2BH1X

X-ray structure of the general secretion pathway complex of the n- terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
68
structure length
68
Chain Sequence
IRRLPFSFANRFKLVLDWNEDFSQASIYYLAPLSMEALVETKRVVKHAFQLIELSQAEFESKLTQVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-Ray Structure of the Type II Secretion System Complex Formed by the N-Terminal Domain of Epse and the Cytoplasmic Domain of Epsl of Vibrio Cholerae
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Transport protein
molecule keywords GENERAL SECRETION PATHWAY PROTEIN L
total genus 15
structure length 68
sequence length 68
chains with identical sequence Y
ec nomenclature
pdb deposition date 2005-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.160 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 2bh1X00
4PHTA 2BH1X 2D28C 2D27A
chains in the Genus database with same CATH superfamily
3B7WA 4PUGA 5GTDA 3JAMD 3NPDA 4DG9A 3AY0A 1HNXC 4KTTA 3CJEA 3LNOA 4IR7A 2D28C 4JI2C 3LGXA 2D27A 5BURA 2CY1A 4RM2A 5LMNC 1MXAA 1LCIA 2JNVA 4KTVA 1HR0C 1JOSA 2JMPA 2MM9A 1QWIA 3L95X 1I94C 2UXBC 4X66C 1N2FA 1MXCA 2P2JA 2VQEC 2UXCC 3R9XA 4R1LA 4JM1A 2QVYX 4B3RC 1O9TA 4ISBA 1XNRC 3EERA 2D1QA 2UXDC 2D1TA 4JI3C 4GS5A 4JI5C 4JI4C 3PROC 2QL8A 2D1RA 3LUSA 2P02A 4DR3C 3GR0A 4I9GA 1O92A 3ETCA 4DV2C 4D4GA 4PZPA 1AMUA 1VEHA 3C5EA 3CQ1A 1MKYA 4DV1C 1FJGC 4L4QA 3UOWA 2OPLA 3J80D 3IEVA 2D7VA 4ZJZA 3NYQA 2ZM6C 3OTOC 1IBKC 1M6XC 5AE3A 4BSZA 2P2QA 2OBVA 3RV2A 3G7SA 2ZZMA 4U5YD 5IT9D 2HJGA 2ASBA 4HPVA 4FUTA 4DR1C 1MD9A 5BUQA 1BA3A 4WV3A 1TH5A 2UUBC 2CXCA 3SO4A 2YWBA 1QM4A 1PG3A 3RG2A 1J5EC 4KHPC 1O93A 3EQ6A 4LF7C 2PT7G 4JI7C 2BH1X 4X64C 3GR1A 4LF8C 1GPMA 1RG9A 1USPB 5H9UA 3NI2A 3AF5A 4I9FA 3ETOA 2KDNA 4DR2C 4LFBC 4NXMC 2BJOA 1XS3A 4JI8C 3A25A 3N2QA 2PN2A 5BSVA 3R9WA 3CW8X 4BCAA 3IEUA 3VNQA 3GKUA 3LAXA 1T5DX 4D4IA 2ONFA 4LF6C 5BR8C 4DR4C 4JV5C 4K0KC 4NOZA 1XRAA 3CQ3A 4D56A 1XMQC 2ZZNA 4TPSB 5JRHA 3PBKA 1HNWC 1LQLA 2KZFA 1L2FA 1XMOC 3T1HC 4MH4A 1K0RA 2UU9C 4DR7C 3FCEA 2E8CA 5IFIA 4GKKC 5FLXD 1IBLC 1N33C 4LF4C 3H2TA 4DV6C 2DHMA 3CQ2A 4DCTA 1IBMC 4RVNA 2EGTA 4PUIA 2YX1A 2MCQA 2OO4A 3N54B 1XRBA 4K0BA 5BUSA 2E8EA 2CU6A 2PROA 4R1MA 3IPLA 4BC7A 1MDFA 3NYRA 5BSWA 2P2BA 2AYAA 1WF3A 5A2QD 2V7BA 4GKJC 3UEBA 1HNZC 4LFAC 1PG4A 5T8TA 4RLFA 2VZEA 4GXQA 4AQYC 3A9UA 3FCCA 1VLAA 1ULTA 3IMLA 1N34C 5A1IA 3E7XA 2YCBA 4DV0C 5BSMA 3S82A 3O2EA 1XNQC 1XHJA 4B3TC 4R0MA 5A19A 1V25A 5ADZA 4DCVA 2Y27A 3AF6A 4DCUA 1MDBA 2QVXX 5CZXA 1V26A 2M5HA 1KKGA 2DYJA 5KEIA 4FUQA 1EGAA 2DPLA 4JI1C 4LF5C 4DV5C 3TQIA 3KXWA 4X65C 2D1SA 3L8CA 4MTNA 2VSQA 4RVOA 4LE5A 4EATA 1P4EC 5A1GA 4FTFA 4DR5C 4OX9C 1UWDA 4XX2A 2QVZX 3UX3A 5CZVA 2Y4NA 4IZ6A 4BBYA 3DAYA 4BC9A 3DLPX 3GPCA 3DHVA 1HH2P 3K6RA 2UUAC 1UKKA 3VNSA 1P4EA 2QW0X 2YWCA 3J81D 5LMUC 5LCIA 3A9VA 1P7LA 3UZ0A 4DCSA 4L7IA 5T8SA 4PROC 2E0GA 4JI6C 4JI0C 4X62C 2VQFC 4YY3C 2UUCC 1PA4A 4DV3C 5BSTA 4G36A 3I08A 5K8FA 1IB8A 3PESA 4DR6C 4G1IA 4NDNA 3T1YC 1ML8A 5DV9A 4D57A 4YHHC 4RMNA 4RLQA 1ZB9A 4ZLPA 1PU1A 4LF9C 3I07A 3CW9A 1N36C 4GXRA 1M6XA 3A26A 1MXBA 2Z51A 3TR3A 3VNRA 2WP0C 4B3MC 2KZ0A 2E8FA 2Y4OA 3LNVA 1XRCA 5E7QA 1WH9A 3UX2A 5KYTA 4DV4C 1N32C 3R44A 1YJ7A 1FUGA 4DUYC 3E7WA 4OXIA 1T5HX 3TDEA 4G37A 4B3SC 1NY8A 2XR1A 4NXNC 2E7GA 2WD9A 1NYEA 4PUHA 3A4IA 5KYVA 1ZB8A 1WCJA 4DV7C 2E5LC 5K85A 4DUZC 1O90A 5AE1A 4L2ZA 4LFCC 1FLOA 1V60A 4ODJA 5BSRA 4JYAC 2P2MA 2HHHC 2P2FA 4WS9A 4DG8A 2ATWA 2NCLA 1USPA 1RY2A 4RM3A 5IWAC 2MMAB 2P20A 2OPLB 4OYCA 4PHTA 5AE2A 2F4VC 5BSUA 2M5OA 3TUFA
chains in the Genus database with same CATH topology
3B7WA 5GTDA 3JAMD 3NPDA 4DG9A 1HNXC 4KTTA 3CJEA 4IR7A 2D28C 4JI2C 3LGXA 2D27A 5BURA 2CY1A 4RM2A 5LMNC 1MXAA 1LCIA 4KTVA 1HR0C 1JOSA 2JMPA 1QWIA 3L95X 1I94C 2UXBC 4X66C 1N2FA 1MXCA 2P2JA 2VQEC 2UXCC 3R9XA 4R1LA 4JM1A 2QVYX 4B3RC 1O9TA 4ISBA 1XNRC 3EERA 2D1QA 2UXDC 2D1TA 4JI3C 4GS5A 4JI5C 4JI4C 3PROC 2QL8A 2D1RA 3LUSA 2P02A 4DR3C 3GR0A 4I9GA 1O92A 3ETCA 4DV2C 4D4GA 4PZPA 1AMUA 3C5EA 1MKYA 4DV1C 1FJGC 4L4QA 3UOWA 2OPLA 3J80D 3IEVA 2D7VA 4ZJZA 3NYQA 2ZM6C 3OTOC 1IBKC 5AE3A 4BSZA 2P2QA 2OBVA 3RV2A 3G7SA 4U5YD 5IT9D 2HJGA 2ASBA 4HPVA 4FUTA 4DR1C 1MD9A 5BUQA 1BA3A 4WV3A 2UUBC 2CXCA 3SO4A 2YWBA 1QM4A 1PG3A 3RG2A 1J5EC 4KHPC 1O93A 3EQ6A 4LF7C 2PT7G 4JI7C 2BH1X 4X64C 3GR1A 4LF8C 1GPMA 1RG9A 1USPB 5H9UA 3NI2A 3AF5A 4I9FA 3ETOA 4DR2C 4LFBC 4NXMC 2BJOA 4JI8C 3N2QA 2PN2A 5BSVA 3R9WA 3CW8X 4BCAA 3IEUA 3VNQA 3GKUA 3LAXA 1T5DX 4D4IA 2ONFA 4LF6C 5BR8C 4DR4C 4JV5C 4K0KC 4NOZA 1XRAA 1XMQC 4D56A 4TPSB 5JRHA 3PBKA 1HNWC 1LQLA 2KZFA 1L2FA 1XMOC 3T1HC 4MH4A 1K0RA 2UU9C 4DR7C 3FCEA 2E8CA 5IFIA 4GKKC 5FLXD 1IBLC 1N33C 4LF4C 3H2TA 4DV6C 4DCTA 1IBMC 4RVNA 2EGTA 2OO4A 3N54B 1XRBA 4K0BA 5BUSA 2E8EA 2PROA 4R1MA 3IPLA 4BC7A 1MDFA 3NYRA 5BSWA 2P2BA 2AYAA 1WF3A 5A2QD 2V7BA 4GKJC 1HNZC 4LFAC 1PG4A 5T8TA 4RLFA 2VZEA 4GXQA 4AQYC 3A9UA 3FCCA 1VLAA 1ULTA 3IMLA 1N34C 5A1IA 3E7XA 2YCBA 4DV0C 5BSMA 3S82A 1XNQC 4B3TC 4R0MA 5A19A 1V25A 5ADZA 4DCVA 2Y27A 3AF6A 4DCUA 1MDBA 2QVXX 5CZXA 1V26A 1KKGA 2DYJA 5KEIA 4LF5C 1EGAA 2DPLA 4FUQA 4JI1C 4DV5C 3TQIA 3KXWA 4X65C 2D1SA 3L8CA 4MTNA 2VSQA 4RVOA 4LE5A 4EATA 5A1GA 4FTFA 4DR5C 4OX9C 4XX2A 2QVZX 5CZVA 2Y4NA 4IZ6A 4BBYA 3DAYA 4BC9A 3DLPX 3GPCA 3DHVA 1HH2P 2UUAC 1UKKA 3VNSA 2QW0X 2YWCA 3J81D 5LMUC 3A9VA 1P7LA 3UZ0A 4DCSA 4L7IA 5T8SA 4PROC 2E0GA 4JI6C 4JI0C 4X62C 2VQFC 4YY3C 2UUCC 1PA4A 4DV3C 5BSTA 4G36A 3I08A 5K8FA 3PESA 4DR6C 4G1IA 4NDNA 3T1YC 1ML8A 5DV9A 4D57A 4YHHC 4RMNA 4RLQA 1ZB9A 4ZLPA 4LF9C 3I07A 3CW9A 1N36C 4GXRA 1MXBA 3VNRA 2WP0C 4B3MC 2E8FA 2Y4OA 3LNVA 1XRCA 5E7QA 1WH9A 5KYTA 4DV4C 1N32C 3R44A 1YJ7A 1FUGA 4DUYC 3E7WA 4OXIA 1T5HX 3TDEA 4G37A 4B3SC 2XR1A 4NXNC 2E7GA 2WD9A 1NYEA 3A4IA 5KYVA 1ZB8A 4DV7C 2E5LC 5K85A 4DUZC 1O90A 5AE1A 4L2ZA 4LFCC 4ODJA 5BSRA 4JYAC 2P2MA 2HHHC 2P2FA 4WS9A 4DG8A 2ATWA 1USPA 1RY2A 4RM3A 5IWAC 2P20A 2OPLB 4OYCA 4PHTA 5AE2A 2F4VC 5BSUA 3TUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHT A;  2BH1 X;  2D28 C;  2D27 A; 
#chains in the Genus database with same CATH topology
 3B7W A;  4PUG A;  5GTD A;  3JAM D;  3NPD A;  4DG9 A;  3AY0 A;  1HNX C;  4KTT A;  3CJE A;  3LNO A;  4IR7 A;  2D28 C;  4JI2 C;  3LGX A;  2D27 A;  5BUR A;  2CY1 A;  4RM2 A;  5LMN C;  1MXA A;  1LCI A;  2JNV A;  4KTV A;  1HR0 C;  1JOS A;  2JMP A;  2MM9 A;  1QWI A;  3L95 X;  1I94 C;  2UXB C;  4X66 C;  1N2F A;  1MXC A;  2P2J A;  2VQE C;  2UXC C;  3R9X A;  4R1L A;  4JM1 A;  2QVY X;  4B3R C;  1O9T A;  4ISB A;  1XNR C;  3EER A;  2D1Q A;  2UXD C;  2D1T A;  4JI3 C;  4GS5 A;  4JI5 C;  4JI4 C;  3PRO C;  2QL8 A;  2D1R A;  3LUS A;  2P02 A;  4DR3 C;  3GR0 A;  4I9G A;  1O92 A;  3ETC A;  4DV2 C;  4D4G A;  4PZP A;  1AMU A;  1VEH A;  3C5E A;  3CQ1 A;  1MKY A;  4DV1 C;  1FJG C;  4L4Q A;  3UOW A;  2OPL A;  3J80 D;  3IEV A;  2D7V A;  4ZJZ A;  3NYQ A;  2ZM6 C;  3OTO C;  1IBK C;  1M6X C;  5AE3 A;  4BSZ A;  2P2Q A;  2OBV A;  3RV2 A;  3G7S A;  2ZZM A;  4U5Y D;  5IT9 D;  2HJG A;  2ASB A;  4HPV A;  4FUT A;  4DR1 C;  1MD9 A;  5BUQ A;  1BA3 A;  4WV3 A;  1TH5 A;  2UUB C;  2CXC A;  3SO4 A;  2YWB A;  1QM4 A;  1PG3 A;  3RG2 A;  1J5E C;  4KHP C;  1O93 A;  3EQ6 A;  4LF7 C;  2PT7 G;  4JI7 C;  2BH1 X;  4X64 C;  3GR1 A;  4LF8 C;  1GPM A;  1RG9 A;  1USP B;  5H9U A;  3NI2 A;  3AF5 A;  4I9F A;  3ETO A;  2KDN A;  4DR2 C;  4LFB C;  4NXM C;  2BJO A;  1XS3 A;  4JI8 C;  3A25 A;  3N2Q A;  2PN2 A;  5BSV A;  3R9W A;  3CW8 X;  4BCA A;  3IEU A;  3VNQ A;  3GKU A;  3LAX A;  1T5D X;  4D4I A;  2ONF A;  4LF6 C;  5BR8 C;  4DR4 C;  4JV5 C;  4K0K C;  4NOZ A;  1XRA A;  3CQ3 A;  4D56 A;  1XMQ C;  2ZZN A;  4TPS B;  5JRH A;  3PBK A;  1HNW C;  1LQL A;  2KZF A;  1L2F A;  1XMO C;  3T1H C;  4MH4 A;  1K0R A;  2UU9 C;  4DR7 C;  3FCE A;  2E8C A;  5IFI A;  4GKK C;  5FLX D;  1IBL C;  1N33 C;  4LF4 C;  3H2T A;  4DV6 C;  2DHM A;  3CQ2 A;  4DCT A;  1IBM C;  4RVN A;  2EGT A;  4PUI A;  2YX1 A;  2MCQ A;  2OO4 A;  3N54 B;  1XRB A;  4K0B A;  5BUS A;  2E8E A;  2CU6 A;  2PRO A;  4R1M A;  3IPL A;  4BC7 A;  1MDF A;  3NYR A;  5BSW A;  2P2B A;  2AYA A;  1WF3 A;  5A2Q D;  2V7B A;  4GKJ C;  3UEB A;  1HNZ C;  4LFA C;  1PG4 A;  5T8T A;  4RLF A;  2VZE A;  4GXQ A;  4AQY C;  3A9U A;  3FCC A;  1VLA A;  1ULT A;  3IML A;  1N34 C;  5A1I A;  3E7X A;  2YCB A;  4DV0 C;  5BSM A;  3S82 A;  3O2E A;  1XNQ C;  1XHJ A;  4B3T C;  4R0M A;  5A19 A;  1V25 A;  5ADZ A;  4DCV A;  2Y27 A;  3AF6 A;  4DCU A;  1MDB A;  2QVX X;  5CZX A;  1V26 A;  2M5H A;  1KKG A;  2DYJ A;  5KEI A;  4FUQ A;  1EGA A;  2DPL A;  4JI1 C;  4LF5 C;  4DV5 C;  3TQI A;  3KXW A;  4X65 C;  2D1S A;  3L8C A;  4MTN A;  2VSQ A;  4RVO A;  4LE5 A;  4EAT A;  1P4E C;  5A1G A;  4FTF A;  4DR5 C;  4OX9 C;  1UWD A;  4XX2 A;  2QVZ X;  3UX3 A;  5CZV A;  2Y4N A;  4IZ6 A;  4BBY A;  3DAY A;  4BC9 A;  3DLP X;  3GPC A;  3DHV A;  1HH2 P;  3K6R A;  2UUA C;  1UKK A;  3VNS A;  1P4E A;  2QW0 X;  2YWC A;  3J81 D;  5LMU C;  5LCI A;  3A9V A;  1P7L A;  3UZ0 A;  4DCS A;  4L7I A;  5T8S A;  4PRO C;  2E0G A;  4JI6 C;  4JI0 C;  4X62 C;  2VQF C;  4YY3 C;  2UUC C;  1PA4 A;  4DV3 C;  5BST A;  4G36 A;  3I08 A;  5K8F A;  1IB8 A;  3PES A;  4DR6 C;  4G1I A;  4NDN A;  3T1Y C;  1ML8 A;  5DV9 A;  4D57 A;  4YHH C;  4RMN A;  4RLQ A;  1ZB9 A;  4ZLP A;  1PU1 A;  4LF9 C;  3I07 A;  3CW9 A;  1N36 C;  4GXR A;  1M6X A;  3A26 A;  1MXB A;  2Z51 A;  3TR3 A;  3VNR A;  2WP0 C;  4B3M C;  2KZ0 A;  2E8F A;  2Y4O A;  3LNV A;  1XRC A;  5E7Q A;  1WH9 A;  3UX2 A;  5KYT A;  4DV4 C;  1N32 C;  3R44 A;  1YJ7 A;  1FUG A;  4DUY C;  3E7W A;  4OXI A;  1T5H X;  3TDE A;  4G37 A;  4B3S C;  1NY8 A;  2XR1 A;  4NXN C;  2E7G A;  2WD9 A;  1NYE A;  4PUH A;  3A4I A;  5KYV A;  1ZB8 A;  1WCJ A;  4DV7 C;  2E5L C;  5K85 A;  4DUZ C;  1O90 A;  5AE1 A;  4L2Z A;  4LFC C;  1FLO A;  1V60 A;  4ODJ A;  5BSR A;  4JYA C;  2P2M A;  2HHH C;  2P2F A;  4WS9 A;  4DG8 A;  2ATW A;  2NCL A;  1USP A;  1RY2 A;  4RM3 A;  5IWA C;  2MMA B;  2P20 A;  2OPL B;  4OYC A;  4PHT A;  5AE2 A;  2F4V C;  5BSU A;  2M5O A;  3TUF A; 
#chains in the Genus database with same CATH homology
 3B7W A;  5GTD A;  3JAM D;  3NPD A;  4DG9 A;  1HNX C;  4KTT A;  3CJE A;  4IR7 A;  2D28 C;  4JI2 C;  3LGX A;  2D27 A;  5BUR A;  2CY1 A;  4RM2 A;  5LMN C;  1MXA A;  1LCI A;  4KTV A;  1HR0 C;  1JOS A;  2JMP A;  1QWI A;  3L95 X;  1I94 C;  2UXB C;  4X66 C;  1N2F A;  1MXC A;  2P2J A;  2VQE C;  2UXC C;  3R9X A;  4R1L A;  4JM1 A;  2QVY X;  4B3R C;  1O9T A;  4ISB A;  1XNR C;  3EER A;  2D1Q A;  2UXD C;  2D1T A;  4JI3 C;  4GS5 A;  4JI5 C;  4JI4 C;  3PRO C;  2QL8 A;  2D1R A;  3LUS A;  2P02 A;  4DR3 C;  3GR0 A;  4I9G A;  1O92 A;  3ETC A;  4DV2 C;  4D4G A;  4PZP A;  1AMU A;  3C5E A;  1MKY A;  4DV1 C;  1FJG C;  4L4Q A;  3UOW A;  2OPL A;  3J80 D;  3IEV A;  2D7V A;  4ZJZ A;  3NYQ A;  2ZM6 C;  3OTO C;  1IBK C;  5AE3 A;  4BSZ A;  2P2Q A;  2OBV A;  3RV2 A;  3G7S A;  4U5Y D;  5IT9 D;  2HJG A;  2ASB A;  4HPV A;  4FUT A;  4DR1 C;  1MD9 A;  5BUQ A;  1BA3 A;  4WV3 A;  2UUB C;  2CXC A;  3SO4 A;  2YWB A;  1QM4 A;  1PG3 A;  3RG2 A;  1J5E C;  4KHP C;  1O93 A;  3EQ6 A;  4LF7 C;  2PT7 G;  4JI7 C;  2BH1 X;  4X64 C;  3GR1 A;  4LF8 C;  1GPM A;  1RG9 A;  1USP B;  5H9U A;  3NI2 A;  3AF5 A;  4I9F A;  3ETO A;  4DR2 C;  4LFB C;  4NXM C;  2BJO A;  4JI8 C;  3N2Q A;  2PN2 A;  5BSV A;  3R9W A;  3CW8 X;  4BCA A;  3IEU A;  3VNQ A;  3GKU A;  3LAX A;  1T5D X;  4D4I A;  2ONF A;  4LF6 C;  5BR8 C;  4DR4 C;  4JV5 C;  4K0K C;  4NOZ A;  1XRA A;  1XMQ C;  4D56 A;  4TPS B;  5JRH A;  3PBK A;  1HNW C;  1LQL A;  2KZF A;  1L2F A;  1XMO C;  3T1H C;  4MH4 A;  1K0R A;  2UU9 C;  4DR7 C;  3FCE A;  2E8C A;  5IFI A;  4GKK C;  5FLX D;  1IBL C;  1N33 C;  4LF4 C;  3H2T A;  4DV6 C;  4DCT A;  1IBM C;  4RVN A;  2EGT A;  2OO4 A;  3N54 B;  1XRB A;  4K0B A;  5BUS A;  2E8E A;  2PRO A;  4R1M A;  3IPL A;  4BC7 A;  1MDF A;  3NYR A;  5BSW A;  2P2B A;  2AYA A;  1WF3 A;  5A2Q D;  2V7B A;  4GKJ C;  1HNZ C;  4LFA C;  1PG4 A;  5T8T A;  4RLF A;  2VZE A;  4GXQ A;  4AQY C;  3A9U A;  3FCC A;  1VLA A;  1ULT A;  3IML A;  1N34 C;  5A1I A;  3E7X A;  2YCB A;  4DV0 C;  5BSM A;  3S82 A;  1XNQ C;  4B3T C;  4R0M A;  5A19 A;  1V25 A;  5ADZ A;  4DCV A;  2Y27 A;  3AF6 A;  4DCU A;  1MDB A;  2QVX X;  5CZX A;  1V26 A;  1KKG A;  2DYJ A;  5KEI A;  4LF5 C;  1EGA A;  2DPL A;  4FUQ A;  4JI1 C;  4DV5 C;  3TQI A;  3KXW A;  4X65 C;  2D1S A;  3L8C A;  4MTN A;  2VSQ A;  4RVO A;  4LE5 A;  4EAT A;  5A1G A;  4FTF A;  4DR5 C;  4OX9 C;  4XX2 A;  2QVZ X;  5CZV A;  2Y4N A;  4IZ6 A;  4BBY A;  3DAY A;  4BC9 A;  3DLP X;  3GPC A;  3DHV A;  1HH2 P;  2UUA C;  1UKK A;  3VNS A;  2QW0 X;  2YWC A;  3J81 D;  5LMU C;  3A9V A;  1P7L A;  3UZ0 A;  4DCS A;  4L7I A;  5T8S A;  4PRO C;  2E0G A;  4JI6 C;  4JI0 C;  4X62 C;  2VQF C;  4YY3 C;  2UUC C;  1PA4 A;  4DV3 C;  5BST A;  4G36 A;  3I08 A;  5K8F A;  3PES A;  4DR6 C;  4G1I A;  4NDN A;  3T1Y C;  1ML8 A;  5DV9 A;  4D57 A;  4YHH C;  4RMN A;  4RLQ A;  1ZB9 A;  4ZLP A;  4LF9 C;  3I07 A;  3CW9 A;  1N36 C;  4GXR A;  1MXB A;  3VNR A;  2WP0 C;  4B3M C;  2E8F A;  2Y4O A;  3LNV A;  1XRC A;  5E7Q A;  1WH9 A;  5KYT A;  4DV4 C;  1N32 C;  3R44 A;  1YJ7 A;  1FUG A;  4DUY C;  3E7W A;  4OXI A;  1T5H X;  3TDE A;  4G37 A;  4B3S C;  2XR1 A;  4NXN C;  2E7G A;  2WD9 A;  1NYE A;  3A4I A;  5KYV A;  1ZB8 A;  4DV7 C;  2E5L C;  5K85 A;  4DUZ C;  1O90 A;  5AE1 A;  4L2Z A;  4LFC C;  4ODJ A;  5BSR A;  4JYA C;  2P2M A;  2HHH C;  2P2F A;  4WS9 A;  4DG8 A;  2ATW A;  1USP A;  1RY2 A;  4RM3 A;  5IWA C;  2P20 A;  2OPL B;  4OYC A;  4PHT A;  5AE2 A;  2F4V C;  5BSU A;  3TUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...