2E8CA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein Aq_1549
publication title Crystal structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8cA00
4JI0C 4LFAC 2PT7G 4DR5C 4YY3C 1ML8A 1WF3A 4X62C 4DV0C 3IEVA 1N36C 1ZB9A 1EGAA 1NYEA 2ZM6C 4DCVA 3R9WA 1KKGA 1HNWC 1IBKC 2JMPA 2DYJA 4LF7C 1N2FA 3J80D 4JI7C 4BSZA 4X66C 3GKUA 4GKJC 4DCSA 4GKKC 4X64C 4YHHC 2HHHC 2E8EA 1N34C 4NXMC 1HNZC 1MKYA 2CY1A 5LMUC 3J81D 4B3MC 3I07A 3T1YC 2CXCA 2UXDC 4B3TC 1JOSA 2YCBA 1HR0C 4DR1C 4K0KC 1WH9A 4NOZA 3EERA 4JI2C 1N33C 1IBLC 2BJOA 4JI4C 1XNRC 1ZB8A 1N32C 4DR2C 2UXBC 4LF8C 1VLAA 5A2QD 5IWAC 4LF4C 1LQLA 5LMNC 3IEUA 4JYAC 2E8FA 5FLXD 4DUZC 4DV3C 2E5LC 3JAMD 4DR6C 2OPLB 2UUBC 1I94C 1FJGC 4JI3C 1XNQC 1J5EC 4MH4A 4NXNC 1USPA 4DR3C 2OPLA 2D7VA 2VQEC 2XR1A 4DR4C 5BR8C 1XMQC 3T1HC 4DV7C 2VQFC 1HNXC 2ATWA 2HJGA 4JI6C 4DV6C 1K0RA 4X65C 4JI1C 4DV2C 3AF5A 4JI8C 4KHPC 4DV4C 4JI5C 4JV5C 1XMOC 1QWIA 4LF9C 1USPB 2ASBA 4B3SC 2EGTA 4B3RC 2KZFA 4LF5C 2PN2A 4DV1C 4LF6C 3OTOC 2UUAC 1UKKA 2ONFA 4LFBC 2UU9C 3AF6A 2UUCC 2F4VC 4DR7C 2QL8A 4DV5C 2E8CA 4LFCC 3CJEA 4DUYC 3LUSA 4AQYC 1IBMC 4DCTA 4OX9C 1PA4A 2E7GA 5IT9D 3R9XA 4MTNA 4DCUA 1L2FA 1HH2P 2UXCC 4XX2A
chains in the Genus database with same CATH superfamily
2PT7G 4OYCA 1MDBA 1ML8A 4G1IA 2QW0X 1WF3A 4X62C 1T5DX 3GR0A 1M6XA 1TH5A 3LNVA 4PUIA 2VZEA 1EGAA 2WP0C 2Y27A 4RLFA 3FCCA 1QM4A 3UEBA 2JMPA 4D4IA 1N2FA 4JI7C 1BA3A 3CW9A 4I9FA 3GKUA 3N54B 4DG9A 2QVZX 5BSUA 5CZXA 4X64C 3CW8X 3N2QA 4GS5A 4TPSB 4NXMC 4IR7A 3GR1A 3UX3A 2JNVA 1AMUA 3A26A 3T1YC 3NYRA 1IBLC 2BJOA 4JI4C 3DAYA 4DG8A 4OXIA 1ZB8A 2UXBC 2KDNA 3PESA 5IWAC 3TR3A 2P2JA 1MXAA 1LQLA 5AE3A 1PG4A 2E5LC 5T8TA 4DR6C 5A19A 5KEIA 1I94C 2M5OA 4JI3C 4K0BA 1V60A 1XNQC 5BSTA 1FUGA 3UX2A 1USPA 2OPLA 5K8FA 4PROC 1XRBA 4D56A 5BR8C 4DV7C 3NI2A 5BUQA 4KHPC 2DHMA 5AE1A 2WD9A 4RVNA 2ZZMA 1XMOC 4JV5C 1M6XC 1USPB 5BSVA 4R1LA 4DV1C 3TUFA 2OO4A 1XS3A 1IB8A 3OTOC 2UUAC 5ADZA 4G37A 2UU9C 2ZZNA 5BURA 5JRHA 2P2BA 4RVOA 4DUYC 4OX9C 4L2ZA 5BSWA 3R9XA 4MTNA 1XHJA 2UXCC 1XRAA 2QVYX 1MXBA 5BSMA 5DV9A 3GPCA 4JI0C 4G36A 4YY3C 4DV0C 2MM9A 4BCAA 1N36C 4RLQA 3CQ2A 3UOWA 5T8SA 5E7QA 3R9WA 4GXQA 1KKGA 1HNWC 3S82A 4KTVA 3B7WA 4D4GA 3J80D 2D28C 4X66C 1O90A 2E0GA 1PU1A 1HNZC 5LMUC 3L8CA 3J81D 4B3MC 3VNRA 2UXDC 4K0KC 4DR1C 4JI2C 3NPDA 1XRCA 1XNRC 4DR2C 2Z51A 3IEUA 2E8FA 5FLXD 4LE5A 2MCQA 2D27A 3O2EA 2UUBC 1UWDA 1J5EC 5AE2A 5IFIA 3AY0A 1VEHA 4L4QA 3R44A 2D7VA 2P2FA 4BBYA 2YX1A 3KXWA 2XR1A 1P4EA 3PBKA 1GPMA 2VQFC 2ATWA 2HJGA 2M5HA 4BC9A 2YWBA 4R0MA 4B3SC 2OBVA 2PN2A 2ONFA 4I9GA 2UUCC 3AF6A 2F4VC 1MDFA 4DV5C 2E8CA 4LFCC 3DLPX 2KZ0A 3LUSA 1V26A 1PA4A 5IT9D 4RM2A 2DPLA 3NYQA 4R1MA 5CZVA 4RMNA 3A25A 3CQ3A 4DR5C 3ETOA 4D57A 2NCLA 1ZB9A 3C5EA 1MXCA 1NYEA 4PUHA 2D1SA 4ISBA 1MD9A 5K85A 1RG9A 2DYJA 4LF7C 5KYVA 1PG3A 4GKJC 4L7IA 4DCSA 4GKKC 1FLOA 2D1QA 1N34C 3LAXA 4KTTA 2CY1A 1P4EC 3I07A 3UZ0A 2CXCA 4NDNA 1JOSA 2YCBA 1HR0C 3H2TA 5BUSA 1N32C 5A2QD 4HPVA 5BSRA 5LMNC 3JAMD 1LCIA 3L95X 1O93A 2P20A 2VQEC 2AYAA 1XMQC 3T1HC 4DV6C 2BH1X 4PZPA 4DV4C 2CU6A 3LNOA 1QWIA 1T5HX 4LF9C 1ULTA 2MMAB 2EGTA 3A9UA 2KZFA 4PHTA 3VNSA 4FTFA 4WV3A 4ZLPA 4IZ6A 3K6RA 4DR7C 1O9TA 5A1GA 4U5YD 4AQYC 1IBMC 3EQ6A 4EATA 2E7GA 4DCUA 4XX2A 4LFAC 2QVXX 3IMLA 3IEVA 3A9VA 5H9UA 2ZM6C 4DCVA 5KYTA 3IPLA 4ODJA 1V25A 3A4IA 1IBKC 5LCIA 1P7LA 3RG2A 4BSZA 3DHVA 4FUQA 4YHHC 2HHHC 2E8EA 4FUTA 4BC7A 1MKYA 3ETCA 2YWCA 1YJ7A 4WS9A 3PROC 4B3TC 1WCJA 1WH9A 4ZJZA 4NOZA 3EERA 1N33C 2D1TA 4GXRA 3TDEA 4LF8C 1VLAA 4LF4C 4JYAC 3I08A 4DUZC 4PUGA 4DV3C 2OPLB 5GTDA 3SO4A 3E7XA 1FJGC 4MH4A 4NXNC 2VSQA 4DR3C 2V7BA 1NY8A 3FCEA 2P02A 3VNQA 4RM3A 4DR4C 1O92A 1HNXC 4JI6C 1K0RA 4X65C 3TQIA 4JI1C 4DV2C 3AF5A 2D1RA 4JI8C 4JI5C 3RV2A 2ASBA 3CQ1A 4B3RC 4LF5C 3G7SA 4LF6C 1RY2A 3E7WA 1UKKA 2PROA 4LFBC 2QL8A 3CJEA 4DCTA 2P2QA 4JM1A 1L2FA 3LGXA 1HH2P 5A1IA 2Y4OA 2Y4NA 2P2MA
chains in the Genus database with same CATH topology
2PT7G 4OYCA 1MDBA 1ML8A 4G1IA 2QW0X 1WF3A 4X62C 1T5DX 3GR0A 3LNVA 2VZEA 1EGAA 2WP0C 2Y27A 4RLFA 3FCCA 1QM4A 2JMPA 4D4IA 1N2FA 4JI7C 1BA3A 3CW9A 4I9FA 3GKUA 3N54B 4DG9A 2QVZX 5BSUA 5CZXA 4X64C 3CW8X 3N2QA 4GS5A 4TPSB 4NXMC 4IR7A 3GR1A 1AMUA 3T1YC 3NYRA 1IBLC 2BJOA 4JI4C 3DAYA 4DG8A 4OXIA 1ZB8A 2UXBC 3PESA 5IWAC 2P2JA 1MXAA 1LQLA 5AE3A 1PG4A 2E5LC 5T8TA 4DR6C 5A19A 5KEIA 1I94C 4JI3C 4K0BA 1XNQC 5BSTA 1FUGA 1USPA 2OPLA 5K8FA 4PROC 1XRBA 4D56A 5BR8C 4DV7C 3NI2A 5BUQA 4KHPC 5AE1A 2WD9A 4RVNA 4JV5C 1XMOC 1USPB 5BSVA 4R1LA 4DV1C 3TUFA 2OO4A 3OTOC 2UUAC 5ADZA 4G37A 2UU9C 5BURA 5JRHA 4RVOA 2P2BA 4DUYC 4OX9C 4L2ZA 5BSWA 3R9XA 4MTNA 2UXCC 1XRAA 2QVYX 1MXBA 5BSMA 5DV9A 3GPCA 4JI0C 4G36A 4YY3C 4DV0C 4BCAA 1N36C 4RLQA 3UOWA 5T8SA 5E7QA 3R9WA 4GXQA 1KKGA 1HNWC 3S82A 4KTVA 3B7WA 3J80D 4D4GA 2D28C 4X66C 1O90A 2E0GA 1HNZC 5LMUC 3L8CA 3J81D 4B3MC 3VNRA 2UXDC 4K0KC 4DR1C 4JI2C 3NPDA 1XRCA 1XNRC 4DR2C 3IEUA 2E8FA 5FLXD 4LE5A 2D27A 2UUBC 1J5EC 5AE2A 5IFIA 4L4QA 3R44A 2D7VA 2P2FA 4BBYA 3KXWA 2XR1A 3PBKA 1GPMA 2VQFC 2ATWA 2HJGA 4BC9A 2YWBA 4R0MA 4B3SC 2OBVA 2PN2A 2ONFA 4I9GA 2UUCC 3AF6A 2F4VC 1MDFA 4DV5C 2E8CA 4LFCC 3DLPX 3LUSA 1V26A 1PA4A 5IT9D 4RM2A 2DPLA 3NYQA 4R1MA 5CZVA 4RMNA 4DR5C 3ETOA 4D57A 1ZB9A 3C5EA 1MXCA 1NYEA 2D1SA 4ISBA 1MD9A 5K85A 1RG9A 2DYJA 4LF7C 5KYVA 1PG3A 4GKJC 4L7IA 4DCSA 4GKKC 2D1QA 1N34C 3LAXA 4KTTA 2CY1A 3I07A 3UZ0A 2CXCA 4NDNA 1JOSA 2YCBA 1HR0C 3H2TA 5BUSA 1N32C 5A2QD 4HPVA 5BSRA 5LMNC 3JAMD 1LCIA 3L95X 1O93A 2P20A 2VQEC 2AYAA 1XMQC 3T1HC 4DV6C 2BH1X 4PZPA 4DV4C 1QWIA 1T5HX 4LF9C 1ULTA 2EGTA 3A9UA 2KZFA 4PHTA 3VNSA 4FTFA 4WV3A 4ZLPA 4IZ6A 4DR7C 1O9TA 4U5YD 5A1GA 4AQYC 1IBMC 3EQ6A 4EATA 2E7GA 4DCUA 4XX2A 4LFAC 2QVXX 3IMLA 3IEVA 3A9VA 5H9UA 2ZM6C 4DCVA 5KYTA 3IPLA 4ODJA 1V25A 3A4IA 1IBKC 1P7LA 3RG2A 4BSZA 3DHVA 4FUQA 4YHHC 2HHHC 2E8EA 4FUTA 4BC7A 1MKYA 3ETCA 2YWCA 1YJ7A 4WS9A 3PROC 4B3TC 1WH9A 4ZJZA 4NOZA 3EERA 1N33C 2D1TA 4GXRA 3TDEA 4LF8C 1VLAA 4LF4C 4JYAC 3I08A 4DUZC 4DV3C 2OPLB 5GTDA 3SO4A 3E7XA 1FJGC 4MH4A 4NXNC 2VSQA 4DR3C 2V7BA 3FCEA 2P02A 3VNQA 4RM3A 4DR4C 1O92A 1HNXC 4JI6C 1K0RA 4X65C 3TQIA 4JI1C 4DV2C 3AF5A 2D1RA 4JI8C 4JI5C 3RV2A 2ASBA 4B3RC 4LF5C 3G7SA 4LF6C 1RY2A 3E7WA 1UKKA 2PROA 4LFBC 2QL8A 3CJEA 4DCTA 2P2QA 4JM1A 1L2FA 3LGXA 1HH2P 5A1IA 2Y4OA 2Y4NA 2P2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 C;  4LFA C;  2PT7 G;  4DR5 C;  4YY3 C;  1ML8 A;  1WF3 A;  4X62 C;  4DV0 C;  3IEV A;  1N36 C;  1ZB9 A;  1EGA A;  1NYE A;  2ZM6 C;  4DCV A;  3R9W A;  1KKG A;  1HNW C;  1IBK C;  2JMP A;  2DYJ A;  4LF7 C;  1N2F A;  3J80 D;  4JI7 C;  4BSZ A;  4X66 C;  3GKU A;  4GKJ C;  4DCS A;  4GKK C;  4X64 C;  4YHH C;  2HHH C;  2E8E A;  1N34 C;  4NXM C;  1HNZ C;  1MKY A;  2CY1 A;  5LMU C;  3J81 D;  4B3M C;  3I07 A;  3T1Y C;  2CXC A;  2UXD C;  4B3T C;  1JOS A;  2YCB A;  1HR0 C;  4DR1 C;  4K0K C;  1WH9 A;  4NOZ A;  3EER A;  4JI2 C;  1N33 C;  1IBL C;  2BJO A;  4JI4 C;  1XNR C;  1ZB8 A;  1N32 C;  4DR2 C;  2UXB C;  4LF8 C;  1VLA A;  5A2Q D;  5IWA C;  4LF4 C;  1LQL A;  5LMN C;  3IEU A;  4JYA C;  2E8F A;  5FLX D;  4DUZ C;  4DV3 C;  2E5L C;  3JAM D;  4DR6 C;  2OPL B;  2UUB C;  1I94 C;  1FJG C;  4JI3 C;  1XNQ C;  1J5E C;  4MH4 A;  4NXN C;  1USP A;  4DR3 C;  2OPL A;  2D7V A;  2VQE C;  2XR1 A;  4DR4 C;  5BR8 C;  1XMQ C;  3T1H C;  4DV7 C;  2VQF C;  1HNX C;  2ATW A;  2HJG A;  4JI6 C;  4DV6 C;  1K0R A;  4X65 C;  4JI1 C;  4DV2 C;  3AF5 A;  4JI8 C;  4KHP C;  4DV4 C;  4JI5 C;  4JV5 C;  1XMO C;  1QWI A;  4LF9 C;  1USP B;  2ASB A;  4B3S C;  2EGT A;  4B3R C;  2KZF A;  4LF5 C;  2PN2 A;  4DV1 C;  4LF6 C;  3OTO C;  2UUA C;  1UKK A;  2ONF A;  4LFB C;  2UU9 C;  3AF6 A;  2UUC C;  2F4V C;  4DR7 C;  2QL8 A;  4DV5 C;  2E8C A;  4LFC C;  3CJE A;  4DUY C;  3LUS A;  4AQY C;  1IBM C;  4DCT A;  4OX9 C;  1PA4 A;  2E7G A;  5IT9 D;  3R9X A;  4MTN A;  4DCU A;  1L2F A;  1HH2 P;  2UXC C;  4XX2 A; 
#chains in the Genus database with same CATH topology
 2PT7 G;  4OYC A;  1MDB A;  1ML8 A;  4G1I A;  2QW0 X;  1WF3 A;  4X62 C;  1T5D X;  3GR0 A;  1M6X A;  1TH5 A;  3LNV A;  4PUI A;  2VZE A;  1EGA A;  2WP0 C;  2Y27 A;  4RLF A;  3FCC A;  1QM4 A;  3UEB A;  2JMP A;  4D4I A;  1N2F A;  4JI7 C;  1BA3 A;  3CW9 A;  4I9F A;  3GKU A;  3N54 B;  4DG9 A;  2QVZ X;  5BSU A;  5CZX A;  4X64 C;  3CW8 X;  3N2Q A;  4GS5 A;  4TPS B;  4NXM C;  4IR7 A;  3GR1 A;  3UX3 A;  2JNV A;  1AMU A;  3A26 A;  3T1Y C;  3NYR A;  1IBL C;  2BJO A;  4JI4 C;  3DAY A;  4DG8 A;  4OXI A;  1ZB8 A;  2UXB C;  2KDN A;  3PES A;  5IWA C;  3TR3 A;  2P2J A;  1MXA A;  1LQL A;  5AE3 A;  1PG4 A;  2E5L C;  5T8T A;  4DR6 C;  5A19 A;  5KEI A;  1I94 C;  2M5O A;  4JI3 C;  4K0B A;  1V60 A;  1XNQ C;  5BST A;  1FUG A;  3UX2 A;  1USP A;  2OPL A;  5K8F A;  4PRO C;  1XRB A;  4D56 A;  5BR8 C;  4DV7 C;  3NI2 A;  5BUQ A;  4KHP C;  2DHM A;  5AE1 A;  2WD9 A;  4RVN A;  2ZZM A;  1XMO C;  4JV5 C;  1M6X C;  1USP B;  5BSV A;  4R1L A;  4DV1 C;  3TUF A;  2OO4 A;  1XS3 A;  1IB8 A;  3OTO C;  2UUA C;  5ADZ A;  4G37 A;  2UU9 C;  2ZZN A;  5BUR A;  5JRH A;  2P2B A;  4RVO A;  4DUY C;  4OX9 C;  4L2Z A;  5BSW A;  3R9X A;  4MTN A;  1XHJ A;  2UXC C;  1XRA A;  2QVY X;  1MXB A;  5BSM A;  5DV9 A;  3GPC A;  4JI0 C;  4G36 A;  4YY3 C;  4DV0 C;  2MM9 A;  4BCA A;  1N36 C;  4RLQ A;  3CQ2 A;  3UOW A;  5T8S A;  5E7Q A;  3R9W A;  4GXQ A;  1KKG A;  1HNW C;  3S82 A;  4KTV A;  3B7W A;  4D4G A;  3J80 D;  2D28 C;  4X66 C;  1O90 A;  2E0G A;  1PU1 A;  1HNZ C;  5LMU C;  3L8C A;  3J81 D;  4B3M C;  3VNR A;  2UXD C;  4K0K C;  4DR1 C;  4JI2 C;  3NPD A;  1XRC A;  1XNR C;  4DR2 C;  2Z51 A;  3IEU A;  2E8F A;  5FLX D;  4LE5 A;  2MCQ A;  2D27 A;  3O2E A;  2UUB C;  1UWD A;  1J5E C;  5AE2 A;  5IFI A;  3AY0 A;  1VEH A;  4L4Q A;  3R44 A;  2D7V A;  2P2F A;  4BBY A;  2YX1 A;  3KXW A;  2XR1 A;  1P4E A;  3PBK A;  1GPM A;  2VQF C;  2ATW A;  2HJG A;  2M5H A;  4BC9 A;  2YWB A;  4R0M A;  4B3S C;  2OBV A;  2PN2 A;  2ONF A;  4I9G A;  2UUC C;  3AF6 A;  2F4V C;  1MDF A;  4DV5 C;  2E8C A;  4LFC C;  3DLP X;  2KZ0 A;  3LUS A;  1V26 A;  1PA4 A;  5IT9 D;  4RM2 A;  2DPL A;  3NYQ A;  4R1M A;  5CZV A;  4RMN A;  3A25 A;  3CQ3 A;  4DR5 C;  3ETO A;  4D57 A;  2NCL A;  1ZB9 A;  3C5E A;  1MXC A;  1NYE A;  4PUH A;  2D1S A;  4ISB A;  1MD9 A;  5K85 A;  1RG9 A;  2DYJ A;  4LF7 C;  5KYV A;  1PG3 A;  4GKJ C;  4L7I A;  4DCS A;  4GKK C;  1FLO A;  2D1Q A;  1N34 C;  3LAX A;  4KTT A;  2CY1 A;  1P4E C;  3I07 A;  3UZ0 A;  2CXC A;  4NDN A;  1JOS A;  2YCB A;  1HR0 C;  3H2T A;  5BUS A;  1N32 C;  5A2Q D;  4HPV A;  5BSR A;  5LMN C;  3JAM D;  1LCI A;  3L95 X;  1O93 A;  2P20 A;  2VQE C;  2AYA A;  1XMQ C;  3T1H C;  4DV6 C;  2BH1 X;  4PZP A;  4DV4 C;  2CU6 A;  3LNO A;  1QWI A;  1T5H X;  4LF9 C;  1ULT A;  2MMA B;  2EGT A;  3A9U A;  2KZF A;  4PHT A;  3VNS A;  4FTF A;  4WV3 A;  4ZLP A;  4IZ6 A;  3K6R A;  4DR7 C;  1O9T A;  5A1G A;  4U5Y D;  4AQY C;  1IBM C;  3EQ6 A;  4EAT A;  2E7G A;  4DCU A;  4XX2 A;  4LFA C;  2QVX X;  3IML A;  3IEV A;  3A9V A;  5H9U A;  2ZM6 C;  4DCV A;  5KYT A;  3IPL A;  4ODJ A;  1V25 A;  3A4I A;  1IBK C;  5LCI A;  1P7L A;  3RG2 A;  4BSZ A;  3DHV A;  4FUQ A;  4YHH C;  2HHH C;  2E8E A;  4FUT A;  4BC7 A;  1MKY A;  3ETC A;  2YWC A;  1YJ7 A;  4WS9 A;  3PRO C;  4B3T C;  1WCJ A;  1WH9 A;  4ZJZ A;  4NOZ A;  3EER A;  1N33 C;  2D1T A;  4GXR A;  3TDE A;  4LF8 C;  1VLA A;  4LF4 C;  4JYA C;  3I08 A;  4DUZ C;  4PUG A;  4DV3 C;  2OPL B;  5GTD A;  3SO4 A;  3E7X A;  1FJG C;  4MH4 A;  4NXN C;  2VSQ A;  4DR3 C;  2V7B A;  1NY8 A;  3FCE A;  2P02 A;  3VNQ A;  4RM3 A;  4DR4 C;  1O92 A;  1HNX C;  4JI6 C;  1K0R A;  4X65 C;  3TQI A;  4JI1 C;  4DV2 C;  3AF5 A;  2D1R A;  4JI8 C;  4JI5 C;  3RV2 A;  2ASB A;  3CQ1 A;  4B3R C;  4LF5 C;  3G7S A;  4LF6 C;  1RY2 A;  3E7W A;  1UKK A;  2PRO A;  4LFB C;  2QL8 A;  3CJE A;  4DCT A;  2P2Q A;  4JM1 A;  1L2F A;  3LGX A;  1HH2 P;  5A1I A;  2Y4O A;  2Y4N A;  2P2M A; 
#chains in the Genus database with same CATH homology
 2PT7 G;  4OYC A;  1MDB A;  1ML8 A;  4G1I A;  2QW0 X;  1WF3 A;  4X62 C;  1T5D X;  3GR0 A;  3LNV A;  2VZE A;  1EGA A;  2WP0 C;  2Y27 A;  4RLF A;  3FCC A;  1QM4 A;  2JMP A;  4D4I A;  1N2F A;  4JI7 C;  1BA3 A;  3CW9 A;  4I9F A;  3GKU A;  3N54 B;  4DG9 A;  2QVZ X;  5BSU A;  5CZX A;  4X64 C;  3CW8 X;  3N2Q A;  4GS5 A;  4TPS B;  4NXM C;  4IR7 A;  3GR1 A;  1AMU A;  3T1Y C;  3NYR A;  1IBL C;  2BJO A;  4JI4 C;  3DAY A;  4DG8 A;  4OXI A;  1ZB8 A;  2UXB C;  3PES A;  5IWA C;  2P2J A;  1MXA A;  1LQL A;  5AE3 A;  1PG4 A;  2E5L C;  5T8T A;  4DR6 C;  5A19 A;  5KEI A;  1I94 C;  4JI3 C;  4K0B A;  1XNQ C;  5BST A;  1FUG A;  1USP A;  2OPL A;  5K8F A;  4PRO C;  1XRB A;  4D56 A;  5BR8 C;  4DV7 C;  3NI2 A;  5BUQ A;  4KHP C;  5AE1 A;  2WD9 A;  4RVN A;  4JV5 C;  1XMO C;  1USP B;  5BSV A;  4R1L A;  4DV1 C;  3TUF A;  2OO4 A;  3OTO C;  2UUA C;  5ADZ A;  4G37 A;  2UU9 C;  5BUR A;  5JRH A;  4RVO A;  2P2B A;  4DUY C;  4OX9 C;  4L2Z A;  5BSW A;  3R9X A;  4MTN A;  2UXC C;  1XRA A;  2QVY X;  1MXB A;  5BSM A;  5DV9 A;  3GPC A;  4JI0 C;  4G36 A;  4YY3 C;  4DV0 C;  4BCA A;  1N36 C;  4RLQ A;  3UOW A;  5T8S A;  5E7Q A;  3R9W A;  4GXQ A;  1KKG A;  1HNW C;  3S82 A;  4KTV A;  3B7W A;  3J80 D;  4D4G A;  2D28 C;  4X66 C;  1O90 A;  2E0G A;  1HNZ C;  5LMU C;  3L8C A;  3J81 D;  4B3M C;  3VNR A;  2UXD C;  4K0K C;  4DR1 C;  4JI2 C;  3NPD A;  1XRC A;  1XNR C;  4DR2 C;  3IEU A;  2E8F A;  5FLX D;  4LE5 A;  2D27 A;  2UUB C;  1J5E C;  5AE2 A;  5IFI A;  4L4Q A;  3R44 A;  2D7V A;  2P2F A;  4BBY A;  3KXW A;  2XR1 A;  3PBK A;  1GPM A;  2VQF C;  2ATW A;  2HJG A;  4BC9 A;  2YWB A;  4R0M A;  4B3S C;  2OBV A;  2PN2 A;  2ONF A;  4I9G A;  2UUC C;  3AF6 A;  2F4V C;  1MDF A;  4DV5 C;  2E8C A;  4LFC C;  3DLP X;  3LUS A;  1V26 A;  1PA4 A;  5IT9 D;  4RM2 A;  2DPL A;  3NYQ A;  4R1M A;  5CZV A;  4RMN A;  4DR5 C;  3ETO A;  4D57 A;  1ZB9 A;  3C5E A;  1MXC A;  1NYE A;  2D1S A;  4ISB A;  1MD9 A;  5K85 A;  1RG9 A;  2DYJ A;  4LF7 C;  5KYV A;  1PG3 A;  4GKJ C;  4L7I A;  4DCS A;  4GKK C;  2D1Q A;  1N34 C;  3LAX A;  4KTT A;  2CY1 A;  3I07 A;  3UZ0 A;  2CXC A;  4NDN A;  1JOS A;  2YCB A;  1HR0 C;  3H2T A;  5BUS A;  1N32 C;  5A2Q D;  4HPV A;  5BSR A;  5LMN C;  3JAM D;  1LCI A;  3L95 X;  1O93 A;  2P20 A;  2VQE C;  2AYA A;  1XMQ C;  3T1H C;  4DV6 C;  2BH1 X;  4PZP A;  4DV4 C;  1QWI A;  1T5H X;  4LF9 C;  1ULT A;  2EGT A;  3A9U A;  2KZF A;  4PHT A;  3VNS A;  4FTF A;  4WV3 A;  4ZLP A;  4IZ6 A;  4DR7 C;  1O9T A;  4U5Y D;  5A1G A;  4AQY C;  1IBM C;  3EQ6 A;  4EAT A;  2E7G A;  4DCU A;  4XX2 A;  4LFA C;  2QVX X;  3IML A;  3IEV A;  3A9V A;  5H9U A;  2ZM6 C;  4DCV A;  5KYT A;  3IPL A;  4ODJ A;  1V25 A;  3A4I A;  1IBK C;  1P7L A;  3RG2 A;  4BSZ A;  3DHV A;  4FUQ A;  4YHH C;  2HHH C;  2E8E A;  4FUT A;  4BC7 A;  1MKY A;  3ETC A;  2YWC A;  1YJ7 A;  4WS9 A;  3PRO C;  4B3T C;  1WH9 A;  4ZJZ A;  4NOZ A;  3EER A;  1N33 C;  2D1T A;  4GXR A;  3TDE A;  4LF8 C;  1VLA A;  4LF4 C;  4JYA C;  3I08 A;  4DUZ C;  4DV3 C;  2OPL B;  5GTD A;  3SO4 A;  3E7X A;  1FJG C;  4MH4 A;  4NXN C;  2VSQ A;  4DR3 C;  2V7B A;  3FCE A;  2P02 A;  3VNQ A;  4RM3 A;  4DR4 C;  1O92 A;  1HNX C;  4JI6 C;  1K0R A;  4X65 C;  3TQI A;  4JI1 C;  4DV2 C;  3AF5 A;  2D1R A;  4JI8 C;  4JI5 C;  3RV2 A;  2ASB A;  4B3R C;  4LF5 C;  3G7S A;  4LF6 C;  1RY2 A;  3E7W A;  1UKK A;  2PRO A;  4LFB C;  2QL8 A;  3CJE A;  4DCT A;  2P2Q A;  4JM1 A;  1L2F A;  3LGX A;  1HH2 P;  5A1I A;  2Y4O A;  2Y4N A;  2P2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...