2BH1X

X-ray structure of the general secretion pathway complex of the n- terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
IRRLPFSFANRFKLVLDWNEDFSQASIYYLAPLSMEALVETKRVVKHAFQLIELSQAEFESKLTQVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
publication title The X-Ray Structure of the Type II Secretion System Complex Formed by the N-Terminal Domain of Epse and the Cytoplasmic Domain of Epsl of Vibrio Cholerae
pubmed doi rcsb
source organism Vibrio cholerae
total genus 15
structure length 68
sequence length 68
chains with identical sequence Y
ec nomenclature
pdb deposition date 2005-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bh1X00
2BH1X 2D28C 2D27A 4PHTA
chains in the Genus database with same CATH superfamily
1T5DX 4DV6C 4B3SC 2QVZX 5A1IA 4ZLPA 5H9UA 2CY1A 1O93A 3RG2A 3A9UA 4NXNC 3CJEA 1RY2A 2PT7G 2OO4A 2E8CA 1MXCA 2KZ0A 2M5OA 3GR1A 1N33C 3IEUA 4OYCA 1USPA 2D7VA 2MMAB 1ZB9A 4DCSA 3UEBA 3UX3A 2VZEA 2WP0C 1FJGC 3LNOA 2CXCA 1QM4A 5BURA 4PROC 1XS3A 5LMUC 2VQEC 3DAYA 3A26A 3TDEA 5KYVA 2UXDC 4LFBC 2D1RA 1EGAA 4R1LA 4MTNA 4JI4C 2ATWA 1ML8A 4RM3A 4YHHC 4NOZA 2ASBA 2ZM6C 2F4VC 1O90A 2BH1X 1YJ7A 4IZ6A 1XRCA 3VNRA 1HNWC 3A4IA 4KTTA 3IMLA 2DPLA 1MXAA 2YCBA 4ODJA 2OBVA 1AMUA 3T1HC 1O92A 4LF5C 3I08A 4I9GA 4LF9C 2ONFA 2QW0X 4MH4A 1I94C 3CQ2A 2M5HA 1HH2P 4JM1A 3IPLA 3NYRA 2P2QA 4HPVA 4AQYC 5BSUA 4D4GA 3CQ1A 2E8EA 4LF7C 4DCUA 4JI3C 1IBLC 1K0RA 5AE1A 4WS9A 4DV4C 5BSRA 4ZJZA 1WF3A 1PG3A 4K0KC 2V7BA 1BA3A 4DR2C 3DLPX 1O9TA 2KZFA 4LFCC 4DUZC 5CZVA 3TR3A 4DV5C 3LGXA 4BBYA 4D4IA 2E0GA 2YWBA 4G1IA 4GS5A 4BCAA 1XMQC 4D57A 1RG9A 5BSWA 2JMPA 3GR0A 4I9FA 4DG8A 4RVNA 4RVOA 4JI1C 1FUGA 3CW9A 1HNXC 1L2FA 1WCJA 3LAXA 2OPLB 4JI0C 4PUHA 1HNZC 3R9WA 2XR1A 4X65C 3E7WA 1IBMC 1N36C 4OXIA 3S82A 4DV2C 4YY3C 2PROA 4G36A 4JI6C 4PZPA 3FCCA 4ISBA 4DR5C 3IEVA 5CZXA 4L7IA 5A1GA 5IT9D 2D1SA 2AYAA 4K0BA 4DV0C 4DCTA 4BC7A 5T8SA 2ZZMA 5BUSA 2D1TA 3AY0A 3AF5A 5K85A 1VLAA 4DV7C 4NXMC 4RM2A 3O2EA 3K6RA 5BUQA 4R0MA 4JI8C 3DHVA 1QWIA 3NYQA 4JI2C 3L8CA 1PU1A 5BR8C 1NY8A 3RV2A 4EATA 5K8FA 1XRAA 1MD9A 4D56A 2Z51A 1WH9A 2E5LC 2YWCA 1TH5A 5IWAC 5A2QD 5KEIA 5AE2A 1V26A 5FLXD 4JV5C 1XRBA 2OPLA 1P4EA 1MKYA 1XMOC 5BSTA 4LF8C 5LCIA 2MCQA 4NDNA 1N32C 2D1QA 4FUTA 3NPDA 4DG9A 3H2TA 2VQFC 3N54B 2UXCC 1N34C 1JOSA 1XNRC 4PHTA 2UUCC 5A19A 4RLFA 2PN2A 3B7WA 4RLQA 5IFIA 4G37A 1KKGA 3PESA 4DV3C 4TPSB 4XX2A 3VNSA 4DR6C 2QVXX 4JI5C 3KXWA 4KHPC 3T1YC 1PA4A 4BC9A 1VEHA 3G7SA 1M6XA 3I07A 3PBKA 2BJOA 1V25A 3JAMD 5KYTA 5DV9A 4LF4C 1T5HX 3FCEA 2Y27A 4B3TC 1HR0C 1NYEA 4X66C 2ZZNA 5AE3A 4FTFA 4RMNA 4OX9C 3EERA 2QL8A 2WD9A 2D27A 1P4EC 1P7LA 4R1MA 1GPMA 3LNVA 3N2QA 1MXBA 2P2MA 4GKKC 4DV1C 1ZB8A 2D28C 2DHMA 2P20A 4IR7A 2CU6A 4DR7C 2Y4NA 4U5YD 5T8TA 1MDBA 2KDNA 2P2BA 2VSQA 3A9VA 3LUSA 3J80D 3CW8X 4BSZA 2E7GA 2UU9C 4JYAC 4DUYC 3L95X 4LFAC 1MDFA 2P2JA 2EGTA 3GKUA 3UOWA 3OTOC 2NCLA 2HJGA 1IBKC 5ADZA 4DR3C 1LQLA 1UWDA 4L2ZA 1N2FA 2YX1A 4FUQA 1M6XC 3R9XA 2UXBC 4DCVA 3VNQA 2Y4OA 5BSVA 1ULTA 4LF6C 4X62C 5BSMA 3J81D 4L4QA 2HHHC 2UUAC 3AF6A 4PUIA 3ETCA 3NI2A 3R44A 5GTDA 4GXRA 2MM9A 3CQ3A 2P02A 4DR4C 1J5EC 1LCIA 5E7QA 1PG4A 3TUFA 4GXQA 1UKKA 1USPB 3ETOA 2DYJA 4LE5A 2P2FA 3GPCA 1V60A 4X64C 2JNVA 4KTVA 4B3RC 1XHJA 1XNQC 1IB8A 3A25A 3C5EA 1FLOA 3UX2A 3TQIA 5LMNC 4GKJC 2QVYX 3EQ6A 3PROC 5JRHA 4DR1C 4PUGA 3E7XA 4JI7C 2E8FA 4WV3A 4B3MC 2UUBC 3UZ0A 3SO4A
chains in the Genus database with same CATH topology
1T5DX 4DV6C 4B3SC 2QVZX 5A1IA 4ZLPA 5H9UA 2CY1A 1O93A 3RG2A 3A9UA 4NXNC 3CJEA 1RY2A 2PT7G 2OO4A 2E8CA 1MXCA 3GR1A 1N33C 3IEUA 4OYCA 1USPA 2D7VA 1ZB9A 4DCSA 2VZEA 2WP0C 1FJGC 2CXCA 1QM4A 5BURA 4PROC 5LMUC 2VQEC 3DAYA 3TDEA 5KYVA 2UXDC 4LFBC 2D1RA 1EGAA 4R1LA 4MTNA 4JI4C 2ATWA 1ML8A 4RM3A 4YHHC 4NOZA 2ASBA 2ZM6C 2F4VC 1O90A 2BH1X 1YJ7A 4IZ6A 1XRCA 3VNRA 1HNWC 3A4IA 4KTTA 3IMLA 2DPLA 1MXAA 2YCBA 4ODJA 2OBVA 1AMUA 3T1HC 1O92A 4LF5C 3I08A 4I9GA 4LF9C 2ONFA 2QW0X 4MH4A 1I94C 1HH2P 4JM1A 3IPLA 3NYRA 4AQYC 2P2QA 4HPVA 5BSUA 4D4GA 2E8EA 4LF7C 4DCUA 4JI3C 1IBLC 1K0RA 5AE1A 4WS9A 4DV4C 5BSRA 4ZJZA 1WF3A 1PG3A 4K0KC 2V7BA 1BA3A 4DR2C 3DLPX 1O9TA 2KZFA 4LFCC 4DUZC 5CZVA 4DV5C 3LGXA 4BBYA 4D4IA 2E0GA 2YWBA 4G1IA 4GS5A 4BCAA 1XMQC 4D57A 1RG9A 5BSWA 2JMPA 3GR0A 4I9FA 4DG8A 4RVNA 4RVOA 4JI1C 1FUGA 3CW9A 1HNXC 1L2FA 3LAXA 2OPLB 4JI0C 1HNZC 3R9WA 2XR1A 4X65C 3E7WA 1IBMC 1N36C 4OXIA 3S82A 4DV2C 4YY3C 2PROA 4G36A 4JI6C 4PZPA 3FCCA 4ISBA 4DR5C 3IEVA 5CZXA 4L7IA 5A1GA 5IT9D 2D1SA 2AYAA 4K0BA 4DV0C 4DCTA 4BC7A 5T8SA 5BUSA 2D1TA 3AF5A 5K85A 1VLAA 4DV7C 4NXMC 4RM2A 5BUQA 4R0MA 4JI8C 3DHVA 1QWIA 3NYQA 4JI2C 3L8CA 5BR8C 3RV2A 4EATA 5K8FA 1XRAA 1MD9A 4D56A 1WH9A 2E5LC 2YWCA 5IWAC 5A2QD 5KEIA 5AE2A 1V26A 5FLXD 4JV5C 1XRBA 2OPLA 1MKYA 1XMOC 5BSTA 4LF8C 4NDNA 1N32C 2D1QA 4FUTA 3NPDA 4DG9A 3H2TA 2VQFC 3N54B 2UXCC 1N34C 1JOSA 1XNRC 4PHTA 2UUCC 5A19A 4RLFA 2PN2A 3B7WA 4RLQA 5IFIA 4G37A 1KKGA 3PESA 4DV3C 4TPSB 4XX2A 3VNSA 4DR6C 2QVXX 4JI5C 3KXWA 4KHPC 3T1YC 1PA4A 4BC9A 3G7SA 3I07A 3PBKA 2BJOA 1V25A 3JAMD 5KYTA 5DV9A 4LF4C 1T5HX 3FCEA 2Y27A 4B3TC 1HR0C 1NYEA 4X66C 5AE3A 4FTFA 4RMNA 4OX9C 3EERA 2QL8A 2WD9A 2D27A 1P7LA 4R1MA 1GPMA 3LNVA 3N2QA 1MXBA 2P2MA 4GKKC 4DV1C 1ZB8A 2D28C 2P20A 4IR7A 4DR7C 2Y4NA 4U5YD 5T8TA 1MDBA 2P2BA 2VSQA 3A9VA 3LUSA 3J80D 3CW8X 4BSZA 2E7GA 2UU9C 4JYAC 4DUYC 3L95X 4LFAC 1MDFA 2P2JA 2EGTA 3GKUA 3UOWA 3OTOC 2HJGA 1IBKC 5ADZA 4DR3C 1LQLA 4L2ZA 1N2FA 4FUQA 3R9XA 2UXBC 4DCVA 3VNQA 2Y4OA 5BSVA 1ULTA 4LF6C 4X62C 5BSMA 3J81D 4L4QA 2HHHC 2UUAC 3AF6A 3ETCA 3NI2A 3R44A 5GTDA 4GXRA 2P02A 4DR4C 1J5EC 1LCIA 5E7QA 1PG4A 3TUFA 4GXQA 1UKKA 1USPB 3ETOA 2DYJA 4LE5A 2P2FA 3GPCA 4X64C 4KTVA 4B3RC 1XNQC 3C5EA 3TQIA 5LMNC 4GKJC 2QVYX 3EQ6A 3PROC 5JRHA 4DR1C 3E7XA 4JI7C 2E8FA 4WV3A 4B3MC 2UUBC 3UZ0A 3SO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH1 X;  2D28 C;  2D27 A;  4PHT A; 
#chains in the Genus database with same CATH topology
 1T5D X;  4DV6 C;  4B3S C;  2QVZ X;  5A1I A;  4ZLP A;  5H9U A;  2CY1 A;  1O93 A;  3RG2 A;  3A9U A;  4NXN C;  3CJE A;  1RY2 A;  2PT7 G;  2OO4 A;  2E8C A;  1MXC A;  2KZ0 A;  2M5O A;  3GR1 A;  1N33 C;  3IEU A;  4OYC A;  1USP A;  2D7V A;  2MMA B;  1ZB9 A;  4DCS A;  3UEB A;  3UX3 A;  2VZE A;  2WP0 C;  1FJG C;  3LNO A;  2CXC A;  1QM4 A;  5BUR A;  4PRO C;  1XS3 A;  5LMU C;  2VQE C;  3DAY A;  3A26 A;  3TDE A;  5KYV A;  2UXD C;  4LFB C;  2D1R A;  1EGA A;  4R1L A;  4MTN A;  4JI4 C;  2ATW A;  1ML8 A;  4RM3 A;  4YHH C;  4NOZ A;  2ASB A;  2ZM6 C;  2F4V C;  1O90 A;  2BH1 X;  1YJ7 A;  4IZ6 A;  1XRC A;  3VNR A;  1HNW C;  3A4I A;  4KTT A;  3IML A;  2DPL A;  1MXA A;  2YCB A;  4ODJ A;  2OBV A;  1AMU A;  3T1H C;  1O92 A;  4LF5 C;  3I08 A;  4I9G A;  4LF9 C;  2ONF A;  2QW0 X;  4MH4 A;  1I94 C;  3CQ2 A;  2M5H A;  1HH2 P;  4JM1 A;  3IPL A;  3NYR A;  2P2Q A;  4HPV A;  4AQY C;  5BSU A;  4D4G A;  3CQ1 A;  2E8E A;  4LF7 C;  4DCU A;  4JI3 C;  1IBL C;  1K0R A;  5AE1 A;  4WS9 A;  4DV4 C;  5BSR A;  4ZJZ A;  1WF3 A;  1PG3 A;  4K0K C;  2V7B A;  1BA3 A;  4DR2 C;  3DLP X;  1O9T A;  2KZF A;  4LFC C;  4DUZ C;  5CZV A;  3TR3 A;  4DV5 C;  3LGX A;  4BBY A;  4D4I A;  2E0G A;  2YWB A;  4G1I A;  4GS5 A;  4BCA A;  1XMQ C;  4D57 A;  1RG9 A;  5BSW A;  2JMP A;  3GR0 A;  4I9F A;  4DG8 A;  4RVN A;  4RVO A;  4JI1 C;  1FUG A;  3CW9 A;  1HNX C;  1L2F A;  1WCJ A;  3LAX A;  2OPL B;  4JI0 C;  4PUH A;  1HNZ C;  3R9W A;  2XR1 A;  4X65 C;  3E7W A;  1IBM C;  1N36 C;  4OXI A;  3S82 A;  4DV2 C;  4YY3 C;  2PRO A;  4G36 A;  4JI6 C;  4PZP A;  3FCC A;  4ISB A;  4DR5 C;  3IEV A;  5CZX A;  4L7I A;  5A1G A;  5IT9 D;  2D1S A;  2AYA A;  4K0B A;  4DV0 C;  4DCT A;  4BC7 A;  5T8S A;  2ZZM A;  5BUS A;  2D1T A;  3AY0 A;  3AF5 A;  5K85 A;  1VLA A;  4DV7 C;  4NXM C;  4RM2 A;  3O2E A;  3K6R A;  5BUQ A;  4R0M A;  4JI8 C;  3DHV A;  1QWI A;  3NYQ A;  4JI2 C;  3L8C A;  1PU1 A;  5BR8 C;  1NY8 A;  3RV2 A;  4EAT A;  5K8F A;  1XRA A;  1MD9 A;  4D56 A;  2Z51 A;  1WH9 A;  2E5L C;  2YWC A;  1TH5 A;  5IWA C;  5A2Q D;  5KEI A;  5AE2 A;  1V26 A;  5FLX D;  4JV5 C;  1XRB A;  2OPL A;  1P4E A;  1MKY A;  1XMO C;  5BST A;  4LF8 C;  5LCI A;  2MCQ A;  4NDN A;  1N32 C;  2D1Q A;  4FUT A;  3NPD A;  4DG9 A;  3H2T A;  2VQF C;  3N54 B;  2UXC C;  1N34 C;  1JOS A;  1XNR C;  4PHT A;  2UUC C;  5A19 A;  4RLF A;  2PN2 A;  3B7W A;  4RLQ A;  5IFI A;  4G37 A;  1KKG A;  3PES A;  4DV3 C;  4TPS B;  4XX2 A;  3VNS A;  4DR6 C;  2QVX X;  4JI5 C;  3KXW A;  4KHP C;  3T1Y C;  1PA4 A;  4BC9 A;  1VEH A;  3G7S A;  1M6X A;  3I07 A;  3PBK A;  2BJO A;  1V25 A;  3JAM D;  5KYT A;  5DV9 A;  4LF4 C;  1T5H X;  3FCE A;  2Y27 A;  4B3T C;  1HR0 C;  1NYE A;  4X66 C;  2ZZN A;  5AE3 A;  4FTF A;  4RMN A;  4OX9 C;  3EER A;  2QL8 A;  2WD9 A;  2D27 A;  1P4E C;  1P7L A;  4R1M A;  1GPM A;  3LNV A;  3N2Q A;  1MXB A;  2P2M A;  4GKK C;  4DV1 C;  1ZB8 A;  2D28 C;  2DHM A;  2P20 A;  4IR7 A;  2CU6 A;  4DR7 C;  2Y4N A;  4U5Y D;  5T8T A;  1MDB A;  2KDN A;  2P2B A;  2VSQ A;  3A9V A;  3LUS A;  3J80 D;  3CW8 X;  4BSZ A;  2E7G A;  2UU9 C;  4JYA C;  4DUY C;  3L95 X;  4LFA C;  1MDF A;  2P2J A;  2EGT A;  3GKU A;  3UOW A;  3OTO C;  2NCL A;  2HJG A;  1IBK C;  5ADZ A;  4DR3 C;  1LQL A;  1UWD A;  4L2Z A;  1N2F A;  2YX1 A;  4FUQ A;  1M6X C;  3R9X A;  2UXB C;  4DCV A;  3VNQ A;  2Y4O A;  5BSV A;  1ULT A;  4LF6 C;  4X62 C;  5BSM A;  3J81 D;  4L4Q A;  2HHH C;  2UUA C;  3AF6 A;  4PUI A;  3ETC A;  3NI2 A;  3R44 A;  5GTD A;  4GXR A;  2MM9 A;  3CQ3 A;  2P02 A;  4DR4 C;  1J5E C;  1LCI A;  5E7Q A;  1PG4 A;  3TUF A;  4GXQ A;  1UKK A;  1USP B;  3ETO A;  2DYJ A;  4LE5 A;  2P2F A;  3GPC A;  1V60 A;  4X64 C;  2JNV A;  4KTV A;  4B3R C;  1XHJ A;  1XNQ C;  1IB8 A;  3A25 A;  3C5E A;  1FLO A;  3UX2 A;  3TQI A;  5LMN C;  4GKJ C;  2QVY X;  3EQ6 A;  3PRO C;  5JRH A;  4DR1 C;  4PUG A;  3E7X A;  4JI7 C;  2E8F A;  4WV3 A;  4B3M C;  2UUB C;  3UZ0 A;  3SO4 A; 
#chains in the Genus database with same CATH homology
 1T5D X;  4DV6 C;  4B3S C;  2QVZ X;  5A1I A;  4ZLP A;  5H9U A;  2CY1 A;  1O93 A;  3RG2 A;  3A9U A;  4NXN C;  3CJE A;  1RY2 A;  2PT7 G;  2OO4 A;  2E8C A;  1MXC A;  3GR1 A;  1N33 C;  3IEU A;  4OYC A;  1USP A;  2D7V A;  1ZB9 A;  4DCS A;  2VZE A;  2WP0 C;  1FJG C;  2CXC A;  1QM4 A;  5BUR A;  4PRO C;  5LMU C;  2VQE C;  3DAY A;  3TDE A;  5KYV A;  2UXD C;  4LFB C;  2D1R A;  1EGA A;  4R1L A;  4MTN A;  4JI4 C;  2ATW A;  1ML8 A;  4RM3 A;  4YHH C;  4NOZ A;  2ASB A;  2ZM6 C;  2F4V C;  1O90 A;  2BH1 X;  1YJ7 A;  4IZ6 A;  1XRC A;  3VNR A;  1HNW C;  3A4I A;  4KTT A;  3IML A;  2DPL A;  1MXA A;  2YCB A;  4ODJ A;  2OBV A;  1AMU A;  3T1H C;  1O92 A;  4LF5 C;  3I08 A;  4I9G A;  4LF9 C;  2ONF A;  2QW0 X;  4MH4 A;  1I94 C;  1HH2 P;  4JM1 A;  3IPL A;  3NYR A;  4AQY C;  2P2Q A;  4HPV A;  5BSU A;  4D4G A;  2E8E A;  4LF7 C;  4DCU A;  4JI3 C;  1IBL C;  1K0R A;  5AE1 A;  4WS9 A;  4DV4 C;  5BSR A;  4ZJZ A;  1WF3 A;  1PG3 A;  4K0K C;  2V7B A;  1BA3 A;  4DR2 C;  3DLP X;  1O9T A;  2KZF A;  4LFC C;  4DUZ C;  5CZV A;  4DV5 C;  3LGX A;  4BBY A;  4D4I A;  2E0G A;  2YWB A;  4G1I A;  4GS5 A;  4BCA A;  1XMQ C;  4D57 A;  1RG9 A;  5BSW A;  2JMP A;  3GR0 A;  4I9F A;  4DG8 A;  4RVN A;  4RVO A;  4JI1 C;  1FUG A;  3CW9 A;  1HNX C;  1L2F A;  3LAX A;  2OPL B;  4JI0 C;  1HNZ C;  3R9W A;  2XR1 A;  4X65 C;  3E7W A;  1IBM C;  1N36 C;  4OXI A;  3S82 A;  4DV2 C;  4YY3 C;  2PRO A;  4G36 A;  4JI6 C;  4PZP A;  3FCC A;  4ISB A;  4DR5 C;  3IEV A;  5CZX A;  4L7I A;  5A1G A;  5IT9 D;  2D1S A;  2AYA A;  4K0B A;  4DV0 C;  4DCT A;  4BC7 A;  5T8S A;  5BUS A;  2D1T A;  3AF5 A;  5K85 A;  1VLA A;  4DV7 C;  4NXM C;  4RM2 A;  5BUQ A;  4R0M A;  4JI8 C;  3DHV A;  1QWI A;  3NYQ A;  4JI2 C;  3L8C A;  5BR8 C;  3RV2 A;  4EAT A;  5K8F A;  1XRA A;  1MD9 A;  4D56 A;  1WH9 A;  2E5L C;  2YWC A;  5IWA C;  5A2Q D;  5KEI A;  5AE2 A;  1V26 A;  5FLX D;  4JV5 C;  1XRB A;  2OPL A;  1MKY A;  1XMO C;  5BST A;  4LF8 C;  4NDN A;  1N32 C;  2D1Q A;  4FUT A;  3NPD A;  4DG9 A;  3H2T A;  2VQF C;  3N54 B;  2UXC C;  1N34 C;  1JOS A;  1XNR C;  4PHT A;  2UUC C;  5A19 A;  4RLF A;  2PN2 A;  3B7W A;  4RLQ A;  5IFI A;  4G37 A;  1KKG A;  3PES A;  4DV3 C;  4TPS B;  4XX2 A;  3VNS A;  4DR6 C;  2QVX X;  4JI5 C;  3KXW A;  4KHP C;  3T1Y C;  1PA4 A;  4BC9 A;  3G7S A;  3I07 A;  3PBK A;  2BJO A;  1V25 A;  3JAM D;  5KYT A;  5DV9 A;  4LF4 C;  1T5H X;  3FCE A;  2Y27 A;  4B3T C;  1HR0 C;  1NYE A;  4X66 C;  5AE3 A;  4FTF A;  4RMN A;  4OX9 C;  3EER A;  2QL8 A;  2WD9 A;  2D27 A;  1P7L A;  4R1M A;  1GPM A;  3LNV A;  3N2Q A;  1MXB A;  2P2M A;  4GKK C;  4DV1 C;  1ZB8 A;  2D28 C;  2P20 A;  4IR7 A;  4DR7 C;  2Y4N A;  4U5Y D;  5T8T A;  1MDB A;  2P2B A;  2VSQ A;  3A9V A;  3LUS A;  3J80 D;  3CW8 X;  4BSZ A;  2E7G A;  2UU9 C;  4JYA C;  4DUY C;  3L95 X;  4LFA C;  1MDF A;  2P2J A;  2EGT A;  3GKU A;  3UOW A;  3OTO C;  2HJG A;  1IBK C;  5ADZ A;  4DR3 C;  1LQL A;  4L2Z A;  1N2F A;  4FUQ A;  3R9X A;  2UXB C;  4DCV A;  3VNQ A;  2Y4O A;  5BSV A;  1ULT A;  4LF6 C;  4X62 C;  5BSM A;  3J81 D;  4L4Q A;  2HHH C;  2UUA C;  3AF6 A;  3ETC A;  3NI2 A;  3R44 A;  5GTD A;  4GXR A;  2P02 A;  4DR4 C;  1J5E C;  1LCI A;  5E7Q A;  1PG4 A;  3TUF A;  4GXQ A;  1UKK A;  1USP B;  3ETO A;  2DYJ A;  4LE5 A;  2P2F A;  3GPC A;  4X64 C;  4KTV A;  4B3R C;  1XNQ C;  3C5E A;  3TQI A;  5LMN C;  4GKJ C;  2QVY X;  3EQ6 A;  3PRO C;  5JRH A;  4DR1 C;  3E7X A;  4JI7 C;  2E8F A;  4WV3 A;  4B3M C;  2UUB C;  3UZ0 A;  3SO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...