2E8CA

Crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
132
structure length
132
Chain Sequence
MEVKEVELELSSEATFLSKTSIGEITAGEKGLNPMELLLVSIGSCSGVDVYHILKKKRQEVKDIKIFLKGKRREKHPKIYEEIEIKYVAVGKVEEKALEQAVKLSTEKYCSVLAMVKPSTNLKISWEVKWEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (Aq_1549) from Aquifex aeolicus VF5
rcsb
source organism Aquifex aeolicus
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein Aq_1549
total genus 39
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2e8cA00
4DV2C 4B3MC 3IEVA 3J80D 5IWAC 1USPB 4JI5C 4LFBC 4DR5C 1QWIA 4DR4C 4DR7C 2DYJA 4LF5C 1KKGA 1ML8A 2UU9C 1HNXC 2HHHC 4OX9C 4DV5C 1NYEA 4LF8C 3OTOC 1ZB9A 4NXMC 1HR0C 4JI4C 3LUSA 4LFAC 1VLAA 4JI3C 1HNZC 4DUYC 4X66C 2E7GA 3T1HC 4JV5C 4LF9C 4AQYC 4JI1C 2E8CA 2UXDC 1LQLA 4DV6C 2PT7G 4B3SC 4B3RC 1N36C 1J5EC 2OPLA 2E8FA 4X64C 2ZM6C 2EGTA 4X62C 1L2FA 1PA4A 4XX2A 1XMQC 2ONFA 4LF4C 1WH9A 4MH4A 4NOZA 4JI2C 5FLXD 4DCVA 4DR2C 2VQEC 2F4VC 1ZB8A 2UUAC 1IBLC 1USPA 3JAMD 3I07A 4MTNA 2XR1A 4LF7C 1N34C 3GKUA 1WF3A 2UXBC 3AF5A 4BSZA 4DR1C 4JYAC 4DV4C 2UUCC 2OPLB 1IBKC 4JI8C 2HJGA 4DV1C 2QL8A 1XNQC 5BR8C 4DV0C 2UUBC 4JI7C 4X65C 2CXCA 4DR6C 4DUZC 1EGAA 5A2QD 1HNWC 2ASBA 4DCSA 2VQFC 2E8EA 4LF6C 3CJEA 4YY3C 1JOSA 2PN2A 3T1YC 4GKJC 2E5LC 1XMOC 2JMPA 4KHPC 3EERA 4GKKC 2ATWA 4K0KC 1UKKA 4YHHC 4DV7C 4JI0C 2UXCC 4DR3C 1HH2P 5LMNC 3AF6A 3R9XA 4B3TC 5IT9D 1IBMC 3IEUA 1MKYA 3J81D 4NXNC 1XNRC 4JI6C 5LMUC 4DV3C 4DCTA 2D7VA 4DCUA 1N33C 3R9WA 1N2FA 2BJOA 2CY1A 2KZFA 1FJGC 1I94C 1N32C 1K0RA 4LFCC 2YCBA
chains in the Genus database with same CATH superfamily
3IEVA 4I9GA 1V60A 4PUIA 4DG8A 2YX1A 1QWIA 3UX2A 4RMNA 2M5HA 4BCAA 1NYEA 4LF8C 1MXBA 4BC7A 4PUGA 4LF9C 1O93A 4ZLPA 3CQ1A 4RLQA 2E8CA 1LQLA 4DV6C 4B3SC 1J5EC 1MXCA 2E8FA 1L2FA 1XMQC 2ONFA 3IMLA 4PHTA 1WH9A 4U5YD 2KZ0A 2VQEC 3JAMD 3CW8X 2XR1A 4L2ZA 2D1SA 3AF5A 4BSZA 4JYAC 3TDEA 4GXRA 1IBKC 4JI8C 2QL8A 1RY2A 2VSQA 4JI7C 2CXCA 2DPLA 4OYCA 1FLOA 4DUZC 2NCLA 5A2QD 2VQFC 5K85A 2CU6A 3CJEA 3DHVA 4IR7A 2ZZMA 2P2MA 2PN2A 4GKJC 2E5LC 1XMOC 2JMPA 1YJ7A 4GKKC 4FUTA 5BSUA 4K0KC 1MDBA 4YHHC 4DV7C 5A19A 4IZ6A 1VEHA 2Y27A 5BSMA 4DG9A 1MKYA 2VZEA 3J81D 2MM9A 4JI6C 1N33C 2D27A 2KZFA 3RG2A 3R44A 2P2JA 4DV2C 3J80D 5IWAC 2JNVA 4LFBC 3FCEA 1XRAA 3C5EA 4DR5C 2DYJA 5KYVA 2HHHC 3UZ0A 4DV5C 2P2BA 4PZPA 1ZB9A 4NXMC 4JI4C 2YWCA 1VLAA 2P02A 5IFIA 1QM4A 3TUFA 4X66C 4D56A 5T8SA 4JI1C 4RM2A 5BUQA 1O90A 4B3RC 1WCJA 2OPLA 1P4EA 3A25A 5BURA 4X64C 2Z51A 4XX2A 2PROA 4LF4C 3N54B 5BSVA 5FLXD 4DCVA 5BSRA 4MTNA 2WP0C 4LF7C 3O2EA 4R0MA 4NDNA 3H2TA 3VNQA 1O9TA 3TQIA 4BBYA 5BSWA 4DV0C 1FUGA 4X65C 3GPCA 4DR6C 1XRBA 2D1QA 4DCSA 2E8EA 1XRCA 2OBVA 4LF6C 1M6XA 4WV3A 3T1YC 2V7BA 1UWDA 3E7XA 4L7IA 2P20A 2AYAA 3CW9A 4G37A 4DR3C 1HH2P 3AF6A 2QVZX 4B3TC 1IBMC 4HPVA 5K8FA 3IEUA 3K6RA 4NXNC 5AE3A 2D7VA 4DCUA 3NYQA 3R9WA 4ODJA 5DV9A 5KYTA 3DLPX 1RG9A 1K0RA 4RLFA 4LFCC 4B3MC 4D4GA 1AMUA 1PU1A 1USPB 4JI5C 4JM1A 1PG3A 4RM3A 2ZZNA 4WS9A 3ETCA 4DR4C 4LF5C 4FUQA 2UU9C 2QW0X 4OX9C 3PROC 5E7QA 1ULTA 2KDNA 1HR0C 4LFAC 2Y4OA 3UX3A 3SO4A 4DUYC 4JV5C 3EQ6A 4LE5A 1GPMA 2OO4A 4ZJZA 2PT7G 3L8CA 1N36C 2EGTA 4X62C 2WD9A 1PA4A 3LGXA 3UOWA 2P2QA 4BC9A 4NOZA 4MH4A 4JI2C 4DR2C 2F4VC 1ZB8A 1IBLC 4I9FA 3I07A 4OXIA 3B7WA 1N34C 3GKUA 5BSTA 3E7WA 1WF3A 3A26A 5ADZA 2UXBC 4RVNA 2UUCC 1T5DX 2D1RA 2OPLB 2HJGA 2P2FA 5GTDA 1EGAA 2M5OA 3KXWA 5CZXA 4GXQA 4KTVA 3GR1A 1XS3A 3RV2A 3UEBA 1V26A 5AE1A 5LCIA 5CZVA 3EERA 1TH5A 4PROC 3I08A 1UKKA 4JI0C 2UXCC 3R9XA 4FTFA 2QVXX 1IB8A 5BUSA 3GR0A 3CQ2A 4DV3C 4GS5A 2QVYX 1N2FA 2BJOA 2CY1A 3A9UA 3NYRA 4L4QA 3FCCA 4RVOA 4G1IA 1LCIA 5AE2A 1MDFA 1I94C 4DR7C 3TR3A 1KKGA 1ML8A 3NPDA 1HNXC 2E0GA 4D57A 3OTOC 1P7LA 3LUSA 4JI3C 1HNZC 2E7GA 3T1HC 2Y4NA 1MD9A 4AQYC 2D1TA 2UXDC 4R1LA 2ZM6C 3VNRA 5H9UA 1NY8A 3ETOA 4KTTA 3A4IA 3A9VA 5T8TA 2MCQA 3PBKA 2YWBA 3LNOA 4EATA 2UUAC 3DAYA 4K0BA 3G7SA 1USPA 2BH1X 4TPSB 4ISBA 4DR1C 4DV4C 2DHMA 4R1MA 1V25A 3LAXA 4DV1C 1XNQC 5BR8C 4D4IA 2UUBC 3N2QA 1BA3A 1HNWC 2ASBA 3L95X 4YY3C 1JOSA 5A1GA 1P4EC 4KHPC 3PESA 4PUHA 3CQ3A 5JRHA 1PG4A 2ATWA 5KEIA 1MXAA 3LNVA 5LMNC 3VNSA 3NI2A 5IT9D 3IPLA 4G36A 2MMAB 3AY0A 1XHJA 1M6XC 2D28C 1XNRC 5LMUC 4DCTA 5A1IA 1O92A 1FJGC 3S82A 1T5HX 1N32C 2YCBA
chains in the Genus database with same CATH topology
3IEVA 4I9GA 4DG8A 1QWIA 4RMNA 4BCAA 1NYEA 4LF8C 1MXBA 4BC7A 4LF9C 1O93A 4ZLPA 4RLQA 2E8CA 1LQLA 4DV6C 4B3SC 1J5EC 1MXCA 2E8FA 1L2FA 1XMQC 2ONFA 3IMLA 4PHTA 1WH9A 4U5YD 2VQEC 3JAMD 3CW8X 2XR1A 4L2ZA 2D1SA 3AF5A 4BSZA 4JYAC 3TDEA 4GXRA 1IBKC 4JI8C 2QL8A 1RY2A 2VSQA 4JI7C 2CXCA 2DPLA 4OYCA 4DUZC 5A2QD 2VQFC 5K85A 3CJEA 3DHVA 4IR7A 2P2MA 2PN2A 4GKJC 2E5LC 1XMOC 2JMPA 1YJ7A 4GKKC 4FUTA 5BSUA 4K0KC 1MDBA 4YHHC 4DV7C 5A19A 4IZ6A 2Y27A 5BSMA 4DG9A 1MKYA 2VZEA 3J81D 4JI6C 1N33C 2D27A 2KZFA 3RG2A 3R44A 2P2JA 4DV2C 3J80D 5IWAC 4LFBC 3FCEA 1XRAA 3C5EA 4DR5C 2DYJA 5KYVA 2HHHC 3UZ0A 4DV5C 2P2BA 4PZPA 1ZB9A 4NXMC 4JI4C 2YWCA 1VLAA 2P02A 5IFIA 1QM4A 3TUFA 4X66C 4D56A 5T8SA 4JI1C 4RM2A 5BUQA 1O90A 4B3RC 2OPLA 5BURA 4X64C 4XX2A 2PROA 4LF4C 3N54B 5BSVA 5FLXD 4DCVA 5BSRA 4MTNA 2WP0C 4LF7C 4R0MA 4NDNA 3H2TA 3VNQA 1O9TA 3TQIA 4BBYA 5BSWA 4DV0C 1FUGA 4X65C 3GPCA 4DR6C 1XRBA 2D1QA 4DCSA 2E8EA 1XRCA 2OBVA 4LF6C 1T5HX 4WV3A 3T1YC 2V7BA 3E7XA 4L7IA 2P20A 2AYAA 3CW9A 4G37A 4DR3C 1HH2P 3AF6A 2QVZX 4B3TC 1IBMC 4HPVA 3IEUA 5K8FA 4NXNC 5AE3A 2D7VA 4DCUA 3NYQA 3R9WA 4ODJA 5DV9A 5KYTA 3DLPX 1RG9A 1K0RA 4LFCC 4RLFA 4B3MC 4D4GA 1AMUA 1USPB 4JI5C 4JM1A 1PG3A 4RM3A 4WS9A 3ETCA 4DR4C 4LF5C 4FUQA 2UU9C 2QW0X 4OX9C 3PROC 5E7QA 1ULTA 1HR0C 4LFAC 2Y4OA 3SO4A 4DUYC 4JV5C 3EQ6A 4LE5A 1GPMA 2OO4A 4ZJZA 2PT7G 3L8CA 1N36C 2EGTA 4X62C 2WD9A 1PA4A 3LGXA 3UOWA 2P2QA 4BC9A 4NOZA 4JI2C 4MH4A 4DR2C 2F4VC 1ZB8A 1IBLC 4I9FA 3I07A 4OXIA 3B7WA 1N34C 3GKUA 5BSTA 3E7WA 1WF3A 5ADZA 2UXBC 4RVNA 2UUCC 1T5DX 2D1RA 2OPLB 2HJGA 2P2FA 5GTDA 1EGAA 3KXWA 5CZXA 4GXQA 4KTVA 3GR1A 3RV2A 1V26A 5AE1A 5CZVA 3EERA 4PROC 3I08A 1UKKA 4JI0C 2UXCC 3R9XA 4FTFA 2QVXX 5BUSA 3GR0A 4DV3C 4GS5A 2QVYX 1N2FA 2BJOA 2CY1A 3A9UA 3NYRA 4L4QA 3FCCA 4RVOA 4G1IA 1LCIA 5AE2A 1MDFA 4DR7C 1KKGA 1ML8A 3NPDA 1HNXC 2E0GA 4D57A 3OTOC 1P7LA 3LUSA 4JI3C 1HNZC 2E7GA 3T1HC 2Y4NA 1MD9A 4AQYC 2D1TA 2UXDC 4R1LA 2ZM6C 3VNRA 5H9UA 3ETOA 4KTTA 3A4IA 3A9VA 5T8TA 3PBKA 2YWBA 4EATA 2UUAC 3DAYA 4K0BA 3G7SA 1USPA 2BH1X 4TPSB 4ISBA 4DR1C 4DV4C 4R1MA 1V25A 3LAXA 4DV1C 1XNQC 5BR8C 4D4IA 2UUBC 3N2QA 1BA3A 1HNWC 2ASBA 3L95X 4YY3C 1JOSA 5A1GA 4KHPC 3PESA 5JRHA 1PG4A 2ATWA 5KEIA 1MXAA 3LNVA 5LMNC 3VNSA 3NI2A 5IT9D 3IPLA 4G36A 2D28C 1XNRC 5LMUC 4DCTA 5A1IA 1O92A 1FJGC 3S82A 1I94C 1N32C 2YCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 C;  4B3M C;  3IEV A;  3J80 D;  5IWA C;  1USP B;  4JI5 C;  4LFB C;  4DR5 C;  1QWI A;  4DR4 C;  4DR7 C;  2DYJ A;  4LF5 C;  1KKG A;  1ML8 A;  2UU9 C;  1HNX C;  2HHH C;  4OX9 C;  4DV5 C;  1NYE A;  4LF8 C;  3OTO C;  1ZB9 A;  4NXM C;  1HR0 C;  4JI4 C;  3LUS A;  4LFA C;  1VLA A;  4JI3 C;  1HNZ C;  4DUY C;  4X66 C;  2E7G A;  3T1H C;  4JV5 C;  4LF9 C;  4AQY C;  4JI1 C;  2E8C A;  2UXD C;  1LQL A;  4DV6 C;  2PT7 G;  4B3S C;  4B3R C;  1N36 C;  1J5E C;  2OPL A;  2E8F A;  4X64 C;  2ZM6 C;  2EGT A;  4X62 C;  1L2F A;  1PA4 A;  4XX2 A;  1XMQ C;  2ONF A;  4LF4 C;  1WH9 A;  4MH4 A;  4NOZ A;  4JI2 C;  5FLX D;  4DCV A;  4DR2 C;  2VQE C;  2F4V C;  1ZB8 A;  2UUA C;  1IBL C;  1USP A;  3JAM D;  3I07 A;  4MTN A;  2XR1 A;  4LF7 C;  1N34 C;  3GKU A;  1WF3 A;  2UXB C;  3AF5 A;  4BSZ A;  4DR1 C;  4JYA C;  4DV4 C;  2UUC C;  2OPL B;  1IBK C;  4JI8 C;  2HJG A;  4DV1 C;  2QL8 A;  1XNQ C;  5BR8 C;  4DV0 C;  2UUB C;  4JI7 C;  4X65 C;  2CXC A;  4DR6 C;  4DUZ C;  1EGA A;  5A2Q D;  1HNW C;  2ASB A;  4DCS A;  2VQF C;  2E8E A;  4LF6 C;  3CJE A;  4YY3 C;  1JOS A;  2PN2 A;  3T1Y C;  4GKJ C;  2E5L C;  1XMO C;  2JMP A;  4KHP C;  3EER A;  4GKK C;  2ATW A;  4K0K C;  1UKK A;  4YHH C;  4DV7 C;  4JI0 C;  2UXC C;  4DR3 C;  1HH2 P;  5LMN C;  3AF6 A;  3R9X A;  4B3T C;  5IT9 D;  1IBM C;  3IEU A;  1MKY A;  3J81 D;  4NXN C;  1XNR C;  4JI6 C;  5LMU C;  4DV3 C;  4DCT A;  2D7V A;  4DCU A;  1N33 C;  3R9W A;  1N2F A;  2BJO A;  2CY1 A;  2KZF A;  1FJG C;  1I94 C;  1N32 C;  1K0R A;  4LFC C;  2YCB A; 
#chains in the Genus database with same CATH topology
 3IEV A;  4I9G A;  1V60 A;  4PUI A;  4DG8 A;  2YX1 A;  1QWI A;  3UX2 A;  4RMN A;  2M5H A;  4BCA A;  1NYE A;  4LF8 C;  1MXB A;  4BC7 A;  4PUG A;  4LF9 C;  1O93 A;  4ZLP A;  3CQ1 A;  4RLQ A;  2E8C A;  1LQL A;  4DV6 C;  4B3S C;  1J5E C;  1MXC A;  2E8F A;  1L2F A;  1XMQ C;  2ONF A;  3IML A;  4PHT A;  1WH9 A;  4U5Y D;  2KZ0 A;  2VQE C;  3JAM D;  3CW8 X;  2XR1 A;  4L2Z A;  2D1S A;  3AF5 A;  4BSZ A;  4JYA C;  3TDE A;  4GXR A;  1IBK C;  4JI8 C;  2QL8 A;  1RY2 A;  2VSQ A;  4JI7 C;  2CXC A;  2DPL A;  4OYC A;  1FLO A;  4DUZ C;  2NCL A;  5A2Q D;  2VQF C;  5K85 A;  2CU6 A;  3CJE A;  3DHV A;  4IR7 A;  2ZZM A;  2P2M A;  2PN2 A;  4GKJ C;  2E5L C;  1XMO C;  2JMP A;  1YJ7 A;  4GKK C;  4FUT A;  5BSU A;  4K0K C;  1MDB A;  4YHH C;  4DV7 C;  5A19 A;  4IZ6 A;  1VEH A;  2Y27 A;  5BSM A;  4DG9 A;  1MKY A;  2VZE A;  3J81 D;  2MM9 A;  4JI6 C;  1N33 C;  2D27 A;  2KZF A;  3RG2 A;  3R44 A;  2P2J A;  4DV2 C;  3J80 D;  5IWA C;  2JNV A;  4LFB C;  3FCE A;  1XRA A;  3C5E A;  4DR5 C;  2DYJ A;  5KYV A;  2HHH C;  3UZ0 A;  4DV5 C;  2P2B A;  4PZP A;  1ZB9 A;  4NXM C;  4JI4 C;  2YWC A;  1VLA A;  2P02 A;  5IFI A;  1QM4 A;  3TUF A;  4X66 C;  4D56 A;  5T8S A;  4JI1 C;  4RM2 A;  5BUQ A;  1O90 A;  4B3R C;  1WCJ A;  2OPL A;  1P4E A;  3A25 A;  5BUR A;  4X64 C;  2Z51 A;  4XX2 A;  2PRO A;  4LF4 C;  3N54 B;  5BSV A;  5FLX D;  4DCV A;  5BSR A;  4MTN A;  2WP0 C;  4LF7 C;  3O2E A;  4R0M A;  4NDN A;  3H2T A;  3VNQ A;  1O9T A;  3TQI A;  4BBY A;  5BSW A;  4DV0 C;  1FUG A;  4X65 C;  3GPC A;  4DR6 C;  1XRB A;  2D1Q A;  4DCS A;  2E8E A;  1XRC A;  2OBV A;  4LF6 C;  1M6X A;  4WV3 A;  3T1Y C;  2V7B A;  1UWD A;  3E7X A;  4L7I A;  2P20 A;  2AYA A;  3CW9 A;  4G37 A;  4DR3 C;  1HH2 P;  3AF6 A;  2QVZ X;  4B3T C;  1IBM C;  4HPV A;  5K8F A;  3IEU A;  3K6R A;  4NXN C;  5AE3 A;  2D7V A;  4DCU A;  3NYQ A;  3R9W A;  4ODJ A;  5DV9 A;  5KYT A;  3DLP X;  1RG9 A;  1K0R A;  4RLF A;  4LFC C;  4B3M C;  4D4G A;  1AMU A;  1PU1 A;  1USP B;  4JI5 C;  4JM1 A;  1PG3 A;  4RM3 A;  2ZZN A;  4WS9 A;  3ETC A;  4DR4 C;  4LF5 C;  4FUQ A;  2UU9 C;  2QW0 X;  4OX9 C;  3PRO C;  5E7Q A;  1ULT A;  2KDN A;  1HR0 C;  4LFA C;  2Y4O A;  3UX3 A;  3SO4 A;  4DUY C;  4JV5 C;  3EQ6 A;  4LE5 A;  1GPM A;  2OO4 A;  4ZJZ A;  2PT7 G;  3L8C A;  1N36 C;  2EGT A;  4X62 C;  2WD9 A;  1PA4 A;  3LGX A;  3UOW A;  2P2Q A;  4BC9 A;  4NOZ A;  4MH4 A;  4JI2 C;  4DR2 C;  2F4V C;  1ZB8 A;  1IBL C;  4I9F A;  3I07 A;  4OXI A;  3B7W A;  1N34 C;  3GKU A;  5BST A;  3E7W A;  1WF3 A;  3A26 A;  5ADZ A;  2UXB C;  4RVN A;  2UUC C;  1T5D X;  2D1R A;  2OPL B;  2HJG A;  2P2F A;  5GTD A;  1EGA A;  2M5O A;  3KXW A;  5CZX A;  4GXQ A;  4KTV A;  3GR1 A;  1XS3 A;  3RV2 A;  3UEB A;  1V26 A;  5AE1 A;  5LCI A;  5CZV A;  3EER A;  1TH5 A;  4PRO C;  3I08 A;  1UKK A;  4JI0 C;  2UXC C;  3R9X A;  4FTF A;  2QVX X;  1IB8 A;  5BUS A;  3GR0 A;  3CQ2 A;  4DV3 C;  4GS5 A;  2QVY X;  1N2F A;  2BJO A;  2CY1 A;  3A9U A;  3NYR A;  4L4Q A;  3FCC A;  4RVO A;  4G1I A;  1LCI A;  5AE2 A;  1MDF A;  1I94 C;  4DR7 C;  3TR3 A;  1KKG A;  1ML8 A;  3NPD A;  1HNX C;  2E0G A;  4D57 A;  3OTO C;  1P7L A;  3LUS A;  4JI3 C;  1HNZ C;  2E7G A;  3T1H C;  2Y4N A;  1MD9 A;  4AQY C;  2D1T A;  2UXD C;  4R1L A;  2ZM6 C;  3VNR A;  5H9U A;  1NY8 A;  3ETO A;  4KTT A;  3A4I A;  3A9V A;  5T8T A;  2MCQ A;  3PBK A;  2YWB A;  3LNO A;  4EAT A;  2UUA C;  3DAY A;  4K0B A;  3G7S A;  1USP A;  2BH1 X;  4TPS B;  4ISB A;  4DR1 C;  4DV4 C;  2DHM A;  4R1M A;  1V25 A;  3LAX A;  4DV1 C;  1XNQ C;  5BR8 C;  4D4I A;  2UUB C;  3N2Q A;  1BA3 A;  1HNW C;  2ASB A;  3L95 X;  4YY3 C;  1JOS A;  5A1G A;  1P4E C;  4KHP C;  3PES A;  4PUH A;  3CQ3 A;  5JRH A;  1PG4 A;  2ATW A;  5KEI A;  1MXA A;  3LNV A;  5LMN C;  3VNS A;  3NI2 A;  5IT9 D;  3IPL A;  4G36 A;  2MMA B;  3AY0 A;  1XHJ A;  1M6X C;  2D28 C;  1XNR C;  5LMU C;  4DCT A;  5A1I A;  1O92 A;  1FJG C;  3S82 A;  1T5H X;  1N32 C;  2YCB A; 
#chains in the Genus database with same CATH homology
 3IEV A;  4I9G A;  4DG8 A;  1QWI A;  4RMN A;  4BCA A;  1NYE A;  4LF8 C;  1MXB A;  4BC7 A;  4LF9 C;  1O93 A;  4ZLP A;  4RLQ A;  2E8C A;  1LQL A;  4DV6 C;  4B3S C;  1J5E C;  1MXC A;  2E8F A;  1L2F A;  1XMQ C;  2ONF A;  3IML A;  4PHT A;  1WH9 A;  4U5Y D;  2VQE C;  3JAM D;  3CW8 X;  2XR1 A;  4L2Z A;  2D1S A;  3AF5 A;  4BSZ A;  4JYA C;  3TDE A;  4GXR A;  1IBK C;  4JI8 C;  2QL8 A;  1RY2 A;  2VSQ A;  4JI7 C;  2CXC A;  2DPL A;  4OYC A;  4DUZ C;  5A2Q D;  2VQF C;  5K85 A;  3CJE A;  3DHV A;  4IR7 A;  2P2M A;  2PN2 A;  4GKJ C;  2E5L C;  1XMO C;  2JMP A;  1YJ7 A;  4GKK C;  4FUT A;  5BSU A;  4K0K C;  1MDB A;  4YHH C;  4DV7 C;  5A19 A;  4IZ6 A;  2Y27 A;  5BSM A;  4DG9 A;  1MKY A;  2VZE A;  3J81 D;  4JI6 C;  1N33 C;  2D27 A;  2KZF A;  3RG2 A;  3R44 A;  2P2J A;  4DV2 C;  3J80 D;  5IWA C;  4LFB C;  3FCE A;  1XRA A;  3C5E A;  4DR5 C;  2DYJ A;  5KYV A;  2HHH C;  3UZ0 A;  4DV5 C;  2P2B A;  4PZP A;  1ZB9 A;  4NXM C;  4JI4 C;  2YWC A;  1VLA A;  2P02 A;  5IFI A;  1QM4 A;  3TUF A;  4X66 C;  4D56 A;  5T8S A;  4JI1 C;  4RM2 A;  5BUQ A;  1O90 A;  4B3R C;  2OPL A;  5BUR A;  4X64 C;  4XX2 A;  2PRO A;  4LF4 C;  3N54 B;  5BSV A;  5FLX D;  4DCV A;  5BSR A;  4MTN A;  2WP0 C;  4LF7 C;  4R0M A;  4NDN A;  3H2T A;  3VNQ A;  1O9T A;  3TQI A;  4BBY A;  5BSW A;  4DV0 C;  1FUG A;  4X65 C;  3GPC A;  4DR6 C;  1XRB A;  2D1Q A;  4DCS A;  2E8E A;  1XRC A;  2OBV A;  4LF6 C;  1T5H X;  4WV3 A;  3T1Y C;  2V7B A;  3E7X A;  4L7I A;  2P20 A;  2AYA A;  3CW9 A;  4G37 A;  4DR3 C;  1HH2 P;  3AF6 A;  2QVZ X;  4B3T C;  1IBM C;  4HPV A;  3IEU A;  5K8F A;  4NXN C;  5AE3 A;  2D7V A;  4DCU A;  3NYQ A;  3R9W A;  4ODJ A;  5DV9 A;  5KYT A;  3DLP X;  1RG9 A;  1K0R A;  4LFC C;  4RLF A;  4B3M C;  4D4G A;  1AMU A;  1USP B;  4JI5 C;  4JM1 A;  1PG3 A;  4RM3 A;  4WS9 A;  3ETC A;  4DR4 C;  4LF5 C;  4FUQ A;  2UU9 C;  2QW0 X;  4OX9 C;  3PRO C;  5E7Q A;  1ULT A;  1HR0 C;  4LFA C;  2Y4O A;  3SO4 A;  4DUY C;  4JV5 C;  3EQ6 A;  4LE5 A;  1GPM A;  2OO4 A;  4ZJZ A;  2PT7 G;  3L8C A;  1N36 C;  2EGT A;  4X62 C;  2WD9 A;  1PA4 A;  3LGX A;  3UOW A;  2P2Q A;  4BC9 A;  4NOZ A;  4JI2 C;  4MH4 A;  4DR2 C;  2F4V C;  1ZB8 A;  1IBL C;  4I9F A;  3I07 A;  4OXI A;  3B7W A;  1N34 C;  3GKU A;  5BST A;  3E7W A;  1WF3 A;  5ADZ A;  2UXB C;  4RVN A;  2UUC C;  1T5D X;  2D1R A;  2OPL B;  2HJG A;  2P2F A;  5GTD A;  1EGA A;  3KXW A;  5CZX A;  4GXQ A;  4KTV A;  3GR1 A;  3RV2 A;  1V26 A;  5AE1 A;  5CZV A;  3EER A;  4PRO C;  3I08 A;  1UKK A;  4JI0 C;  2UXC C;  3R9X A;  4FTF A;  2QVX X;  5BUS A;  3GR0 A;  4DV3 C;  4GS5 A;  2QVY X;  1N2F A;  2BJO A;  2CY1 A;  3A9U A;  3NYR A;  4L4Q A;  3FCC A;  4RVO A;  4G1I A;  1LCI A;  5AE2 A;  1MDF A;  4DR7 C;  1KKG A;  1ML8 A;  3NPD A;  1HNX C;  2E0G A;  4D57 A;  3OTO C;  1P7L A;  3LUS A;  4JI3 C;  1HNZ C;  2E7G A;  3T1H C;  2Y4N A;  1MD9 A;  4AQY C;  2D1T A;  2UXD C;  4R1L A;  2ZM6 C;  3VNR A;  5H9U A;  3ETO A;  4KTT A;  3A4I A;  3A9V A;  5T8T A;  3PBK A;  2YWB A;  4EAT A;  2UUA C;  3DAY A;  4K0B A;  3G7S A;  1USP A;  2BH1 X;  4TPS B;  4ISB A;  4DR1 C;  4DV4 C;  4R1M A;  1V25 A;  3LAX A;  4DV1 C;  1XNQ C;  5BR8 C;  4D4I A;  2UUB C;  3N2Q A;  1BA3 A;  1HNW C;  2ASB A;  3L95 X;  4YY3 C;  1JOS A;  5A1G A;  4KHP C;  3PES A;  5JRH A;  1PG4 A;  2ATW A;  5KEI A;  1MXA A;  3LNV A;  5LMN C;  3VNS A;  3NI2 A;  5IT9 D;  3IPL A;  4G36 A;  2D28 C;  1XNR C;  5LMU C;  4DCT A;  5A1I A;  1O92 A;  1FJG C;  3S82 A;  1I94 C;  1N32 C;  2YCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...