 4DR3C 1N34C 4B3TC 2UXDC 1IBMC 4JI8C 4DCUA 3IEUA 2DYJA 2VQFC 4KHPC 3I07A 1USPB 4DCVA 1IBKC 1ZB8A 2OPLA 3JAMD 1XMOC 3AF6A 2OPLB 1WH9A 4DV3C 2JMPA 4LF9C 2BJOA 1XMQC 2ATWA 1ML8A 4JI1C 4LF4C 2ZM6C 4DUYC 4B3MC 1EGAA 4BSZA 2E8CA 4NXNC 4LFCC 2E7GA 2QL8A 4DCTA 3J80D 2PT7G 1UKKA 1N2FA 1HR0C 4X65C 2UU9C 5BR8C 4DCSA 4DV4C 4LF8C 4GKKC 2CXCA 5FLXD 2YCBA 3CJEA 4DV2C 1USPA 4NXMC 4MTNA 1J5EC 4DR7C 4JI6C 2ONFA
chains in the Genus database with same CATH superfamily
3GR0A 3RV2A 1KKGA 2EGTA 1RY2A 3FCEA 1GPMA 4LF5C 2P2MA 4RLQA 1XNQC 3AF5A 1N36C 1PG3A 5A1IA 1MXBA 4LF7C 4B3SC 1MDFA 2PN2A 1PU1A 5A1GA 4DV5C 3IMLA 4U5YD 2YX1A 4DV7C 1O90A 4KTTA 3I08A 5CZVA 1JOSA 4L4QA 3LNOA 2VSQA 4JM1A 1ZB9A 1QM4A 4YHHC 3IPLA 1MXAA 2QW0X 4JI3C 4GKJC 4X66C 4MH4A 2DHMA 4DUZC 1TH5A 3ETCA 4DR6C 4YY3C 4PROC 3J81D 1QWIA 4B3RC 4BC9A 3G7SA 5AE2A 2D1SA 3EERA 2CY1A 3NYRA 4K0KC 3FCCA 4HPVA 3IEUA 4DCUA 2P20A 4ODJA 2OPLA 3JAMD 2ATWA 2P2BA 4PUGA 3TQIA 3AY0A 4FUTA 2QVXX 4DUYC 4B3MC 5JRHA 2E8CA 2BH1X 1N2FA 4IZ6A 3VNQA 4DCSA 5BSWA 2CXCA 4IR7A 3PESA 4DV2C 3DLPX 4MTNA 2P2QA 4JI6C 2ONFA 3CW8X 2UUBC 3IEVA 1HNWC 5BUSA 3LUSA 3TDEA 4AQYC 3L95X 1BA3A 3UZ0A 2NCLA 3T1YC 1XRBA 3KXWA 3SO4A 4BC7A 5BSMA 5LMUC 2WD9A 5IT9D 4OYCA 1MXCA 4FTFA 5BSTA 4JI4C 4RVNA 5IFIA 2E5LC 5A2QD 1PA4A 4LFAC 5E7QA 3CW9A 3OTOC 2ASBA 1N33C 4ZLPA 5T8TA 1P4EC 1HH2P 3ETOA 3K6RA 2Y4OA 5KYTA 1NYEA 2UXCC 1M6XC 1XRAA 3TR3A 3S82A 3R9WA 5A19A 1XNRC 1K0RA 4X64C 5LMNC 1V26A 4DR4C 5BUQA 2D28C 1FUGA 3NPDA 4DV6C 1IB8A 5K8FA 4GXQA 4WS9A 4DR3C 2MMAB 4PUHA 2UXDC 2ZZMA 1NY8A 4JI8C 2M5HA 4RLFA 1XMOC 2JNVA 2OPLB 4K0BA 5BSUA 1MD9A 1XRCA 1YJ7A 4JI1C 3H2TA 2ZM6C 5H9UA 1V60A 3R44A 2PROA 1O92A 4BSZA 2E7GA 4GS5A 1HR0C 4G37A 1FLOA 5BR8C 4LF8C 4WV3A 4GKKC 2VZEA 3A25A 3UEBA 2P02A 4ZJZA 2WP0C 3VNRA 1AMUA 4GXRA 2AYAA 1O9TA 4OX9C 5GTDA 2E8FA 2HJGA 4R1MA 4X62C 2CU6A 3TUFA 2P2JA 3VNSA 2D1TA 4RM3A 4L2ZA 4JI2C 3GKUA 4JI5C 1N32C 4JV5C 1LQLA 1ULTA 2XR1A 3GR1A 1I94C 1RG9A 4DG9A 2QVYX 5BSRA 5BSVA 3E7XA 5LCIA 4XX2A 4NDNA 3LAXA 2KZFA 1UWDA 1PG4A 4LFBC 2E8EA 4DR1C 5KYVA 1O93A 4JI0C 2E0GA 4PUIA 2KZ0A 4LF6C 1XS3A 3A26A 4KTVA 4DR2C 4EATA 4B3TC 4R0MA 5CZXA 1P4EA 4DG8A 3UX3A 4KHPC 1M6XA 2M5OA 3I07A 1USPB 2D27A 2YWBA 3LGXA 1IBKC 1ZB8A 3CQ1A 4D56A 4DV3C 4LF9C 3NYQA 1ML8A 5KEIA 2DPLA 2P2FA 4X65C 3PBKA 1VEHA 2MCQA 5FLXD 4G36A 4DR7C 1USPA 1J5EC 4TPSB 2OBVA 2ZZNA 5T8SA 2F4VC 3EQ6A 1XHJA 1L2FA 3DHVA 4JYAC 3UOWA 4ISBA 2UXBC 4RM2A 4DV0C 2MM9A 1T5DX 4I9GA 1FJGC 1VLAA 3CQ2A 3LNVA 2D1QA 4OXIA 1HNZC 5AE1A 3T1HC 1HNXC 2UUAC 2OO4A 4NOZA 1T5HX 5IWAC 4JI7C 2Y27A 5K85A 4D4GA 3A4IA 3NI2A 1MDBA 5BURA 3C5EA 2D7VA 2Z51A 3A9UA 4G1IA 3R9XA 1IBLC 4R1LA 4FUQA 3N2QA 4RMNA 2VQEC 1WF3A 3RG2A 4DV1C 1LCIA 2UUCC 2HHHC 4DR5C 1MKYA 2YWCA 4BBYA 4PHTA 2D1RA 2KDNA 3GPCA 3N54B 3UX2A 1N34C 1IBMC 2V7BA 4I9FA 1WCJA 2DYJA 3E7WA 4LE5A 5AE3A 2VQFC 4BCAA 4DCVA 5ADZA 3DAYA 3CQ3A 4RVOA 3B7WA 3AF6A 4D57A 1WH9A 2Y4NA 2JMPA 2BJOA 1XMQC 4LF4C 1P7LA 5DV9A 4D4IA 3O2EA 1V25A 1EGAA 4NXNC 4LFCC 3A9VA 4DCTA 2QL8A 3J80D 2PT7G 1UKKA 3L8CA 2UU9C 4DV4C 3PROC 2YCBA 3CJEA 4L7IA 4NXMC 2QVZX 4PZPA
chains in the Genus database with same CATH topology
3GR0A 3RV2A 1KKGA 2EGTA 1RY2A 3FCEA 1GPMA 4LF5C 2P2MA 4RLQA 1XNQC 3AF5A 1N36C 1PG3A 5A1IA 1MXBA 4LF7C 4B3SC 1MDFA 2PN2A 5A1GA 4DV5C 3IMLA 4U5YD 4DV7C 1O90A 4KTTA 3I08A 5CZVA 1JOSA 4L4QA 2VSQA 4JM1A 1ZB9A 1QM4A 4YHHC 3IPLA 1MXAA 2QW0X 4JI3C 4GKJC 4X66C 4MH4A 4DUZC 3ETCA 4DR6C 4YY3C 4PROC 3J81D 1QWIA 4B3RC 4BC9A 3G7SA 5AE2A 2D1SA 3EERA 2CY1A 3NYRA 4K0KC 3FCCA 4HPVA 3IEUA 4DCUA 2P20A 4ODJA 2OPLA 3JAMD 2ATWA 2P2BA 3TQIA 4FUTA 2QVXX 4DUYC 4B3MC 5JRHA 2E8CA 2BH1X 1N2FA 4IZ6A 3VNQA 4DCSA 5BSWA 2CXCA 4IR7A 3PESA 4DV2C 3DLPX 4MTNA 2P2QA 4JI6C 2ONFA 3CW8X 2UUBC 3IEVA 1HNWC 5BUSA 3LUSA 3TDEA 4AQYC 3L95X 1BA3A 3UZ0A 3T1YC 1XRBA 3KXWA 3SO4A 4BC7A 5BSMA 5LMUC 2WD9A 5IT9D 4OYCA 1MXCA 4FTFA 5BSTA 4JI4C 4RVNA 5IFIA 2E5LC 5A2QD 1PA4A 4LFAC 5E7QA 3CW9A 3OTOC 2ASBA 1N33C 4ZLPA 5T8TA 1HH2P 3ETOA 2Y4OA 5KYTA 1NYEA 2UXCC 1XRAA 3R9WA 3S82A 5A19A 1XNRC 1K0RA 4X64C 5LMNC 1V26A 4DR4C 5BUQA 2D28C 1FUGA 3NPDA 4DV6C 5K8FA 4GXQA 4WS9A 4DR3C 2UXDC 4JI8C 4RLFA 1XMOC 2OPLB 4K0BA 5BSUA 1MD9A 1XRCA 1YJ7A 4JI1C 3H2TA 2ZM6C 5H9UA 3R44A 2PROA 1O92A 4BSZA 2E7GA 4GS5A 1HR0C 4G37A 5BR8C 4LF8C 4WV3A 4GKKC 2VZEA 2P02A 4ZJZA 2WP0C 3VNRA 1AMUA 4GXRA 2AYAA 1O9TA 4OX9C 5GTDA 2E8FA 2HJGA 4R1MA 4X62C 3TUFA 2P2JA 3VNSA 2D1TA 4RM3A 4L2ZA 4JI2C 3GKUA 4JI5C 1N32C 4JV5C 1LQLA 1ULTA 2XR1A 3GR1A 1I94C 1RG9A 4DG9A 2QVYX 5BSRA 5BSVA 3E7XA 4XX2A 4NDNA 3LAXA 2KZFA 1PG4A 4LFBC 2E8EA 4DR1C 5KYVA 1O93A 4JI0C 2E0GA 4LF6C 4KTVA 4DR2C 4EATA 4B3TC 4R0MA 5CZXA 4DG8A 4KHPC 3I07A 1USPB 2D27A 2YWBA 3LGXA 1IBKC 1ZB8A 4D56A 4DV3C 4LF9C 3NYQA 1ML8A 5KEIA 2DPLA 2P2FA 4X65C 3PBKA 5FLXD 4G36A 4DR7C 1USPA 1J5EC 4TPSB 2OBVA 5T8SA 2F4VC 3EQ6A 1L2FA 3DHVA 4JYAC 3UOWA 4ISBA 2UXBC 4RM2A 4DV0C 1T5DX 4I9GA 1FJGC 1VLAA 3LNVA 2D1QA 4OXIA 1HNZC 5AE1A 3T1HC 1HNXC 2UUAC 2OO4A 4NOZA 1T5HX 5IWAC 4JI7C 2Y27A 5K85A 4D4GA 3A4IA 3NI2A 1MDBA 5BURA 3C5EA 2D7VA 3A9UA 4G1IA 3R9XA 1IBLC 4R1LA 4FUQA 3N2QA 4RMNA 2VQEC 1WF3A 3RG2A 4DV1C 1LCIA 2UUCC 2HHHC 4DR5C 1MKYA 2YWCA 4BBYA 4PHTA 2D1RA 3GPCA 3N54B 1N34C 1IBMC 2V7BA 4I9FA 2DYJA 3E7WA 4LE5A 5AE3A 2VQFC 4BCAA 4DCVA 5ADZA 3DAYA 4RVOA 3B7WA 3AF6A 4D57A 1WH9A 2Y4NA 2JMPA 2BJOA 1XMQC 4LF4C 1P7LA 5DV9A 4D4IA 1V25A 1EGAA 4NXNC 4LFCC 3A9VA 4DCTA 2QL8A 3J80D 2PT7G 1UKKA 3L8CA 2UU9C 4DV4C 3PROC 2YCBA 3CJEA 4L7IA 4NXMC 2QVZX 4PZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB C;  3IEV A;  1KKG A;  2EGT A;  2F4V C;  1HNW C;  3LUS A;  4LF5 C;  1L2F A;  1XNQ C;  4OX9 C;  4AQY C;  4JYA C;  3AF5 A;  1N36 C;  2E8F A;  2HJG A;  2UXB C;  3T1Y C;  4X62 C;  4DV0 C;  4B3S C;  4LF7 C;  2PN2 A;  5LMU C;  4DV5 C;  1VLA A;  1FJG C;  4JI2 C;  5IT9 D;  3GKU A;  4JI5 C;  1HNZ C;  1N32 C;  3T1H C;  4JI4 C;  4JV5 C;  1LQL A;  1HNX C;  4DV7 C;  2E5L C;  2UUA C;  4NOZ A;  5A2Q D;  1JOS A;  5IWA C;  4JI7 C;  2XR1 A;  1I94 C;  1PA4 A;  4LFA C;  1ZB9 A;  4YHH C;  3OTO C;  2ASB A;  1N33 C;  2D7V A;  4JI3 C;  3R9X A;  4XX2 A;  4GKJ C;  1IBL C;  4MH4 A;  1HH2 P;  4X66 C;  4DUZ C;  1NYE A;  2KZF A;  2VQE C;  2UXC C;  4LFB C;  1WF3 A;  2E8E A;  3R9W A;  4DR1 C;  4DR6 C;  4YY3 C;  4DV1 C;  3J81 D;  1XNR C;  1K0R A;  4JI0 C;  4X64 C;  5LMN C;  1QWI A;  2UUC C;  4DR4 C;  2HHH C;  4B3R C;  4DR5 C;  1MKY A;  4LF6 C;  4DV6 C;  4DR2 C;  3EER A;  2CY1 A;  4K0K C;  4DR3 C;  1N34 C;  4B3T C;  2UXD C;  1IBM C;  4JI8 C;  4DCU A;  3IEU A;  2DYJ A;  2VQF C;  4KHP C;  3I07 A;  1USP B;  4DCV A;  1IBK C;  1ZB8 A;  2OPL A;  3JAM D;  1XMO C;  3AF6 A;  2OPL B;  1WH9 A;  4DV3 C;  2JMP A;  4LF9 C;  2BJO A;  1XMQ C;  2ATW A;  1ML8 A;  4JI1 C;  4LF4 C;  2ZM6 C;  4DUY C;  4B3M C;  1EGA A;  4BSZ A;  2E8C A;  4NXN C;  4LFC C;  2E7G A;  2QL8 A;  4DCT A;  3J80 D;  2PT7 G;  1UKK A;  1N2F A;  1HR0 C;  4X65 C;  2UU9 C;  5BR8 C;  4DCS A;  4DV4 C;  4LF8 C;  4GKK C;  2CXC A;  5FLX D;  2YCB A;  3CJE A;  4DV2 C;  1USP A;  4NXM C;  4MTN A;  1J5E C;  4DR7 C;  4JI6 C;  2ONF A; 
#chains in the Genus database with same CATH topology
 3GR0 A;  3RV2 A;  1KKG A;  2EGT A;  1RY2 A;  3FCE A;  1GPM A;  4LF5 C;  2P2M A;  4RLQ A;  1XNQ C;  3AF5 A;  1N36 C;  1PG3 A;  5A1I A;  1MXB A;  4LF7 C;  4B3S C;  1MDF A;  2PN2 A;  1PU1 A;  5A1G A;  4DV5 C;  3IML A;  4U5Y D;  2YX1 A;  4DV7 C;  1O90 A;  4KTT A;  3I08 A;  5CZV A;  1JOS A;  4L4Q A;  3LNO A;  2VSQ A;  4JM1 A;  1ZB9 A;  1QM4 A;  4YHH C;  3IPL A;  1MXA A;  2QW0 X;  4JI3 C;  4GKJ C;  4X66 C;  4MH4 A;  2DHM A;  4DUZ C;  1TH5 A;  3ETC A;  4DR6 C;  4YY3 C;  4PRO C;  3J81 D;  1QWI A;  4B3R C;  4BC9 A;  3G7S A;  5AE2 A;  2D1S A;  3EER A;  2CY1 A;  3NYR A;  4K0K C;  3FCC A;  4HPV A;  3IEU A;  4DCU A;  2P20 A;  4ODJ A;  2OPL A;  3JAM D;  2ATW A;  2P2B A;  4PUG A;  3TQI A;  3AY0 A;  4FUT A;  2QVX X;  4DUY C;  4B3M C;  5JRH A;  2E8C A;  2BH1 X;  1N2F A;  4IZ6 A;  3VNQ A;  4DCS A;  5BSW A;  2CXC A;  4IR7 A;  3PES A;  4DV2 C;  3DLP X;  4MTN A;  2P2Q A;  4JI6 C;  2ONF A;  3CW8 X;  2UUB C;  3IEV A;  1HNW C;  5BUS A;  3LUS A;  3TDE A;  4AQY C;  3L95 X;  1BA3 A;  3UZ0 A;  2NCL A;  3T1Y C;  1XRB A;  3KXW A;  3SO4 A;  4BC7 A;  5BSM A;  5LMU C;  2WD9 A;  5IT9 D;  4OYC A;  1MXC A;  4FTF A;  5BST A;  4JI4 C;  4RVN A;  5IFI A;  2E5L C;  5A2Q D;  1PA4 A;  4LFA C;  5E7Q A;  3CW9 A;  3OTO C;  2ASB A;  1N33 C;  4ZLP A;  5T8T A;  1P4E C;  1HH2 P;  3ETO A;  3K6R A;  2Y4O A;  5KYT A;  1NYE A;  2UXC C;  1M6X C;  1XRA A;  3TR3 A;  3S82 A;  3R9W A;  5A19 A;  1XNR C;  1K0R A;  4X64 C;  5LMN C;  1V26 A;  4DR4 C;  5BUQ A;  2D28 C;  1FUG A;  3NPD A;  4DV6 C;  1IB8 A;  5K8F A;  4GXQ A;  4WS9 A;  4DR3 C;  2MMA B;  4PUH A;  2UXD C;  2ZZM A;  1NY8 A;  4JI8 C;  2M5H A;  4RLF A;  1XMO C;  2JNV A;  2OPL B;  4K0B A;  5BSU A;  1MD9 A;  1XRC A;  1YJ7 A;  4JI1 C;  3H2T A;  2ZM6 C;  5H9U A;  1V60 A;  3R44 A;  2PRO A;  1O92 A;  4BSZ A;  2E7G A;  4GS5 A;  1HR0 C;  4G37 A;  1FLO A;  5BR8 C;  4LF8 C;  4WV3 A;  4GKK C;  2VZE A;  3A25 A;  3UEB A;  2P02 A;  4ZJZ A;  2WP0 C;  3VNR A;  1AMU A;  4GXR A;  2AYA A;  1O9T A;  4OX9 C;  5GTD A;  2E8F A;  2HJG A;  4R1M A;  4X62 C;  2CU6 A;  3TUF A;  2P2J A;  3VNS A;  2D1T A;  4RM3 A;  4L2Z A;  4JI2 C;  3GKU A;  4JI5 C;  1N32 C;  4JV5 C;  1LQL A;  1ULT A;  2XR1 A;  3GR1 A;  1I94 C;  1RG9 A;  4DG9 A;  2QVY X;  5BSR A;  5BSV A;  3E7X A;  5LCI A;  4XX2 A;  4NDN A;  3LAX A;  2KZF A;  1UWD A;  1PG4 A;  4LFB C;  2E8E A;  4DR1 C;  5KYV A;  1O93 A;  4JI0 C;  2E0G A;  4PUI A;  2KZ0 A;  4LF6 C;  1XS3 A;  3A26 A;  4KTV A;  4DR2 C;  4EAT A;  4B3T C;  4R0M A;  5CZX A;  1P4E A;  4DG8 A;  3UX3 A;  4KHP C;  1M6X A;  2M5O A;  3I07 A;  1USP B;  2D27 A;  2YWB A;  3LGX A;  1IBK C;  1ZB8 A;  3CQ1 A;  4D56 A;  4DV3 C;  4LF9 C;  3NYQ A;  1ML8 A;  5KEI A;  2DPL A;  2P2F A;  4X65 C;  3PBK A;  1VEH A;  2MCQ A;  5FLX D;  4G36 A;  4DR7 C;  1USP A;  1J5E C;  4TPS B;  2OBV A;  2ZZN A;  5T8S A;  2F4V C;  3EQ6 A;  1XHJ A;  1L2F A;  3DHV A;  4JYA C;  3UOW A;  4ISB A;  2UXB C;  4RM2 A;  4DV0 C;  2MM9 A;  1T5D X;  4I9G A;  1FJG C;  1VLA A;  3CQ2 A;  3LNV A;  2D1Q A;  4OXI A;  1HNZ C;  5AE1 A;  3T1H C;  1HNX C;  2UUA C;  2OO4 A;  4NOZ A;  1T5H X;  5IWA C;  4JI7 C;  2Y27 A;  5K85 A;  4D4G A;  3A4I A;  3NI2 A;  1MDB A;  5BUR A;  3C5E A;  2D7V A;  2Z51 A;  3A9U A;  4G1I A;  3R9X A;  1IBL C;  4R1L A;  4FUQ A;  3N2Q A;  4RMN A;  2VQE C;  1WF3 A;  3RG2 A;  4DV1 C;  1LCI A;  2UUC C;  2HHH C;  4DR5 C;  1MKY A;  2YWC A;  4BBY A;  4PHT A;  2D1R A;  2KDN A;  3GPC A;  3N54 B;  3UX2 A;  1N34 C;  1IBM C;  2V7B A;  4I9F A;  1WCJ A;  2DYJ A;  3E7W A;  4LE5 A;  5AE3 A;  2VQF C;  4BCA A;  4DCV A;  5ADZ A;  3DAY A;  3CQ3 A;  4RVO A;  3B7W A;  3AF6 A;  4D57 A;  1WH9 A;  2Y4N A;  2JMP A;  2BJO A;  1XMQ C;  4LF4 C;  1P7L A;  5DV9 A;  4D4I A;  3O2E A;  1V25 A;  1EGA A;  4NXN C;  4LFC C;  3A9V A;  4DCT A;  2QL8 A;  3J80 D;  2PT7 G;  1UKK A;  3L8C A;  2UU9 C;  4DV4 C;  3PRO C;  2YCB A;  3CJE A;  4L7I A;  4NXM C;  2QVZ X;  4PZP A; 
#chains in the Genus database with same CATH homology
 3GR0 A;  3RV2 A;  1KKG A;  2EGT A;  1RY2 A;  3FCE A;  1GPM A;  4LF5 C;  2P2M A;  4RLQ A;  1XNQ C;  3AF5 A;  1N36 C;  1PG3 A;  5A1I A;  1MXB A;  4LF7 C;  4B3S C;  1MDF A;  2PN2 A;  5A1G A;  4DV5 C;  3IML A;  4U5Y D;  4DV7 C;  1O90 A;  4KTT A;  3I08 A;  5CZV A;  1JOS A;  4L4Q A;  2VSQ A;  4JM1 A;  1ZB9 A;  1QM4 A;  4YHH C;  3IPL A;  1MXA A;  2QW0 X;  4JI3 C;  4GKJ C;  4X66 C;  4MH4 A;  4DUZ C;  3ETC A;  4DR6 C;  4YY3 C;  4PRO C;  3J81 D;  1QWI A;  4B3R C;  4BC9 A;  3G7S A;  5AE2 A;  2D1S A;  3EER A;  2CY1 A;  3NYR A;  4K0K C;  3FCC A;  4HPV A;  3IEU A;  4DCU A;  2P20 A;  4ODJ A;  2OPL A;  3JAM D;  2ATW A;  2P2B A;  3TQI A;  4FUT A;  2QVX X;  4DUY C;  4B3M C;  5JRH A;  2E8C A;  2BH1 X;  1N2F A;  4IZ6 A;  3VNQ A;  4DCS A;  5BSW A;  2CXC A;  4IR7 A;  3PES A;  4DV2 C;  3DLP X;  4MTN A;  2P2Q A;  4JI6 C;  2ONF A;  3CW8 X;  2UUB C;  3IEV A;  1HNW C;  5BUS A;  3LUS A;  3TDE A;  4AQY C;  3L95 X;  1BA3 A;  3UZ0 A;  3T1Y C;  1XRB A;  3KXW A;  3SO4 A;  4BC7 A;  5BSM A;  5LMU C;  2WD9 A;  5IT9 D;  4OYC A;  1MXC A;  4FTF A;  5BST A;  4JI4 C;  4RVN A;  5IFI A;  2E5L C;  5A2Q D;  1PA4 A;  4LFA C;  5E7Q A;  3CW9 A;  3OTO C;  2ASB A;  1N33 C;  4ZLP A;  5T8T A;  1HH2 P;  3ETO A;  2Y4O A;  5KYT A;  1NYE A;  2UXC C;  1XRA A;  3R9W A;  3S82 A;  5A19 A;  1XNR C;  1K0R A;  4X64 C;  5LMN C;  1V26 A;  4DR4 C;  5BUQ A;  2D28 C;  1FUG A;  3NPD A;  4DV6 C;  5K8F A;  4GXQ A;  4WS9 A;  4DR3 C;  2UXD C;  4JI8 C;  4RLF A;  1XMO C;  2OPL B;  4K0B A;  5BSU A;  1MD9 A;  1XRC A;  1YJ7 A;  4JI1 C;  3H2T A;  2ZM6 C;  5H9U A;  3R44 A;  2PRO A;  1O92 A;  4BSZ A;  2E7G A;  4GS5 A;  1HR0 C;  4G37 A;  5BR8 C;  4LF8 C;  4WV3 A;  4GKK C;  2VZE A;  2P02 A;  4ZJZ A;  2WP0 C;  3VNR A;  1AMU A;  4GXR A;  2AYA A;  1O9T A;  4OX9 C;  5GTD A;  2E8F A;  2HJG A;  4R1M A;  4X62 C;  3TUF A;  2P2J A;  3VNS A;  2D1T A;  4RM3 A;  4L2Z A;  4JI2 C;  3GKU A;  4JI5 C;  1N32 C;  4JV5 C;  1LQL A;  1ULT A;  2XR1 A;  3GR1 A;  1I94 C;  1RG9 A;  4DG9 A;  2QVY X;  5BSR A;  5BSV A;  3E7X A;  4XX2 A;  4NDN A;  3LAX A;  2KZF A;  1PG4 A;  4LFB C;  2E8E A;  4DR1 C;  5KYV A;  1O93 A;  4JI0 C;  2E0G A;  4LF6 C;  4KTV A;  4DR2 C;  4EAT A;  4B3T C;  4R0M A;  5CZX A;  4DG8 A;  4KHP C;  3I07 A;  1USP B;  2D27 A;  2YWB A;  3LGX A;  1IBK C;  1ZB8 A;  4D56 A;  4DV3 C;  4LF9 C;  3NYQ A;  1ML8 A;  5KEI A;  2DPL A;  2P2F A;  4X65 C;  3PBK A;  5FLX D;  4G36 A;  4DR7 C;  1USP A;  1J5E C;  4TPS B;  2OBV A;  5T8S A;  2F4V C;  3EQ6 A;  1L2F A;  3DHV A;  4JYA C;  3UOW A;  4ISB A;  2UXB C;  4RM2 A;  4DV0 C;  1T5D X;  4I9G A;  1FJG C;  1VLA A;  3LNV A;  2D1Q A;  4OXI A;  1HNZ C;  5AE1 A;  3T1H C;  1HNX C;  2UUA C;  2OO4 A;  4NOZ A;  1T5H X;  5IWA C;  4JI7 C;  2Y27 A;  5K85 A;  4D4G A;  3A4I A;  3NI2 A;  1MDB A;  5BUR A;  3C5E A;  2D7V A;  3A9U A;  4G1I A;  3R9X A;  1IBL C;  4R1L A;  4FUQ A;  3N2Q A;  4RMN A;  2VQE C;  1WF3 A;  3RG2 A;  4DV1 C;  1LCI A;  2UUC C;  2HHH C;  4DR5 C;  1MKY A;  2YWC A;  4BBY A;  4PHT A;  2D1R A;  3GPC A;  3N54 B;  1N34 C;  1IBM C;  2V7B A;  4I9F A;  2DYJ A;  3E7W A;  4LE5 A;  5AE3 A;  2VQF C;  4BCA A;  4DCV A;  5ADZ A;  3DAY A;  4RVO A;  3B7W A;  3AF6 A;  4D57 A;  1WH9 A;  2Y4N A;  2JMP A;  2BJO A;  1XMQ C;  4LF4 C;  1P7L A;  5DV9 A;  4D4I A;  1V25 A;  1EGA A;  4NXN C;  4LFC C;  3A9V A;  4DCT A;  2QL8 A;  3J80 D;  2PT7 G;  1UKK A;  3L8C A;  2UU9 C;  4DV4 C;  3PRO C;  2YCB A;  3CJE A;  4L7I A;  4NXM C;  2QVZ X;  4PZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...