2BH1X

X-ray structure of the general secretion pathway complex of the n- terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
IRRLPFSFANRFKLVLDWNEDFSQASIYYLAPLSMEALVETKRVVKHAFQLIELSQAEFESKLTQVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of the Type II Secretion System Complex Formed by the N-Terminal Domain of Epse and the Cytoplasmic Domain of Epsl of Vibrio Cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport protein
molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
total genus 15
structure length 68
sequence length 68
chains with identical sequence Y
ec nomenclature
pdb deposition date 2005-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bh1X00
4PHTA 2D28C 2D27A 2BH1X
chains in the Genus database with same CATH superfamily
4JI2C 4JYAC 4PUIA 5GTDA 4JV5C 4TPSB 1UKKA 1M6XC 2MM9A 4DV2C 4WS9A 2Y4OA 5BURA 4JI3C 5BUSA 3I07A 5IT9D 3T1HC 4AQYC 3RG2A 3J80D 2ASBA 1FJGC 3UZ0A 4JI6C 4JI8C 4B3SC 2V7BA 4JI1C 4DG9A 4LF8C 2DHMA 3IEUA 4DCTA 2HHHC 1PG3A 4D56A 3R9WA 4PZPA 1HNWC 3A26A 4YHHC 3EQ6A 1V60A 2JMPA 2KZ0A 5A1IA 1YJ7A 4JI0C 1XRBA 2Z51A 2BH1X 2CXCA 4DUYC 1PU1A 4LF7C 2P02A 3I08A 5JRHA 1P4EC 4LFBC 3RV2A 2YWCA 4RVOA 2E8FA 5BSRA 3A25A 2YCBA 3ETOA 4OYCA 3AF6A 3LUSA 1PG4A 2MCQA 1IBMC 4KHPC 1RG9A 1EGAA 2PT7G 1QWIA 2QVXX 3H2TA 5A1GA 3J81D 3IMLA 4BCAA 5A19A 2KZFA 4BC9A 1M6XA 4WV3A 3VNRA 5T8SA 4DCUA 1N33C 4DR4C 3E7WA 4GXQA 1NY8A 5BSVA 4JI5C 2UXCC 4L4QA 4B3MC 4RLQA 5LMNC 1T5DX 3CQ2A 2AYAA 4DR1C 3L8CA 3LNVA 2Y27A 3IEVA 3NYRA 4MH4A 2QL8A 5KYTA 4JI4C 1GPMA 4KTTA 5AE3A 3JAMD 5H9UA 1FLOA 4R0MA 4NDNA 4R1MA 2WP0C 4DG8A 5AE1A 1MXAA 4JM1A 2OPLA 2WD9A 2NCLA 4HPVA 5DV9A 4DR3C 1HH2P 3TR3A 1N2FA 2JNVA 2EGTA 1ML8A 4IZ6A 4FUQA 4L2ZA 1LCIA 4GS5A 4X64C 4LF4C 3GR0A 1WCJA 4YY3C 5BSMA 1HR0C 3ETCA 4I9GA 2M5OA 3CW9A 2D7VA 4DV3C 2ZM6C 2VQFC 3LGXA 2ATWA 4IR7A 2PN2A 1VEHA 4DV6C 3PROC 1ZB8A 2P2BA 2ZZMA 1UWDA 2QVZX 4JI7C 4RM2A 4KTVA 4I9FA 2P2MA 3UX2A 4DV0C 3TUFA 2VSQA 4GKJC 1ULTA 2P2QA 4G37A 2VZEA 3GKUA 4X62C 3K6RA 4D4IA 3A4IA 4NOZA 1T5HX 4RVNA 4B3TC 1IBKC 5KEIA 1XMQC 5BSTA 4BBYA 2E8CA 3A9UA 2UXBC 4RMNA 2UUBC 4BC7A 1MDFA 4MTNA 1XHJA 1NYEA 4G1IA 1MKYA 4D57A 2E5LC 3OTOC 2Y4NA 4LFAC 5IFIA 2D1SA 5IWAC 3N54B 5BSWA 4RM3A 2ONFA 2OO4A 4ISBA 4L7IA 4U5YD 2E0GA 4GXRA 4X66C 3CW8X 4G36A 2D28C 5ADZA 2D1TA 4FTFA 4RLFA 4K0KC 3O2EA 3SO4A 4PUGA 1LQLA 1MXBA 2E8EA 3AY0A 2YX1A 3UEBA 4DCSA 4LF5C 5LCIA 5E7QA 1XNRC 4DR2C 1K0RA 4DR5C 1WF3A 4PUHA 3NPDA 2UUAC 1O9TA 1USPA 5A2QD 3T1YC 1V25A 3TDEA 1FUGA 3CQ3A 3VNSA 2KDNA 1JOSA 5K85A 1XMOC 3PESA 4DV7C 4PROC 3TQIA 4ZJZA 4DR6C 4OXIA 5T8TA 5CZXA 3E7XA 1WH9A 4PHTA 1O93A 4B3RC 1O90A 2QW0X 4R1LA 1P4EA 3DHVA 1V26A 1TH5A 2XR1A 1P7LA 2UUCC 1USPB 3IPLA 1N34C 1RY2A 5LMUC 1MXCA 3CQ1A 4LE5A 1AMUA 1HNXC 2BJOA 2OBVA 1BA3A 2UXDC 4LFCC 1I94C 2D1QA 3R44A 1HNZC 2M5HA 3LNOA 4LF9C 2DYJA 1XRCA 5CZVA 5BR8C 5BUQA 4ZLPA 1L2FA 1O92A 1MDBA 2HJGA 5FLXD 4D4GA 1IBLC 2E7GA 2OPLB 3N2QA 4LF6C 4DV1C 2D27A 1VLAA 1N32C 1ZB9A 3R9XA 3LAXA 2F4VC 1XS3A 2VQEC 3G7SA 4GKKC 3PBKA 2P20A 2DPLA 2ZZNA 2QVYX 4NXNC 3DLPX 2YWBA 4DCVA 1QM4A 3NYQA 5K8FA 2CU6A 1PA4A 1XNQC 4DV4C 1J5EC 5KYVA 3B7WA 4DUZC 3C5EA 3FCCA 4BSZA 4EATA 3GPCA 3L95X 3KXWA 4DV5C 3S82A 3DAYA 4DR7C 1N36C 1IB8A 2MMAB 2UU9C 2D1RA 4FUTA 5BSUA 4K0BA 2P2FA 3FCEA 3AF5A 3CJEA 2PROA 2CY1A 3EERA 4ODJA 4X65C 3A9VA 4XX2A 3NI2A 1XRAA 3UX3A 4OX9C 5AE2A 2P2JA 4NXMC 3VNQA 1KKGA 3UOWA 1MD9A 3GR1A
chains in the Genus database with same CATH topology
4JI2C 4JYAC 4JV5C 5GTDA 4TPSB 1UKKA 4DV2C 4WS9A 2Y4OA 5BURA 4JI3C 5BUSA 3I07A 5IT9D 3T1HC 4AQYC 3RG2A 3J80D 2ASBA 1FJGC 3UZ0A 4JI6C 4JI8C 4B3SC 4JI1C 2V7BA 4DG9A 4LF8C 3IEUA 4DCTA 2HHHC 1PG3A 4D56A 3R9WA 4PZPA 1HNWC 4YHHC 3EQ6A 2JMPA 5A1IA 1YJ7A 4JI0C 1XRBA 2BH1X 2CXCA 4DUYC 4LF7C 2P02A 3I08A 5JRHA 4LFBC 3RV2A 2YWCA 4RVOA 2E8FA 5BSRA 2YCBA 3ETOA 4OYCA 3AF6A 3LUSA 1PG4A 1IBMC 4KHPC 1RG9A 1EGAA 2PT7G 1QWIA 2QVXX 3H2TA 5A1GA 3J81D 3IMLA 4BCAA 5A19A 2KZFA 4BC9A 4WV3A 3VNRA 5T8SA 4DCUA 1N33C 4DR4C 3E7WA 4GXQA 5BSVA 4JI5C 2UXCC 4L4QA 4B3MC 4RLQA 5LMNC 1T5DX 2AYAA 4DR1C 3L8CA 3LNVA 2Y27A 3IEVA 3NYRA 4MH4A 2QL8A 5KYTA 4JI4C 1GPMA 4KTTA 5AE3A 3JAMD 5H9UA 4R0MA 4NDNA 4R1MA 2WP0C 4DG8A 5AE1A 1MXAA 4JM1A 2OPLA 2WD9A 4HPVA 5DV9A 4DR3C 1HH2P 1N2FA 2EGTA 1ML8A 4IZ6A 4FUQA 4L2ZA 1LCIA 4GS5A 4X64C 4LF4C 3GR0A 4YY3C 5BSMA 1HR0C 3ETCA 4I9GA 3CW9A 2D7VA 4DV3C 2ZM6C 2VQFC 3LGXA 2ATWA 4IR7A 2PN2A 4DV6C 3PROC 1ZB8A 2P2BA 2QVZX 4JI7C 4RM2A 4KTVA 4I9FA 2P2MA 4DV0C 3TUFA 2VSQA 4GKJC 1ULTA 2P2QA 4G37A 2VZEA 3GKUA 4X62C 4D4IA 3A4IA 4NOZA 1T5HX 4RVNA 4B3TC 1IBKC 5KEIA 1XMQC 5BSTA 4BBYA 2E8CA 3A9UA 2UXBC 4RMNA 2UUBC 4BC7A 1MDFA 4MTNA 1NYEA 4G1IA 1MKYA 4D57A 2E5LC 3OTOC 2Y4NA 4LFAC 5IFIA 2D1SA 5IWAC 3N54B 5BSWA 4RM3A 2ONFA 2OO4A 4ISBA 4L7IA 4U5YD 2E0GA 4GXRA 4X66C 3CW8X 4G36A 2D28C 5ADZA 2D1TA 4FTFA 4RLFA 4K0KC 3SO4A 1LQLA 1MXBA 2E8EA 4DCSA 4LF5C 5E7QA 1XNRC 4DR2C 1K0RA 4DR5C 1WF3A 3NPDA 2UUAC 1O9TA 1USPA 5A2QD 3T1YC 1V25A 3TDEA 1FUGA 3VNSA 1JOSA 5K85A 1XMOC 3PESA 4DV7C 4PROC 3TQIA 4ZJZA 4DR6C 4OXIA 5T8TA 5CZXA 3E7XA 1WH9A 4PHTA 1O93A 4B3RC 1O90A 2QW0X 4R1LA 3DHVA 1V26A 2XR1A 1P7LA 2UUCC 1USPB 3IPLA 1N34C 1RY2A 5LMUC 1MXCA 4LE5A 1AMUA 1HNXC 2BJOA 2OBVA 1BA3A 2UXDC 4LFCC 1I94C 2D1QA 3R44A 1HNZC 4LF9C 2DYJA 1XRCA 5CZVA 5BR8C 5BUQA 4ZLPA 1L2FA 1O92A 1MDBA 2HJGA 5FLXD 4D4GA 1IBLC 2E7GA 2OPLB 3N2QA 4LF6C 4DV1C 2D27A 1VLAA 1N32C 1ZB9A 3R9XA 3LAXA 2F4VC 2VQEC 3G7SA 4GKKC 3PBKA 2P20A 2DPLA 2QVYX 4NXNC 3DLPX 2YWBA 4DCVA 1QM4A 3NYQA 5K8FA 1PA4A 1XNQC 4DV4C 1J5EC 5KYVA 3B7WA 4DUZC 3C5EA 3FCCA 4BSZA 4EATA 3GPCA 3L95X 3KXWA 4DV5C 3S82A 3DAYA 4DR7C 1N36C 2UU9C 2D1RA 4FUTA 5BSUA 4K0BA 2P2FA 3FCEA 3AF5A 3CJEA 2PROA 2CY1A 3EERA 4ODJA 4X65C 3A9VA 4XX2A 3NI2A 1XRAA 4OX9C 5AE2A 2P2JA 4NXMC 3VNQA 1KKGA 3UOWA 1MD9A 3GR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHT A;  2D28 C;  2D27 A;  2BH1 X; 
#chains in the Genus database with same CATH topology
 4JI2 C;  4JYA C;  4PUI A;  5GTD A;  4JV5 C;  4TPS B;  1UKK A;  1M6X C;  2MM9 A;  4DV2 C;  4WS9 A;  2Y4O A;  5BUR A;  4JI3 C;  5BUS A;  3I07 A;  5IT9 D;  3T1H C;  4AQY C;  3RG2 A;  3J80 D;  2ASB A;  1FJG C;  3UZ0 A;  4JI6 C;  4JI8 C;  4B3S C;  2V7B A;  4JI1 C;  4DG9 A;  4LF8 C;  2DHM A;  3IEU A;  4DCT A;  2HHH C;  1PG3 A;  4D56 A;  3R9W A;  4PZP A;  1HNW C;  3A26 A;  4YHH C;  3EQ6 A;  1V60 A;  2JMP A;  2KZ0 A;  5A1I A;  1YJ7 A;  4JI0 C;  1XRB A;  2Z51 A;  2BH1 X;  2CXC A;  4DUY C;  1PU1 A;  4LF7 C;  2P02 A;  3I08 A;  5JRH A;  1P4E C;  4LFB C;  3RV2 A;  2YWC A;  4RVO A;  2E8F A;  5BSR A;  3A25 A;  2YCB A;  3ETO A;  4OYC A;  3AF6 A;  3LUS A;  1PG4 A;  2MCQ A;  1IBM C;  4KHP C;  1RG9 A;  1EGA A;  2PT7 G;  1QWI A;  2QVX X;  3H2T A;  5A1G A;  3J81 D;  3IML A;  4BCA A;  5A19 A;  2KZF A;  4BC9 A;  1M6X A;  4WV3 A;  3VNR A;  5T8S A;  4DCU A;  1N33 C;  4DR4 C;  3E7W A;  4GXQ A;  1NY8 A;  5BSV A;  4JI5 C;  2UXC C;  4L4Q A;  4B3M C;  4RLQ A;  5LMN C;  1T5D X;  3CQ2 A;  2AYA A;  4DR1 C;  3L8C A;  3LNV A;  2Y27 A;  3IEV A;  3NYR A;  4MH4 A;  2QL8 A;  5KYT A;  4JI4 C;  1GPM A;  4KTT A;  5AE3 A;  3JAM D;  5H9U A;  1FLO A;  4R0M A;  4NDN A;  4R1M A;  2WP0 C;  4DG8 A;  5AE1 A;  1MXA A;  4JM1 A;  2OPL A;  2WD9 A;  2NCL A;  4HPV A;  5DV9 A;  4DR3 C;  1HH2 P;  3TR3 A;  1N2F A;  2JNV A;  2EGT A;  1ML8 A;  4IZ6 A;  4FUQ A;  4L2Z A;  1LCI A;  4GS5 A;  4X64 C;  4LF4 C;  3GR0 A;  1WCJ A;  4YY3 C;  5BSM A;  1HR0 C;  3ETC A;  4I9G A;  2M5O A;  3CW9 A;  2D7V A;  4DV3 C;  2ZM6 C;  2VQF C;  3LGX A;  2ATW A;  4IR7 A;  2PN2 A;  1VEH A;  4DV6 C;  3PRO C;  1ZB8 A;  2P2B A;  2ZZM A;  1UWD A;  2QVZ X;  4JI7 C;  4RM2 A;  4KTV A;  4I9F A;  2P2M A;  3UX2 A;  4DV0 C;  3TUF A;  2VSQ A;  4GKJ C;  1ULT A;  2P2Q A;  4G37 A;  2VZE A;  3GKU A;  4X62 C;  3K6R A;  4D4I A;  3A4I A;  4NOZ A;  1T5H X;  4RVN A;  4B3T C;  1IBK C;  5KEI A;  1XMQ C;  5BST A;  4BBY A;  2E8C A;  3A9U A;  2UXB C;  4RMN A;  2UUB C;  4BC7 A;  1MDF A;  4MTN A;  1XHJ A;  1NYE A;  4G1I A;  1MKY A;  4D57 A;  2E5L C;  3OTO C;  2Y4N A;  4LFA C;  5IFI A;  2D1S A;  5IWA C;  3N54 B;  5BSW A;  4RM3 A;  2ONF A;  2OO4 A;  4ISB A;  4L7I A;  4U5Y D;  2E0G A;  4GXR A;  4X66 C;  3CW8 X;  4G36 A;  2D28 C;  5ADZ A;  2D1T A;  4FTF A;  4RLF A;  4K0K C;  3O2E A;  3SO4 A;  4PUG A;  1LQL A;  1MXB A;  2E8E A;  3AY0 A;  2YX1 A;  3UEB A;  4DCS A;  4LF5 C;  5LCI A;  5E7Q A;  1XNR C;  4DR2 C;  1K0R A;  4DR5 C;  1WF3 A;  4PUH A;  3NPD A;  2UUA C;  1O9T A;  1USP A;  5A2Q D;  3T1Y C;  1V25 A;  3TDE A;  1FUG A;  3CQ3 A;  3VNS A;  2KDN A;  1JOS A;  5K85 A;  1XMO C;  3PES A;  4DV7 C;  4PRO C;  3TQI A;  4ZJZ A;  4DR6 C;  4OXI A;  5T8T A;  5CZX A;  3E7X A;  1WH9 A;  4PHT A;  1O93 A;  4B3R C;  1O90 A;  2QW0 X;  4R1L A;  1P4E A;  3DHV A;  1V26 A;  1TH5 A;  2XR1 A;  1P7L A;  2UUC C;  1USP B;  3IPL A;  1N34 C;  1RY2 A;  5LMU C;  1MXC A;  3CQ1 A;  4LE5 A;  1AMU A;  1HNX C;  2BJO A;  2OBV A;  1BA3 A;  2UXD C;  4LFC C;  1I94 C;  2D1Q A;  3R44 A;  1HNZ C;  2M5H A;  3LNO A;  4LF9 C;  2DYJ A;  1XRC A;  5CZV A;  5BR8 C;  5BUQ A;  4ZLP A;  1L2F A;  1O92 A;  1MDB A;  2HJG A;  5FLX D;  4D4G A;  1IBL C;  2E7G A;  2OPL B;  3N2Q A;  4LF6 C;  4DV1 C;  2D27 A;  1VLA A;  1N32 C;  1ZB9 A;  3R9X A;  3LAX A;  2F4V C;  1XS3 A;  2VQE C;  3G7S A;  4GKK C;  3PBK A;  2P20 A;  2DPL A;  2ZZN A;  2QVY X;  4NXN C;  3DLP X;  2YWB A;  4DCV A;  1QM4 A;  3NYQ A;  5K8F A;  2CU6 A;  1PA4 A;  1XNQ C;  4DV4 C;  1J5E C;  5KYV A;  3B7W A;  4DUZ C;  3C5E A;  3FCC A;  4BSZ A;  4EAT A;  3GPC A;  3L95 X;  3KXW A;  4DV5 C;  3S82 A;  3DAY A;  4DR7 C;  1N36 C;  1IB8 A;  2MMA B;  2UU9 C;  2D1R A;  4FUT A;  5BSU A;  4K0B A;  2P2F A;  3FCE A;  3AF5 A;  3CJE A;  2PRO A;  2CY1 A;  3EER A;  4ODJ A;  4X65 C;  3A9V A;  4XX2 A;  3NI2 A;  1XRA A;  3UX3 A;  4OX9 C;  5AE2 A;  2P2J A;  4NXM C;  3VNQ A;  1KKG A;  3UOW A;  1MD9 A;  3GR1 A; 
#chains in the Genus database with same CATH homology
 4JI2 C;  4JYA C;  4JV5 C;  5GTD A;  4TPS B;  1UKK A;  4DV2 C;  4WS9 A;  2Y4O A;  5BUR A;  4JI3 C;  5BUS A;  3I07 A;  5IT9 D;  3T1H C;  4AQY C;  3RG2 A;  3J80 D;  2ASB A;  1FJG C;  3UZ0 A;  4JI6 C;  4JI8 C;  4B3S C;  4JI1 C;  2V7B A;  4DG9 A;  4LF8 C;  3IEU A;  4DCT A;  2HHH C;  1PG3 A;  4D56 A;  3R9W A;  4PZP A;  1HNW C;  4YHH C;  3EQ6 A;  2JMP A;  5A1I A;  1YJ7 A;  4JI0 C;  1XRB A;  2BH1 X;  2CXC A;  4DUY C;  4LF7 C;  2P02 A;  3I08 A;  5JRH A;  4LFB C;  3RV2 A;  2YWC A;  4RVO A;  2E8F A;  5BSR A;  2YCB A;  3ETO A;  4OYC A;  3AF6 A;  3LUS A;  1PG4 A;  1IBM C;  4KHP C;  1RG9 A;  1EGA A;  2PT7 G;  1QWI A;  2QVX X;  3H2T A;  5A1G A;  3J81 D;  3IML A;  4BCA A;  5A19 A;  2KZF A;  4BC9 A;  4WV3 A;  3VNR A;  5T8S A;  4DCU A;  1N33 C;  4DR4 C;  3E7W A;  4GXQ A;  5BSV A;  4JI5 C;  2UXC C;  4L4Q A;  4B3M C;  4RLQ A;  5LMN C;  1T5D X;  2AYA A;  4DR1 C;  3L8C A;  3LNV A;  2Y27 A;  3IEV A;  3NYR A;  4MH4 A;  2QL8 A;  5KYT A;  4JI4 C;  1GPM A;  4KTT A;  5AE3 A;  3JAM D;  5H9U A;  4R0M A;  4NDN A;  4R1M A;  2WP0 C;  4DG8 A;  5AE1 A;  1MXA A;  4JM1 A;  2OPL A;  2WD9 A;  4HPV A;  5DV9 A;  4DR3 C;  1HH2 P;  1N2F A;  2EGT A;  1ML8 A;  4IZ6 A;  4FUQ A;  4L2Z A;  1LCI A;  4GS5 A;  4X64 C;  4LF4 C;  3GR0 A;  4YY3 C;  5BSM A;  1HR0 C;  3ETC A;  4I9G A;  3CW9 A;  2D7V A;  4DV3 C;  2ZM6 C;  2VQF C;  3LGX A;  2ATW A;  4IR7 A;  2PN2 A;  4DV6 C;  3PRO C;  1ZB8 A;  2P2B A;  2QVZ X;  4JI7 C;  4RM2 A;  4KTV A;  4I9F A;  2P2M A;  4DV0 C;  3TUF A;  2VSQ A;  4GKJ C;  1ULT A;  2P2Q A;  4G37 A;  2VZE A;  3GKU A;  4X62 C;  4D4I A;  3A4I A;  4NOZ A;  1T5H X;  4RVN A;  4B3T C;  1IBK C;  5KEI A;  1XMQ C;  5BST A;  4BBY A;  2E8C A;  3A9U A;  2UXB C;  4RMN A;  2UUB C;  4BC7 A;  1MDF A;  4MTN A;  1NYE A;  4G1I A;  1MKY A;  4D57 A;  2E5L C;  3OTO C;  2Y4N A;  4LFA C;  5IFI A;  2D1S A;  5IWA C;  3N54 B;  5BSW A;  4RM3 A;  2ONF A;  2OO4 A;  4ISB A;  4L7I A;  4U5Y D;  2E0G A;  4GXR A;  4X66 C;  3CW8 X;  4G36 A;  2D28 C;  5ADZ A;  2D1T A;  4FTF A;  4RLF A;  4K0K C;  3SO4 A;  1LQL A;  1MXB A;  2E8E A;  4DCS A;  4LF5 C;  5E7Q A;  1XNR C;  4DR2 C;  1K0R A;  4DR5 C;  1WF3 A;  3NPD A;  2UUA C;  1O9T A;  1USP A;  5A2Q D;  3T1Y C;  1V25 A;  3TDE A;  1FUG A;  3VNS A;  1JOS A;  5K85 A;  1XMO C;  3PES A;  4DV7 C;  4PRO C;  3TQI A;  4ZJZ A;  4DR6 C;  4OXI A;  5T8T A;  5CZX A;  3E7X A;  1WH9 A;  4PHT A;  1O93 A;  4B3R C;  1O90 A;  2QW0 X;  4R1L A;  3DHV A;  1V26 A;  2XR1 A;  1P7L A;  2UUC C;  1USP B;  3IPL A;  1N34 C;  1RY2 A;  5LMU C;  1MXC A;  4LE5 A;  1AMU A;  1HNX C;  2BJO A;  2OBV A;  1BA3 A;  2UXD C;  4LFC C;  1I94 C;  2D1Q A;  3R44 A;  1HNZ C;  4LF9 C;  2DYJ A;  1XRC A;  5CZV A;  5BR8 C;  5BUQ A;  4ZLP A;  1L2F A;  1O92 A;  1MDB A;  2HJG A;  5FLX D;  4D4G A;  1IBL C;  2E7G A;  2OPL B;  3N2Q A;  4LF6 C;  4DV1 C;  2D27 A;  1VLA A;  1N32 C;  1ZB9 A;  3R9X A;  3LAX A;  2F4V C;  2VQE C;  3G7S A;  4GKK C;  3PBK A;  2P20 A;  2DPL A;  2QVY X;  4NXN C;  3DLP X;  2YWB A;  4DCV A;  1QM4 A;  3NYQ A;  5K8F A;  1PA4 A;  1XNQ C;  4DV4 C;  1J5E C;  5KYV A;  3B7W A;  4DUZ C;  3C5E A;  3FCC A;  4BSZ A;  4EAT A;  3GPC A;  3L95 X;  3KXW A;  4DV5 C;  3S82 A;  3DAY A;  4DR7 C;  1N36 C;  2UU9 C;  2D1R A;  4FUT A;  5BSU A;  4K0B A;  2P2F A;  3FCE A;  3AF5 A;  3CJE A;  2PRO A;  2CY1 A;  3EER A;  4ODJ A;  4X65 C;  3A9V A;  4XX2 A;  3NI2 A;  1XRA A;  4OX9 C;  5AE2 A;  2P2J A;  4NXM C;  3VNQ A;  1KKG A;  3UOW A;  1MD9 A;  3GR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...