3L95X

Crystal structure of the human notch1 negative regulatory region (nrr) bound to the fab fragment of an antagonist antibody
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
230
Chain Sequence
GSACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGDVRGSIVYLEIDNRQCVSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-NRR1 fab fragment light chain
publication title Therapeutic antibody targeting of individual Notch receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 230
sequence length 233
chains with identical sequence Y
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00066 Notch LNR domain
X PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l95X02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3l95X01
3L95X 5CZVA 3ETOA 2OO4A 4ZLPA 5CZXA
chains in the Genus database with same CATH superfamily
3O6QA 4MFBB 1RCXB 1T9TA 3FDSA 3KJFB 1F5AA 2ZM6J 2OLWA 5EX0A 2RB7A 1QLNA 1KBRA 3CVKA 1JXLA 4OHZA 2KO1A 2PD1A 1NPPA 4RM2A 4F4YA 2JZ5A 3W2WB 3HFKA 1W7WA 3LGMA 3KHRA 1XRAA 1CC7A 1YI2S 4ECYA 2VD3A 2KT5A 4V19J 4GMKA 1HNZJ 5KTQA 2H51B 4EI2A 1UVMA 4OLOA 4RUHA 3MTJA 3V2UC 4Y28C 1WH9A 1UVIA 5BYSA 4KH0B 4PRFA 4DV0F 3IMLA 3MMBB 4QWDA 1QTMA 1JJ2R 1FRIA 1UW9A 2GS8A 3EPIA 2GCFA 3OXFA 1RZMA 3TW0A 1T02A 4O4GA 2W9CB 5D3GB 3DRYA 1WEYA 5DQGA 2AGPA 4DR5F 1HPZB 3NL0A 4ZN1A 5ETNA 4LT6A 2AWZA 2IBOA 3N6NA 4GVBB 2OJ3A 2HNYB 4MH8A 1TL1B 4JI8C 4QYZK 1MWYA 4JI2F 1FJCA 3IMQJ 4A8WA 4F4ZA 4HDGA 4HKQA 1RTJA 3I08A 3LNOA 2Z2YB 4HR2A 2DR6A 2IY5B 2UUBC 3T19A 1NB7A 1O0PA 3MUVP 2K3KA 1LEOA 1Y9OA 2RRAA 2FVRA 4P72A 3PXGa 1CJVB 2GZOA 1R27B 2AU0A 2DR9A 5I42B 2F9JA 4ZPDA 1NUEA 2WVBA 3UR3C 2ZJQQ 4D4IA 1CEZA 4F67A 1VQ8S 3UVJB 1TUGB 1KR4A 1RAEB 4JI0C 1C1BA 4QW9A 3LO3A 2YKMA 3KK2A 2GA7A 3KDNA 1FWLA 1TELA 3GG0A 4NXMJ 4LF5F 4USMA 1X0FA 2DVIA 1S1XA 2XQCA 4LMZA 2YX4A 1N5YB 3CDBA 3IWXA 1JXEA 1HBMB 1FKPB 2F9DA 2E44A 1YWXA 1B99A 4ILMA 4RW4B 3KLGA 1CQNA 2FJEB 1FRJA 4ZJZA 1TKTA 2FJWA 2XYHB 2W9AA 4RLEA 1FDBA 1FRXA 1K0TA 1U0HA 3M1VB 2V6AA 3QT5A 3KXWA 4X4PA 4USKA 2XLKA 2AYAA 4U9RA 5KFJA 1Q79A 1O6XA 1X0PA 2F4VJ 5HVGA 2EKNA 2W9BA 4OYPA 4ZVSB 2GVDA 2PEHA 2VC1A 1V3SA 1SIWB 5JVHQ 4ODJA 2XCAA 2HQ3A 2DT9A 3UD3P 2ILYA 4CLKA 4ELUA 4OYBA 2XYPB 1HD1A 1M90T 1J5EF 1IBKF 3TEGA 4RWWA 5LXYA 2UXDJ 2M2BA 2VZ9A 2I6WA 2BJ3A 3RRKA 1E6YA 4ZHRA 1FEHA 3Q8YA 4TPSB 2AEJA 4PG5A 5HROB 4DUZJ 3EMTA 5L9NA 1QE1B 2OELA 1GFWB 4RW6A 2DNMA 3G6XA 1HI1A 3I55S 4DUYF 1KD1T 4JV5F 3M8QA 2NYHA 1D9FA 1ZA1B 2DGXA 4WPAA 4EWTA 2HS4A 3TZZA 2NPFA 2E8EA 2XB2D 3R2DJ 1LWFB 1RHQB 3Q8VA 2B4VA 4K0KC 1J5OA 4XK8C 1GXLA 1UVNA 4ES2A 1R0AA 3LNVA 2LA4A 3MD3A 3H98A 2VASA 5A6PA 2WP0C 2BJ9A 3OJUA 2CQ4A 2RHQB 2MQLA 3LF0A 1U6FA 4ZPCA 4DSKA 1EKSA 5CA5A 4RX6A 1KQGB 4K2JA 4F3MA 1S97A 4Y65A 4PG7A 1EQMA 1FESA 1TAQA 3SFGA 4DS5A 3UZ0A 2GJ2A 5KT2A 4DV5C 2HHWA 4MMOA 2E7XA 1RT3B 1U47A 2AYBA 3W60A 4JYAC 4B3MJ 2YNIA 3VAFA 1VRUA 3I96A 5J1NA 1S9GB 1H2TZ 3V6DA 2BBEA 3C16A 4JUZA 2ILZA 5E5NA 1F5BA 2OMLA 2JEIA 2E8FA 5M2PA 4BDPA 1SI9A 3QRRA 3OUYB 3MM5A 2QL7B 2BANA 3BN4A 2APOA 2E1MC 2UV8G 4W90B 5IQQA 4G65A 3NNHA 5H9UA 1KFDA 1TH5A 3PX6A 3S6EA 1VEHA 1TKDA 2UUCJ 3HP6A 2R2RA 2AW0A 1HWIA 3NGSA 2IBKA 2V5HG 2Y1JA 4AQYC 5BYRA 1CJUB 4DR5C 3MOZA 1I5OB 2V63A 1LK7A 5E41A 3O44A 1YJWS 5LSLA 2DO0A 5K8PA 1SL0A 2KHCA 4B3SF 3T5HA 1NSAA 2DISA 2R8IA 1NEEA 2YWWA 3RW6A 1KFSA 4M94A 3UR0A 2YPYA 4QJVA 3BH6B 1SC3B 3NGKA 3HPOA 5IXUA 1HQUB 3C5EA 1IJFB 2CDRB 5G0RB 3RTVA 3DRPB 2L48A 3M7VA 4DX8H 3IR6B 1N56A 2I1RA 1Q86T 4F4WA 2PMZD 4QBUA 4QYZJ 5CXTA 4EZ9A 2CJBA 4DV1J 1HI8A 1RHJB 2BE2B 2HVDA 1ZB8A 1T11A 2H9ZA 3DXBA 3KJNB 4LRFA 3VGUA 2VG5B 4DQIA 4NLOA 1OSCA 2VIHA 2EC2A 5A0YB 1X4HA 3OL8A 1SJRA 1R8AA 4X65J 3LAKA 3AD8C 4LF8J 3OQ2A 1S6PB 4UUWA 5LMNJ 4OI3A 1GXUA 4DPWA 4EZ6A 4FYYB 5KOXA 4YB6A 2NCLA 2E8CA 2WVFA 3CJ3A 2PFFB 1T9WA 2B7BB 2BVZA 1XMOF 2OO4A 1VRTB 4DV7J 3GKUA 5IV3A 5KFOA 3R5AA 4JB8B 1SL2A 1TL3B 3J7ZT 3HFZB 3DLLQ 4EBDA 8RUCA 3EERA 4M5NA 2RRBA 4NI2A 4RW7B 4LVNP 2Z0GA 3TNVA 4GXRA 1D8ZA 3PACA 4I0WA 2W7OA 5EDWA 4F04B 1ZH5A 2LQ9A 3NGRA 4LRAA 2EG1A 2R9LA 4EBCA 3SFUA 5T7LA 4YR0A 4ED7A 3KHLA 5C24A 1U1QA 2LECA 3BYPA 5D0GA 4PR6A 3ENAA 5GVQA 4L6V3 2V8PA 4ZP7A 2CQ2A 4WFNQ 4KQZA 5GMEA 1PYOB 5F41A 3MAAB 5HSPA 2QLBB 4OHXA 2YQ0A 2Z30B 3EM1A 3N5FA 2R2TA 3QJLA 5KT5A 4F36A 1WC6A 3NMAA 1RAIB 4IOAQ 1QSYA 4F2RA 3AOCA 1SKRA 1DTQB 5B0DA 3BDPA 1JLQB 4CIOA 2ZWPA 2IDLA 1FE0A 5E7OB 4PPDA 1T5DX 2VG6B 1BUXA 2AYGA 5B0GA 1CLFA 5IC6B 5A2QD 1RBLA 1RWOB 4V1Ak 4NLRA 5KG1A 3L7OA 2FLOA 3TUIC 2NXEA 1A0OB 2ZM6F 1QUPA 1DQ9A 1X31C 4K59A 4PCQA 1K44A 4DF4A 3KJQB 3K0JA 3DRSA 3GCXP 2BKPA 3AODA 4OZ2A 4P7VA 1HD0A 1B64A 4AL7A 1KVIA 2ZITA 3T5JA 2CQ3A 1UVLA 4ZK7M 2ZBQA 2DY1A 4USHA 2DNRA 3K8VA 2GGPB 1S0OA 1FFGB 2CQIA 1IBMC 1HNZF 1U2RA 2BW2A 3A9VA 1IQTA 2CPFA 4NE9C 1U1RA 4DLEA 2ZH6A 3FC9A 4D56A 4LBHA 5ETTA 3UD5A 2QTWA 2PT0A 3MR2A 5IC4B 1JWWA 4KKOA 3GYNA 4GC6A 4AL6A 1S76D 2DRAA 3FKBA 2VFRA 3FJ2A 1DLOA 3ISZA 4LJMA 3R2CJ 3MDFA 3OFEA 3GIIA 1S59A 2MMYA 3AXMA 2HFSA 1FFSB 5DDRC 4YB7A 2MM9A 4WTOB 4J9KA 2DNGA 1DRZA 4CNYA 3TR3A 3GFYA 2HHXA 2UUAJ 1RTIA 3I0SA 4O23A 2ZH5A 2BKOA 3GIMA 4CWBA 4B3SC 3ILIA 4C8KA 3CJEA 1Y11A 4XPEA 2MKKA 2QA4G 1GQEA 3H2VE 3H90A 2CPXA 4ZPTR 3HHLA 1BQNB 3BGRB 4OQJA 1MXCA 3UN2A 5KFBA 2HHTA 2W2MP 4WYLA 4ZCKA 5I3UA 2WVEA 3K89A 1VBXA 2DGTA 3TUZC 2DD8S 3MI7X 2M9KA 2UZAA 3I6PA 3M30B 1DURA 4KJIA 3CD5A 1QAIA 1OWXA 2DGSA 4B17A 4FTFA 2C3PA 2L9DA 2I0XA 2YWKA 3TAMA 1NKEA 1QM9A 2D41A 4OJ3A 5KFNA 2GJIA 2QRRA 1G4CA 3HHLD 4PAAA 1P9QC 3DOKB 2YKQA 2VHGA 1RTDA 3C14B 3D6MB 2DNZA 2IVMA 3M6WA 3SV4A 2F4FA 3TJ9A 4IG0A 5DZ6A 3FUYA 4QR1A 1RU1A 1GMWA 4NXMF 2Y1RI 3SYZA 1WSVA 3HJVA 4ED4A 4LFCJ 3GONA 4YDXA 3NLCA 4Q2MA 1S1UB 3MECA 4LUBA 4EBEA 3DOLA 3R9WA 1X4EA 1XMOC 2DNQA 3J80D 3AHPA 1V25A 3TRGA 4LREA 3KLFA 3R5BA 1GMWD 1IB8A 3KK3B 1U48A 2LQ8A 2AV5A 2AGQA 3ENQA 3QGPA 4FKXA 4A8OA 2L9NA 1SC6A 3UO0A 1VHFA 1SJQA 1N6QB 3WBZA 2A3JA 3VAGA 2HLUA 5HL7Q 2F4VF 3SI8A 4P2MA 3BH7B 3V4IA 2QL8A 3IR7B 2ZDOA 2VQEC 4ZVHA 3DKDA 2AD9A 2VZEA 3MR6A 5HANA 1KSPA 1SH0A 1HIYA 3O1LA 2G2OA 3QYYA 1N5SA 2GQ2A 3I5BA 3QNWB 1URNA 2ATWA 1ACMB 2UXDF 1CSJA 4EO6A 2WONB 2DXFA 2LDIA 2C2DA 2DNYA 2VPWB 5KEIA 4I2QA 1HBNA 2YVSA 3NBPA 4DUZF 1C0UA 4C3LA 4L3KA 3ZTSA 5F9LA 3QJPA 1OS5A 3BZQA 3MHYA 2V2ZA 3HD1A 1RWKB 3C19A 4HH0A 2IFXA 1EETA 2A6MA 3BSAA 4IG3B 2VA3A 2EK6A 4DV6J 1A6LA 6FDRA 4KFBA 2UUWA 1LW0B 2H65B 1DBDA 5H9EK 3PW0A 3Q8UA 5F8IA 4CTAA 4J9VA 4R8UA 3PIPQ 1VQYA 4HPVA 1Q82T 4O0IA 4GRSA 4PQUB 2XS2A 1LXJA 2KZMA 4KR0B 4ZCMA 1XJWB 1RWMB 3E8OA 1WHXA 1UEKA 1FKOA 1G1XA 1T94A 2JC1A 2ZZTA 5DZ7A 1ZAXA 1IUJA 2MY7A 1JLEA 3D1OA 1RHKB 1F9HA 3AAWB 3LQVA 3GG1A 1Y7PA 2G1HA 1YZ6A 3WC0A 5KYVA 1ZM4A 4PPZA 1M5PC 2EGTA 4TYAA 3FEXB 1IKYA 2D7VA 4JBCA 1UKUA 3FMBA 2BABA 4X64C 1OQ6A 2VB6A 2XCPA 1VK3A 3EXYA 5HMWA 1NH7A 1T05B 1HBOB 3QATA 3GJSB 2PN6A 4DZDA 1N0UA 2XZWA 2P02A 4WWSA 2VOPA 1X5TA 4M5DB 3N28A 1L3UA 4KO0B 4K5RA 2UUCF 3DLEA 4DF8A 3IGNA 3PW4A 2KL8A 3TEHB 2UV8A 3RBEA 1M5SA 4G36A 1N54B 4ZIWA 4QWEA 1WKJA 2C2ZB 1VISA 3JSYA 3ZNUA 3SQGA 5KG5A 4NA1A 1EP4B 2Q1LA 1S1TB 5E7QA 4I68A 4OHYA 2ZH8A 3M2VB 3Q86A 4IRKA 1P4EA 1U02A 6FD1A 1M1GA 1FVQA 5KFGA 5JJBA 4Q8EA 4OYMA 4F0KA 4ZIVA 3AJDA 3QWPA 2YNFA 4UOGA 4DUTA 1FD8A 3QIDA 2WAQD 3HHLC 3QIPB 3DI6B 5J2QA 3V6JA 3JSMB 4DL0C 4U7UK 3R3TA 3ZTQA 4B3OB 2VU5A 4H4OB 3D4JA 5DDPC 1DY3A 5KG7A 4KE5A 1NJIT 4I2PA 3JYTB 3W9HA 1CC8A 1JOSA 1BQMB 2FJBB 3LP2A 1FDAA 2QIFA 2JNJA 3LUSA 4X65F 4EYHB 4JI3C 2CJYB 4LF8F 5HN0A 3K17A 4DFKA 3ZXWA 4PHTA 5LMNF 2DGOA 1FRMA 3THPA 4CO1A 5BSWA 2IM1A 3C15B 5C42B 3EE3A 1RAFB 1O5JA 5LM7E 3D9BA 5IM0A 3TANA 2VJVA 4Y2CA 2CJKA 3CJTA 4AYBD 1IJEB 3QRQA 3GJTB 5BJRA 2ZNYA 5D4OA 3KTQA 3ZTOA 2VC0A 4L2ZA 3DRRA 3I31A 1N4LA 5CD4A 4ED6A 4ZCLA 2ATCB 3ENWA 3RR8A 3HHKA 1S4FA 4XX2A 2FZCB 2YKPA 1BHNA 5KFWA 2R7TA 4FKYA 2HQCA 3NPDA 2CNOB 4EU0A 2EFQA 5KFHA 3I4PA 1S9FA 2IJNA 2GAGC 1HNIA 1KLNA 2V4JB 4UOCA 3CT9A 2Q6CA 3MPYA 3PHTA 1B3TA 2OSRA 3IEVA 4OX7A 3JB9k 4DFPA 2UXDC 3RB4A 4WXOA 3T6BA 1JLFA 2UVRA 2YWBA 3BGLA 3H5XA 4TNOA 2HGLA 4DUZC 4O4GB 4DR3J 3MM7A 2Y0BB 3KJVA 4BC7A 3BO3A 3M9MB 4MKBA 4UY85 5AXNA 2GHPA 1ZOTA 4WKYA 2J8SA 3HVAA 1MG7A 3NGTA 3M6VA 2P2JA 1Z1ZA 2CQBA 2B9YA 3SCKE 4K4ZA 3G86A 1RAAB 2MCQA 5LJ5Y 4DCUA 1RTJB 4Q0BA 3D1QA 1UA1A 2BX6A 2PT7G 3M8PA 3HO1A 4IRCA 1FLOA 4D57A 3G8QA 2VBXA 4IFYA 4WP8A 5A8WA 1KC8T 2XSJA 1OY6A 1YBUA 4O0NA 1HHTP 4GO7X 3VHQA 2XO7A 3PNIA 1F6TA 4MTPA 5H9EJ 4OMFG 3I4HX 1JLGA 3FRYA 1S49A 3NP5A 4KC5A 4OX6A 4B3MC 1YRUA 1KOOA 3KMSA 4FNIA 3P6YC 3FSXA 1MXAA 1C1BB 2W24A 2YKMB 3AXKA 3KK2B 3FBFA 4JI4F 2X1FA 3JXOA 4IQMA 2PROA 2CIMA 2Y4NA 2RU3A 4DWIA 4C8ZA 2B8PA 2ASJA 1S1XB 3EGZA 3GSIA 4RW8A 1XTZA 5HMXA 2XWXA 2YY3A 1R8HA 1N36J 4M95A 3LWLA 3KLGB 4W92B 1Q8IA 2DK2A 1TKTB 1D3WA 2MQQA 3NAHA 1U0HB 4OX9J 4I1TA 5K8NA 4E98A 5L39A 3CIMA 2GW8A 1IKWA 1PCAA 3T5KA 1TVRA 1EKRA 2UUAF 2W9BB 2ZBPA 2I9SA 2D27A 1O93A 4B9UA 2GVDB 1U4BA 2MLXA 2HMIB 4OZ5A 1S5ZA 3ONQA 5F8GA 1I94J 3MF5A 3TVZA 5CYMA 2C2KB 2CNNB 1RG9A 1E6YB 4ZHRB 3DGVA 3BM7A 2GC8A 1H7XA 4RW6B 1VQ4S 1LV5A 1H3DA 5K85A 2MJUA 2C3OA 3M8QB 5L1JA 3OD2A 1I6JA 3M8YA 4A46A 3KUHA 2E29A 1WF1A 2K8GA 4DV1C 4OZ3A 2KU7A 4YUDA 1X60A 4ZP8A 2R7QA 2R7RA 2V4RA 2V9WA 1J5OB 4F02A 2ZWOA 1HR0J 2OIHA 4MYUA 2M52A 1UAWA 2W4PA 2MKJA 5D15A 1R0AB 1D0EA 5HMZA 2N3OA 4LF8C 2DXDA 1RBAA 1FXDA 5ETQA 1G7CB 2XYGB 4Q5VA 3W62A 4LFCF 3FFIA 2Y8WA 4JP8A 4ZN3A 3SXLA 5IZHA 1M1KT 2IRXA 2X51A 5ETOA 1SQGA 2R7XA 2MDAA 4JI5J 2YTCA 4C6AA 3GLJA 5EWEA 3SV3A 2WVCA 1H2VZ 4DV3J 1ZAVA 1JK9B 3G6VA 2RAQA 2HBQB 3CJ4A 1RHMB 1V60A 4DV7C 2QVYX 2YKOA 2RE1A 2YNIB 2KZZA 3NYQA 1VRUB 3CQ1A 1X9WA 1NMEB 3CJQA 2MMAB 4B9VA 3V6DB 4LF4F 2DHMA 3C16B 1MSWD 3TUJC 3BREA 1MMLA 4OZ0A 4ELVA 1ZZFA 3TQEA 2PMHA 3J80U 2HVEA 1AYEA 3K2YA 3LOUA 3MM5B 3MFHA 2BANB 2LU1A 4DPYA 1U1KA 1TTHB 2E0GA 1EAYC 4B3RJ 2AGOA 5B0EA 1WD6A 4AXIA 1PC4A 3VGTA 2DHHA 3ZC4A 2Y1LB 1XK8A 2MQOA 2BMBA 2CWKA 4NDNA 2Z2LA 1WTFA 4AD6A 3NGUA 1U24A 1QSLA 4LF1A 1YQHA 4USTA 1FJGJ 2PMWA 4DV6F 3J7AN 5D0EA 3PESA 1VQPS 3PTWA 1N32J 1FD2A 3T1HF 1VYAA 2JDJA 4BC9A 1R6VA 3MMJA 4WP3A 2HHHJ 3DDNA 5BURA 1RADB 1X5SA 2V67A 3IBWA 3UE2A 1QSSA 3FCCA 3KG0A 4FYXB 4YQWA 1NNDA 5K14A 3J81Y 2OPQA 2KYXA 4OZLA 3U02A 5HP1A 2YWHA 2BRLA 4CNZA 4NLVA 1U8WA 2FJXA 1KVKA 4H4KC 4NZ6A 3POTA 4TVAB 2FGOA 4HL9A 4FS2A 4M5LA 3VAMA 3I0RA 1NM2A 1SKUB 2QT7A 4IH6A 4B9TA 2EK1A 3NNCA 3OFHA 4Z7YA 1Y5IB 1KHWA 5F8NA 2UXBJ 5FDLA 3A12A 3M4XA 4WBFA 4UOHA 5KG2A 2F40A 2J8AA 2ZZNA 3HI9A 3LUYA 3MM8A 3MGJA 5GTDA 1BXNA 2MLZA 2GMJA 1BA3A 3G7SA 4DU8A 3RB6A 2MYFA 1J2VA 3AT1B 1Q7YT 2YQ3A 2P2FA 1TFYA 2ZVSA 3LGNA 1IVZA 3EZUA 4WF9Q 5KFQA 2OI2A 3IM9A 1TKXA 3R5GA 2BA9A 1MMNA 2ASYA 3U1NA 4NASA 5JMNA 4C11A 3ZZUA 4LSNA 2OSQA 3EQ6A 2HSEB 2E1AA 2LVWA 3T5LA 4LE5A 4NI2B 3DC2A 1IM4A 1F2HA 3PY8A 3QWUA 4FNHA 3TZXA 5A76A 4GKJJ 2DYAA 2UUAC 2QL5B 1N88A 3VAJA 2VFVA 5T7LB 2RJZA 5C24B 1XRBA 4DZ6A 2AYMA 4NEZA 3FSIA 3Q8QB 5IT9U 4J37A 2HKEA 4FF1A 2BACA 3WQPA 1KN6A 1B0TA 3NI2A 4WFXA 1P9YA 4UZCA 5D4NA 4X4NA 3KK1A 1F1BB 1SC4B 4PZVA 3I9ZA 5DRKA 1URRA 5B08A 3W63A 1YKWA 4LF9J 4X4TA 1FNOA 5HBMA 4ZVQB 3UDLA 4I6YA 4USWA 2JEFA 1JQGA 2CPZA 2IHR1 3U1LA 1SIZA 4MAKA 2V34A 1Q95G 4DQQA 1LWXA 5CCLA 1D9AA 2ZD1A 2RD5C 1NBEB 4LFBJ 3O2IA 3O3LA 5GADU 2IRYA 2R2UA 4X4UA 4LFCC 5KT4A 4MKYA 5RUBA 1KOHA 1FFWB 2IDEA 3DRXA 1HYSA 2A6OA 4ANEA 3DHXA 3JSBA 4OYWA 2V8HA 2XM3A 2AJ4A 5C2GA 3DRSB 3PIOQ 2IAJA 2PA8D 2R7WA 4LFAJ 1RISA 4C3KA 4K4VA 4LBIA 1PSDA 4FF2A 3UEBA 4OYAA 5T8TA 3C46A 1NB2A 3FCEA 1C4CA 2HVZA 3BO4A 5T41A 2QL9B 5HJXA 3GIJA 4DN9A 1O51A 5A1GA 4KGMA 2YWCA 4CT9A 1U49A 4ZP6A 4IYQA 5B0CA 2PIIA 3N0VA 1QWIA 2P9CA 4KKOB 4OFZA 3GFZA 2RS2A 3AQOA 3D0IE 3A8JA 3TVYA 3QBCA 2B6AA 1XR5A 3DAYA 2RUGA 4DR3F 2HIYA 4CT8A 1DLOB 5EN1A 2HURA 1G3OA 4C98A 2KXFA 2IMWP 3CCMS 1X4CA 3PYDA 3OTBA 3CCZA 2XY7A 4P75A 3CQ2A 2NSBA 1DTTA 4O44A 4HACA 3PV8A 4DV6C 4QWAA 1N5QA 1RLCL 1H98A 1RTIB 3I0SB 4WU3A 5LMUC 3ZZTA 4A8SA 2IM2A 5AE1A 4M5IA 3BYRA 4KHPJ 3M8SA 2CQDA 3PRDA 4HHJA 5I3UB 3OHAA 1HW9A 3IEUA 1Z2ZA 2D3OR 1ZM3A 2W25A 4K7QA 1G6BA 4DQPA 3N79A 2EWHA 2MZQA 2N7CA 3CMAS 1Q1KA 2CPJA 3QT7A 3TAMB 2D3UA 2XMJA 1M1HA 4JI1J 1KVJA 2BYCA 3A26A 5L1KA 1IKVA 3D67A 1HNWC 1SC1B 1RTDB 3OR2A 1GX6A 1XR7A 4MTNA 1VDHA 1D1UA 3V4MA 1M0SA 4YB1P 2J76E 4ZDNA 1IR0A 4IG0B 2CU6A 3BKUA 4IOBA 3OTCA 1NAQA 1TUWA 2VODA 5A19A 2FQQB 3CIZA 1I3OB 2EBGA 2A10A 4OXIA 3FK4A 4Y2KA 3KLHA 2NS1B 3MEDA 4EUVA 2WOMA 3MECB 4CQ1A 1LWCA 1U6BA 2N3LA 1R8CA 1N36F 3DOLB 3UNGC 1CJKA 1SJ1A 3M32A 5D0HA 2RF2A 4WFZA 1HMVA 2PSZA 3KLFB 1J5EJ 3T1YJ 1IBKJ 4OX9F 3SQOP 3Q24A 1U09A 2FHOB 1IN0A 2KVQE 3BSOA 1FTCA 3TA2A 4CLUA 2F5GA 2P9EA 2BOPA 3V4IB 1VJWA 1SKSA 1FTRA 5ETSA 3MCMA 4X4OA 2CQ0A 4H54A 2HQGA 4DUYJ 2RS8A 3W8PA 4IO1A 4ANDA 4GS5A 5AT1B 1I94F 4A8MP 2O1PA 2ZBIA 1WEZA 4TXSA 3VVTA 4LR8A 1WSRA 4DX7A 1RAJA 8AT1B 4PQAA 3NCRA 4CZCA 2QGFB 3NXZA 1AT1B 1WJ9A 1Q53A 1YTYA 4I2QB 1HBNB 1RB0A 3NBPB 1F0XA 2LKZA 1C0UB 3M05A 4ZJQA 5AXMA 2P20A 3FNNA 4MK7A 4URQU 3ZTPA 1EETB 5GADI 3THTA 3FSYA 1RP5A 2FVQA 1N5VA 4ZLNA 3EWGA 4JI6F 5EWGA 3VALA 2J7UA 2AEFA 5BUSA 4KFBB 2FGCA 3MM9A 4ICLA 3W3SA 3PX0A 2LCWA 2QZ8A 2AJ0A 2VPZB 2KRBA 4CTAB 5F8JA 4ZPAA 2HFNA 4R8UB 3E01A 4C8YA 2X1GA 2FHJA 3RAQA 3PVXA 1KDNA 1LXNA 1Q0NA 4JI5F 3P96A 2HRYA 4LF2A 1PJ5A 5CYQA 1FKOB 4DR6J 4F50A 2BM1A 1RT1B 4DV3F 2KDNA 2DR5A 1JLEB 2WW8A 1RI7A 4LRDA 9RUBA 1WKKA 1KEKA 1M5OC 2D1RA 2KG1A 2WZ1A 3HD2A 2FHJD 4R5PA 3DLPX 2Y0SD 2IRUA 1IKYB 5KFZA 2A18A 3BGFA 1UTAA 3T9ZA 2H5IB 1FX2A 3D5MA 2MKYA 2BZ2A 2M88A 4ISBA 1AUSL 2CG8A 5FLXD 2RVJA 2VOOA 4CLZA 3FEYB 3LTOA 1NPKA 2JOQA 4M5GA 3QT6A 5I3PA 1H2UX 4J90A 4B3RF 1WC5A 2YKAA 1VLAA 1QTNB 3DLEB 4B9SA 3G87A 3Q89A 2N4DA 2Z51A 3W9JA 4DR3C 2JLFA 1F9EB 1FNXH 2BJ8A 1FJGF 3I5CA 2IJRA 3SQGB 3OTEA 4ZOSA 5D78A 4OJHA 1N32F 2GO9A 1S7IA 1FI4A 1RXOB 2BM0A 3RAMA 2HHHF 3KMQA 4USUA 1WC4A 1SJ3P 4WZQA 2CDQA 3A8KA 4DPTA 2GQCA 2XGPA 1QAXA 2XWYA 4P9SA 2YNFB 4QIFA 5J2QB 1UEVA 1C1CA 3K5MA 5JRHA 1XWLA 4KH1B 3ILLA 3HZEA 1FF2A 1OSDA 1OMSA 1RLDA 2HGMA 4ATNA 4I2PB 1VC6A 2O5DA 4JOUA 5MLCV 4YFUA 3D28A 1LW2A 3LP2B 4ZVEA 3KG1A 1KWMA 4PEOA 1GPMA 4FPIA 1Q4RA 4OI6A 2AKWB 4BBYA 2I8EA 2DEJA 5CYJA 3FCWA 3RR7A 4NXNC 4ZJOA 2CXEA 3VWSA 5IFMA 1L2FA 3VGVA 1HWUA 3TI0A 2ZOMA 5CAAA 3RV2A 3OLAA 4P74A 4CLLA 5IM0B 2JH3A 2D74B 2QYCA 3MWBA 4NYZA 2QLXA 4X62C 2VONA 3UQSA 1A9NB 5DG9A 3LP1A 3MEGA 4E0DA 3V6KA 1N2FA 1N36C 2JSXA 4DPUA 4QIGA 3S1TA 3OV7A 3DRRB 3GCWP 2RQ4A 3OTOC 4DHVA 4A8KA 5DG8A 1S0MA 9ATCB 2V50A 4ZA1A 3CDAA 2HQFA 4GKJF 1REVA 3W8GA 3EPGA 2FHMA 1FRLA 2VBYA 4CH0S 1L3VA 1VLOA 2DPJA 4C8MA 1HNIB 1RT7A 2FJDB 1K1SA 4D3HA 4K4XA 3I5AA 4XPCA 2FLPA 1JLFB 2EC0A 5KFPA 1YJRA 4P2XA 1PILA 4J9QA 3PJWA 3M6UA 4G1IA 2NXNA 1NHVA 2HHPA 3MM7B 3T3FA 3I87A 1Y4ZB 1BGXT 4XO0A 2XGQA 3KJVB 4N77A 2RT3A 1WHYA 3IPLA 4LF9F 4ED3A 2M5YA 4NLXA 2QFJA 1Q16B 3BR9A 5IT0A 1CBKA 3CUNA 3GJRB 1RHUB 4KGVB 2W7PA 1HR0C 4FF4A 3H2LA 4Q0BB 2N4CA 4B02A 1K8AT 4KTVA 2KM8C 4ZP9A 2V4QA 4LFBF 3M8PB 2J6SA 4QIVA 5A8WB 2FB0A 4IFYB 1YRXA 1HWLA 4WYWA 5L1IA 1X4GA 2XSJB 2JJ4D 1QM4A 3QSYB 5HVFA 1N8RT 3GYXB 4DV3C 3KOAA 1RT6A 4LFAF 1FEEA 3Q2SC 1JLGB 4I7FA 1KQSR 1V5IB 4IRDA 4QPXA 1RU2A 3L3CA 1XRCA 1HHQA 1VQ9S 1USPA 5GAHI 3LWMA 5HO4A 4DL6A 2OEMA 4JI8J 1LWEA 2UU9C 2LMIA 3JAMD 2HZCA 4G6VB 2QEXS 1T03A 3R9LA 1R0CB 2J0WA 5D77A 1Y3JA 4URSA 4Y34A 2W2OP 2RQMA 1PYSB 4HYKA 1X9SA 4C0HA 4DX5A 4RW8B 4LF6J 3CNQP 1E6VB 4J9PA 2NZ4A 1JNRB 2HHVA 3JSRA 3TDEA 3TZYA 2F1FA 2YWFA 3J81D 3C2PA 1OO0B 5ETRA 4QW8A 2DPLA 5C25A 2Q66A 4PG4A 1ZZNA 2OHDA 5J1EA 4ES3A 5KG4A 3VAHA 5IOLA 4QQBA 4KY3A 2J9DE 1SVDA 1WG1A 1IKWB 2D1QA 3OL6A 5DJBA 3IS9A 1TVRB 4P10A 1EGAA 1APSA 3H59A 2AZ3A 4JI0J 3ILOA 5B09A 1LQLA 2XZDB 2DY9A 2Y8YA 1RT5A 5BYQA 2HHHC 3TAQA 4KHPF 3R7NB 5F8LA 2JFKA 2B4OA 4XDDA 2NCKL 5CYMB 3CXCR 4NLDA 4LF7C 2RSQA 3GIKA 3WIUA 1T9UA 2XMUA 3NY0A 3O2EA 3D3CJ 4F8RA 3IC1A 4ZJLA 2KRRA 2Q43A 2HRTA 3K8WA 4YHHJ 4A8QA 3R44A 3QFWA 4JI1F 1RT4A 1Q81T 1YJ7A 2FTRA 3A1YG 4PXEA 5KFIA 3BR8A 2E5LJ 4OYXA 1P6TA 3IR5B 1RSCA 2QX0A 3VQSA 1TMMA 2D3O1 2UXBC 4PABA 2F8MA 1TKZA 3TJAA 2JMPA 3GP9A 4B9MA 2DIUA 1YITS 2C3MA 4HTIA 3BQ2A 4HT5A 3R7BB 2FY8A 3FFIB 4TYBA 4MIWA 4RVNA 3EZ5A 4NRTA 3CWJA 3CO0P 4RUBA 2LU2A 3ZZ0A 5KG3A 1EX8A 1KHVA 3AF5A 2IC3A 3V5RA 4OZ1A 4IR9A 2G0CA 2N7YA 1KLMB 1VK8A 3T1YF 2ADBA 1NZ8A 2D69A 1NSQA 4Q8FA 2KFZA 5I4MA 4IR7A 3WC2A 2ZNZA 1YJTA 4WP9A 4CO4A 4PXDA 1P7LA 1KTVA 3CEDA 1YHQS 3GV7B 1KQKA 3AFGA 4GKJC 1CS4A 3CMES 2MEWA 1PAUB 4YP3A 3BSCA 2ZJRQ 4UW2A 1S0VA 5F3TA 3MPDA 4G3IA 3BKTA 5KT6A 2KFNA 3CULA 3PDNA 5DLGA 1C0TA 4X4QA 1O92A 3G96A 4M5MA 4FXWA 4Z7CA 4DSIA 1B0PA 1WC3A 3QAEA 2NUHA 2HEKA 4WS9A 3L8CA 4WKRA 1F2GA 2OPRA 2KFYA 2HK2A 1WI6A 1PKUA 1WHVA 1RQ0A 1NK7A 3V81A 2OD4A 1FVSA 1RA7A 3CDWA 1ROFA 2E5GA 2QLWA 3H0PA 1CJTA 1QY7A 4JYAJ 4JI7F 5BR8J 3G82A 3DDKA 3DU6A 1SV5A 3P49B 3GR0A 2BQRA 3NRBA 2XMMA 3F0NA 4CP5A 3A8EA 3AF6A 3OFGA 1K0VA 2Y3YA 2C2OB 3R5DA 5HQLA 4LFBC 4J5OA 5K14B 2OPQB 3CJ0A 3CJRA 5F8HA 4DR4J 2VUGA 5HP1B 1N34J 4PUGA 2RNEA 2W8KA 2CY1A 4DR6F 2VDIA 2ROPA 1K9MT 2XTJP 3POTB 1KS2A 4RLFA 5ETMA 4ECXA 3KHGA 1BWEA 2HPUA 5L38A 3I0RB 2YCBA 3EYZA 4U5YD 4LFAC 4AQYJ 3C6TA 1EIYB 3W7BA 1ZETA 4DV0C 2ZE2A 1NKBA 5FDLB 1FWKA 1H73A 5DQHA 1FUGA 1Y3KA 3D6TB 4NOZA 4AT1B 1JNZB 3GYGA 1O8BA 3CCVS 4DMZA 1U1MA 1XS3A 2MHNA 2UXCF 3MM8B 2CVEA 2NLWA 1R31A 2KI2A 2C28A 4FUTA 4ECZA 1NJWA 3FBBA 3N2QA 1VQNS 3TA0A 3KLVA 5IS2A 1SQFA 1R3NA 4PZPA 3EUNA 1F3VA 2XS5A 1S79A 5B0FA 1VQKS 1ZBTA 3EGNA 1TKXB 4JI2C 1MU2A 4D3GA 4C11B 2XMKA 2ZOGA 4LSNB 2NR0A 3BKFA 2D28C 2J0QD 3PO4A 3PFEA 3N6LA 3EXCX 4CDIA 1ULRA 3NOCA 1GEHA 3MEEA 4XTTA 1TK8A 2F7VA 1T9VA 4IZ6A 5KFLA 3PRBA 4L3NA 4NZ7A 2R8KA 2ZFHA 2MKIA 3Q0AA 3PHEA 3IWLA 2ZVIA 1UVJA 2HYIB 4RW9A 2OEKA 3IM8A 3M2RA 4NYPA 2MZ1A 2RUSA 3ZO7A 1OJ4A 1MD9A 4ELTA 3OPKA 2U1AA 1MKYA 3IBCB 1BC6A 3BDEA 4OZJA 2Z2ZA 4IR1A 4O3OA 3DMJA 3RW7A 4NLYA 3KK1B 3S8SA 2QLJB 3OSNA 4P73A 2CZ9A 3UCZP 3FZ2A 2C2MB 3KUEA 4KYZA 2C2EA 2D3ZA 5CCMA 4JI1C 4LF5C 3UDCA 2CZ4A 4K4UA 3IN5A 5HBMB 1IXKA 1S6OA 2QG9B 5EX3A 1T3OA 3FGVA 1XMBA 2E66A 3F44A 2RKIA 2O01C 1YVFA 1S12A 1RAHB 1PAEX 1JKHA 2ZD1B 1S48A 2ZUAA 3IFEA 4WV3A 1BMQB 4MIBA 4JM1A 4DSEA 2AYEA 2EFOA 2BQ3A 2JFDA 4CO5A 4DPOA 1U2FA 3WX4A 4H4MA 4L76A 5EGYA 2ZH4A 1WDTA 4WIQA 4WFAQ 1HYSB 2ALYB 4X2BA 3QJJA 4DR2J 2L08A 5GAEU 3VR1A 3HSDA 4YB5A 1VBZA 1TL5A 3TX0A 1JJ4A 2IAJB 5KFRA 1ZM2A 3OJSA 1XEZA 3CSKA 2QSFA 1J5EC 3T1YC 1IBKC 3D1HA 3H4DA 3MMCA 2E7VA 4X4SA 3VZIA 3PO5A 4DV4F 4R0MA 2CNKB 2NYIA 3S01A 1QAJA 2ACYA 4Q43A 4QPTA 1QVFR 2P5VA 3UW1A 4DUYC 4JV5C 4C8OA 2OH2A 1LFPA 1ZYQA 2ZC4A 2J7KA 2YWGA 1ZPVA 1XNQJ 1NH8A 2PI5A 1N33J 4ED8A 4HVZA 4QU6A 1WOSA 1X4BA 2OD6A 1RYRA 4M5KA 2B6AB 2HK3A 4KRWA 4EEYA 2FLLA 5H9FJ 2AT1B 1S9EA 4L74A 1MWQA 2R8HA 4HT7A 1DTTB 4O44B 4HACB 3VGSA 2CJAA 2M5HA 3CD6S 3CCJS 3ET6A 1OPIA 1ZA2B 2ASBA 4OHWA 1KONA 1RWNB 5I3QA 2W01A 4B3TJ 3NGDA 1GTEA 4QR2A 3W5XA 2QW0X 4MJKA 2I38A 1EB0A 5A2QY 1WCJA 1TV6A 1FERA 3RG2A 3DYAA 4OYCA 4FXVA 3WDOA 1P1LA 5DM6Q 4KGZB 4RUCA 4DEZA 4JI4J 2G4BA 1IKXA 4ER8A 1TR0A 1H38A 4OI1A 1AFJA 4ZCIA 1R7IA 4BHQA 1FKAF 3ETOA 2KVIA 4USIA 1IKVB 1A7GE 4TKTA 2VKZG 3AJ1A 3OR2B 1JXVA 1RTHA 2QVXX 4FVMA 1NZAA 2XR1A 1TMJA 4IUFA 5EUHA 4M5HA 3BGOP 4JI8F 5KT7A 4FN5A 2MKCA 4R1MA 3UCGA 2ZH2A 3R5CA 3SBMA 2ASDA 3IG1A 3RJMB 1PC5A 2CXCA 1UPMB 2G13A 1UJ6A 4DCSA 3SCIE 1S77D 2UUBF 3IRWP 3KLHB 4LF6F 4DSJA 1F9FA 3MEDB 5BUQA 3TWZA 2WOMB 2DNNA 1LWCB 2E1PA 4HHUA 2ACMA 3PBKA 1CJKB 2HBZB 2RDIA 3C6UA 2BV3A 3M32B 2RF2B 1HMVB 2CPYA 5HVHA 2C2NA 3JAMU 3RZAA 1BE4A 1B70B 2D1TA 2YX1A 1B7YB 1T9XA 2XS7A 3CW9A 3OTDA 2M8HA 2PC6A 4CLYA 4JI0F 3CJKA 3PCOB 3IP0A 2DR7A 4KV8A 4N76A 3DU5A 2YH0A 3DLGA 2IYIA 3NS5A 4M8LA 3RRGA 3NMRA 1IBLJ 5LJ3Y 1NJXA 3BO2A 3F56A 3R6LB 5HLFA 4XAKA 2ROEA 4LSZB 4D4GA 4FF3A 4YHHF 2EFVA 4AFFA 4DL4A 5DM7Q 1XMQJ 1RY2A 4L7IA 2HIQA 3DCAA 1RTZA 3N6MA 2DBBA 4NLGA 1V6HA 2E5LF 4UQTA 3VAIA 4FYDA 3NG8A 4ICLB 3G2XA 3MM9B 1HWKA 4NCAA 1RWUA 5K9FA 4C3MA 1AROP 1NJZA 4DCTA 1GX5A 4WTYA 2Z8QA 4CLPA 2B43A 3IRXA 2FPHX 4K4YA 3CJSA 3E01B 2XHWA 3OL9A 2HS0A 3H2UB 3CCWA 2AIRB 2DO4A 3AOBA 4LF4J 3CDEA 5KFDA 5CYQB 3GJQB 4F0HA 5DO2A 3J80Y 3JSMA 1T7PA 3D54A 3I82A 3FCHA 4ZVUB 4WCEQ 1HKAA 7AT1B 1H0HB 2FC9A 4R5PB 4IQXA 2MJNA 1HNXJ 3MURP 4PWDA 3ZZRA 3OLBA 3CTRA 4Y0FA 1PJ7A 4DCJB 1SJFA 3H20A 2B9EA 2UUTA 3H5YA 5G4DA 7FDRA 5K5MA 3H42A 5GAGU 1QVGR 2VFUA 3ITHA 3VQTA 1WC0A 2DJWA 1UPPA 3LA0A 2OTJS 3MMAA 3MPWA 3P5TL 1X5OA 1S6UA 3SMZA 3T1HJ 2B3TB 2U2FA 3E7WA 2JVRA 3E51A 3VZHA 4ZITA 1V5VA 1JLCA 4K0BA 2Z56B 4TU8A 4WJBA 2LDYA 3S82A 5KFUA 1P1TA 3A3NB 1ML8A 4DV5F 2FJAB 1N48A 3HX9A 2BR0A 3OVBA 3GILA 4JYAF 4OV6A 1WORA 5BR8F 1PU1A 5BSUA 2NXCA 2CQ1A 1IR1A 2P2QA 1MN7A 2ZM6C 2LQBA 2ZOFA 2FLNA 2QVZX 3TZWA 3NCQA 1D8YA 3KG4A 1WOPA 3QO9A 2H48B 4X64J 4RBVA 1M5HA 2OPSA 1Y5NB 1YJUA 1QUVA 4DJBA 3TO8A 3BJYA 3I07A 3M8WA 1L3TA 2OEJA 4DR4F 2HWHA 2V4JA 1FHTA 1N34F 1C1CB 2HNZA 4J9UE 1SJ4P 1EJ7L 1DZ5A 5B0AA 3ZFVA 2QO3A 3VV2B 1HNZC 1JX4A 3OBIA 3ILJA 3KLEA 2CYYA 1PG4A 2M70A 3U27A 3TVKA 1HHSA 5HQ8A 4HEA9 1WG5A 3HLUA 5KT3A 4AE5A 4AQYF 3KYLA 3AA8A 4DCOB 1LW2B 3ISNC 3JTOA 3CJ8A 2J0XA 1KQFB 2L9WA 3UD4P 3A3PB 2BE9B 2L41A 3MUMP 3P45B 5ITHA 2M3DA 3W9IA 4Y6IA 3SSQA 3LP0A 5DG7A 4Q2LA 4OL8A 4NMLA 1NCLA 4N5SA 1M6XC 1REGX 4GKKJ 2POKA 2DHSA 3AD9C 1HARA 4QR0A 2AJQA 1T5HX 3C8YA 4LF6C 4Y00A 2JEGA 3FEZA 1WELA 3GFXA 3LP1B 3MEGB 2CJ9A 2CA9A 4RM3A 2UVWA 3RBDA 4PXCA 1BY9A 4OI0A 2D1SA 2HFVA 4EGLA 3BF4A 1NXIA 1WACA 2QA1A 5IT9Y 3PKMA 4J9SA 1N52B 5FIIA 3W64A 2D9PA 3OR1A 2BUNA 1WUUA 1XBWA 3TP2A 4B08A 3R1LA 3N54B 5LL6d 8ATCB 2CFXA 5E3AA 1REVB 1HL6A 3RU0A 1CG2A 1X4FA 3TUFA 4JI3J 4DS4A 2CNLB 1VC0A 2C42A 2DXEA 2EXUA 4FBUA 2LEBA 3LAMA 1RCOB 3HSZA 3A9UA 1RT7B 3MCNA 1M5VC 1FA0A 3PROC 3D2WA 3JQMA 4KB7A 3HSGA 3Q23A 5ETVA 3PR5B 4ZLPA 4CLSA 2B8QA 1RHRB 1S1WA 2QC3A 1UZHA 4A4JA 4I67A 1XC9A 3W5YA 2CPHA 3J81j 2EFNA 2KXHA 3QZ8A 4YHHC 4HTJA 2HFZA 2ZEJA 2GIQA 4NXMC 4BLGA 4WFBQ 4MH4A 5A8RA 3HVTA 2ONFA 2E5LC 4F4XA 4PUOA 1DQAA 2FHKA 1GNKA 3CJ5A 1UMJA 2Q6BA 2VKRA 1CULA 2KDOA 4IOCQ 3BS9A 2RILA 2Y1IA 3C66A 1RYSA 3EVMA 2M8DB 4LIRA 2GHVC 2HMIA 1K73T 2PFDA 5ADZA 5IV4A 4FP9A 4QYRA 2F4VC 5B7WA 2IMOA 3HT3A 2MLYA 3HVWA 4DR2F 5BXIA 3H2TA 5E0OA 4LSLA 5GAGI 5HMYA 3L7PA 3QMQA 1RT6B 2RRNA 3EGWB 2QMWA 4CYUA 2HWIA 3CW2C 4IFVA 2B56A 3CCLS 5L1LA 4I7FB 3DNCA 1BQXA 2J9CA 4Q45A 3M6XA 3GR1A 4F0MA 2KJVA 2OFHX 3M2UA 2ZKUA 2K1RA 1USPB 1ZTTA 2LQ5A 4RBUA 5HJYA 1LWEB 1S4EA 3MR3A 4HLBA 1SB6A 2ZHBA 1T03B 3M9OB 3VTIA 2WHOA 4TU7A 2JC0A 3PG9A 1SBRA 2BE7D 2NUUG 2WCXA 4NZ0A 4EATA 3UFCX 1BWVA 2EPIA 4P52A 1XNQF 2WVDA 2LA6A 3EDRB 4RNMA 5LT5A 4NLTA 5E2QA 4URGA 1N33F 3SEOA 1RWVB 2AQ4A 1YG0A 1XERA 4FXDA 5C25B 1NY8A 1YX2A 3VVUA 3W66A 5J1EB 3CCTA 4J9LA 5AJ3J 2R7SA 2CZVC 1YGYA 2NXJA 1N5TA 1AUDA 4H4KA 3ETMA 4IDKA 2KXNB 3IS9B 1G2EA 1VI7A 1OY8A 4CO3A 4KHRA 2EKYA 5J2PA 5BR8C 1HI0P 1IBCB 1X7VA 1IBMF 5A8KA 1OIAA 4ZPVR 2LXUA 4DCPB 4B3TF 1PIEA 1NDCA 4C7QA 4YN3B 1RT5B 2CADA 5KG0A 2MQNA 1KRPA 4P2FA 2EI5A 4DR1J 1KNZA 4P71A 3HSJA 2K7JA 5A2QU 4B9LA 1HBUA 3TOQA 4DR4C 1N34C 3QLHA 3UDVA 2GMHA 4MK9A 4RO0A 1ZM9A 3PKYA 1Q5YA 5J1PA 5L8RC 4I6AA 4UT4A 1RT4B 2R7UA 1F5CA 4IO9Q 2V8VA 4ZVTB 5KG6A 2KJWA 4YY3J 3QRPA 3NEKA 1HQ2A 1FXRA 3K6RA 3HHEA 1QJHA 3W2VA 1FRKA 1TKZB 3PEJA 4I4BA 5BSTA 2UUCC 3DGPA 4HHHA 3AH6A 3MR7A 2VJUA 4XIUA 4NCGA 3RAXA 2E7GA 2MKSA 1I1GA 1I51B 3IO1A 3MXHP 1WF3A 4RKUC 3HCXA 2HBYB 1S1VA 1TL7A 2V94A 1AB8A 2BJ7A 4RMNA 4U6PA 4UZBA 2MY8A 2IC3B 1X4AA 3AA9A 3QAUA 5F8MA 1MROA 3AY0A 4N41A 1SL1A 2QE5A 4QCLA 3PM9A 2HQDA 3ULHA 5CH7B 4ECRA 4K5SA 4ZVOB 4J9NA 3D3BJ 4UTGA 4F2SA 2R8JA 1CQMA 2ATLA 4GXQA 3RB3A 4LQ3A 2BJDA 1CS4B 4NLUA 2KYZA 1NK5A 3P4UB 3TARA 3OT9A 2RDDA 1IBLF 3CW8X 2M4MA 1C0TB 4JI6J 3FBCA 2WSEC 4DL7A 2BJ1A 1R89A 1GK8A 1HQEA 1UVKA 4X65C 3OVSA 4CO2A 2IM0A 1MN9A 4I6WA 2OKQA 1XMQF 5BSRA 5LMNC 1T9YA 5DDQC 4F4KA 3CE8A 2OPRB 3SSSA 2OAUA 1HH2P 3V81B 4FPRA 4RU2A 4BSZA 4KT0C 2UVVA 5EWFA 1CJTB 3LAXA 5LXRA 2GNKA 3W5ZA 3G82B 2PEBA 5JUMA 4C9DA 2KT3A 2WB4A 2VQEF 1GMUA 1SV5B 1TK0A 3I32A 1V9OA 2CPIA 4P7TA 2ZBRA 3N9UC 2HHSA 3GIRA 5DETA 2DHGA 1UWDA 2O66A 3MUTP 4WU2A 2FYXA 3DM2A 1WEXA 3R97A 4ZVFA 4ILLA 1MMDA 4DR2C 5D0RA 2VV5A 4DQSA 1S99A 2HRUA 5D4PA 3CCSS 1Q8LA 4MKAA 3MCOA 3C6TB 4RL1A 1HNXF 3F41A 2ZE2B 4F4AA 1QDUB 1AZSA 1H7WA 2A0FB 1UETA 3PRVA 4DR7J 4F26A 2GVZA 1KTQA 5BSMA 2KT2A 1YJVA 5E3RA 2H3EB 3NAIA 3HM9A 2BQUA 4KBIA 2P9GA 3US5A 3FZBA 4XDCA 4NEYA 4DBQA 3G8TA 2FY1A 3NCPA 3BBFA 5J2MA 1XNQC 4K4WA 1FK9A 1N33C 4DCVA 1MU2B 2SXLA 4N56A 1LNQA 5BSVA 4QZVB 4J91A 2PDAA 2YNHA 2GFFA 2VF3A 3MEEB 2OPLA 3HULA 3IWNC 2XNQA 1WNEA 2K3IA 5IFIA 3NWGA 5F9NA 2Z58B 4K4SA 3OFFA 3CCRS 4X64F 4X66J 3GSDA 4RW9B 4B3TC 1AFIA 3TR5A 3M2RB 4L73A 1VJQA 1S7HA 2CJXB 3BSNA 1RDRA 3HFVA 5KFFA 3DN9A 4AXJA 1HNVA 3M8ZA 4A8YA 5DLFA 4DL5A 3N01A 3DMJB 3IAM9 1J27A 4JI4C 2XY5A 2A1BA 2V9KA 2EFGA 4O3SA 1EHWA 2GAHC 2OGUA 5D6GA 3PW5A 2ZHAA 4OV1A 4A48A 2YBVA 5KFYA 2R3VA 5IWAJ 2AHOB 3R5JB 4K8RA 3R6GB 3ENVA 2OUGA 2X1BA 1ITPA 3IBFB 3NWRA 2RKIB 3HT0A 2DHXA 4C97A 2EFPA 2OPPA 1JKHB 4G37A 3D6HB 2FZGB 1UA0A 3M8RA 3TUPA 2I5JA 1TU0B 4GKKF 3H25A 1VFJA 4HDHA 1VQ6S 2LEPA 4H4MB 4HI2A 3BPSP 1SQEA 3M9NB 2YXLA 1FCAA 2CPEA 2V8GA 3PJ9A 2YH1A 4QU7A 1XQIA 4LIWA 1UWAA 3T1AA 1WWHA 3IXQA 3MMCB 4OLPA 3PW2A 4ECSA 2XMWA 2RHSB 1OY9A 2Y9HA 4JI3F 1RABB 2IVYA 4RNHA 3B6BA 1VMBA 2KHDA 2J9EA 1BLUA 3U1MA 2HLTA 1VHIA 2EG2A 4KPCA 1WF0A 3EZOA 4J9MA 1SH2A 4FYWB 4L4QA 5AE3A 1IBLC 2DNLA 2L3MA 1GH8A 1U1PA 1VOMA 3EX7B 4RVOA 2LXIA 1B4SA 1YJ9S 2N82B 1D9DA 2FDNA 3T6JA 2PI4A 1R43A 2QSWA 3QT8A 1XMQC 3OHBA 2MHEA 1S9EB 2F65A 2OBVA 1T0TV 5GMDA 3BN7A 2DNPA 3A3OB 2DGQA 2R7VA 1LFWA 1L5UA 2WK4A 3ET6B 2G0JA 4N7TA 5DDOC 3UPFA 2NZCA 4YOEA 2MTLA 3BBBA 1NSKL 3KUGA 4DX6A 3RUBL 3QPIA 5AXKA 1W2IA 4OX8A 3AB4B 3FBEA 1NDLA 3TAPA 1TV6B 1JLBA 4OI4A 4O3NA 2VG7A 1IWAA 3DYAB 3QQCD 2VBWA 3MCSA 4LF4C 3BBCA 3HZGA 1IKXB 3H5UA 1DQ8A 3B4DA 2CWXA 3NOGA 4A47A 1AW0A 4Q7AA 3GFHA 2MPUA 4ZKAA 1NHUA 2AF6A 4NX9A 1U2CA 1RTHB 4QOTA 2DGUA 1VC5A 3O8WA 4U95A 1S72S 1HNXC 3KFWX 1Q8BA 4NLQA 5F3ZA 4NA2A 5ETPA 2ZHOA 3HDSA 1FNMA 2BKNA 4BWMA 1NJYA 5E3QA 2ADCA 2P2BA 3IG1B 2XULA 5LMUJ 2KB2A 2H1YA 5J2NA 1CVJA 1VBYA 2J7WA 2JLEA 1XNRJ 4O3RA 2FZKB 1DAXA 1TUVA 4TU9A 4C0OC 4WK1A 3A25A 2OFGX 3KHHA 3NNAA 4ZLLA 1KKHA 3T1HC 5CD4H 2MGZA 3C6UB 4UY8T 2HGNA 4X4RA 1NK0A 2H4WB 1VS3A 5CQGA 4QWBA 4DDFA 3SDEA 3HHLB 1RT1A 3E3XA 2DYJA 4U8VA 3KLIA 1PG3A 5AJ3F 1KKGA 4M63A 4Y3CA 3B82A 3PJXA 4QIEA 3MM6A 2M0GB 3D66A 2YNGA 3L9ZA 1HNWJ 4B3MF 2HFUA 3F73A 1FX4A 3CJKB 4J9RA 3RG6A 5KYTA 1UZDA 3J7YU 4KV8B 2DNOA 3DLGB 3OL7A 3G6ES 2GX8A 2COLA 4PWUA 2ABYA 1PO6A 2OTLS 3VAKA 4DR1F 3DXSX 5CZXA 5HLFB 2CRLA 1B0VA 4DG1A 4ZS6A 4MT1A 3CMQA 3HKWA 1S6QA 2ZH3A 4RU9A 3W1YC 5C2CA 3RB0A 3QGGA 2IYGA 4YY3F 2DRDA 3CC2S 2VSQA 2YKNA 2LEAA 2NPIA 2B9WA 4TY8A 3UN3A 3SCLE 5IT9D 2E5IA 3H5SA 2AP6A 2H5EA 1RT2A 2Q3PA 1RA6A 1HA1A 2FVCA 4RBTA 2E9RX 2D7SA 2RMLA 1XIQA 2W1BA 5K8OA 1RWPB 5K8MA 3IRXB 3GQCA 1ELOA 1Q8KA 2M5OA 1RKIA 4USVA 2D1CA 2B4PA 4ZPBA 4FUQA 3WHIA 2E1CA 1DJ0A 3THVA 4ID5A 4DG9A 4NWBA 4GKKC 1LQ9A 1MXBA 1NDPA 1RUSA 2G0IA 2DIVA 4WE1A 4DPXA 2MQ8A 1UKKA 4M5JA 2W2PP 2CUYA 2ALZA 2UVUA 2AZ1A 3HHNB 1Y10A 2DNHA 3RYLA 4N47A 3GU0A 2H5JB 2B5JA 2HVHA 3DHWC 4DV1F 1CPZA 3GV5B 1DARA 3PW7A 1W26A 2QA2A 1FWPA 4PWDB 2PO4A 3DOMA 1YJNS 1JJHA 3TQ1A 1VQLS 2HJGA 5AE2A 2JNVA 1YBAA 1FO1A 4U8YA 2MB0B 1W25A 1VIOA 3ETCA 1W2BR 4YDDB 3ITHB 1ZB9A 5FD1A 5K8FA 3DLHA 3C3LA 4KPYA 2HNDA 4JI7J 3CJ2A 3LPYA 4LR9A 3MMAB 4DU7A 3SO4A 1X9MA 4IKAA 1LOUA 2UP1A 1TAUA 1JLCB 3G8SA 1JLAA 1S57A 3DLKA 4ETXA 1FRHA 1YDLA 2ZUGA 4FYVB 4DN0A 4DV7F 4OYZA 2C3UA 1PBUA 3K7RA 1WC1A 1UWBA 4N8OA 1Q7LB 4U7UD 1SUQA 5KFKA 3ZTRA 4KGKA 4X84A 2FJVA 4G1QA 1YK9A 4NRUA 3QO9B 3IA0A 2OPSB 5HK4A 3K57A 2B7CB 5HQMA 4UQGA 1AMUA 4JV0A 2HNZB 3ZNJ1 3MFIA 5F0WA 1DHMA 4EK2A 5U47A 1UP1A 4LR7A 6AT1B 2UXCJ 3W61A 3K5PA 1GAOA 3KLEB 1YSJA 2GIRA 2FD2A 2HG4A 3RGIA 3A8IA 1K1QA 1RWXB 2VDHA 4KHMA 3CD7A 2QMXA 4EYIB 1L3KA 4AL5A 4CH7A 4MFBA 1TQLA 2CKWA 4DR7F 3CPWR 3P5BP 4BS2A 5LCIA 5FLXY 3FQKA 3LP0B 2A2CA 2VPYB 3AQPA 4Y2AA 2VL1A 3OVAA 2KG0A 1Z2LA 3CO9A 2DCLA 2XI2A 1TP7A 3CD0A 4NL5A 3GMGA 3ICLA 4ED5A 2ZJPQ 1RAOA 2ZBCA 3W2WA 2HAIA 3UWTA 1TL4A 3CF5Q 1R8BA 2WSFC 2KH9A 5D8HB 4WZMA 1X8DA 3J7YI 4RJVA 1MNEA 3K5NA 4NA3A 4R0EA 2G2ZA 2C22A 2W2NP 3EDQB 3OR1B 3KNGA 4CM2A 1U45A 3GE9A 5A6WA 3R1HA 4C2MA 2J5AA 3MMBA 2RH3A 2VH7A 2W7AA 1RKJA 4DFJA 2ASLA 4OJGA 4PKDB 3K58A 2ZZMA 4X66F 2W9CA 5D3GA 4NXNJ 2HZAA 2GMLA 4Z2XA 2YQ1A 5KFXA 2JHEA 1HPZA 2YX7A 2XHCA 4DR1C 1S1WB 4ED0A 1GXTA 3Q8PB 4GVBA 4X62J 2HNYA 4ZMMA 1RGVA 1TL1A 3E2EA 3AJ2A 2FC8A 4Y2IA 1E6VA 1HW8A 3DFEA 3J7A1 3MEKA 4R25A 4PUIA 2V68A 2BJOA 3GTYX 1ZS6A 1FDDA 2WW4A 2BEFA 4IH7A 5A8RB 4ECTA 1U7LA 5IWAF 3HVTB 1NK6A 4YY3C 2H4YB 1VQ7S 3OTOJ 2QYGA 3KXDA 1NK4A 1H72C 4PUOB 2CJQA 2VQFJ 4CI0B 1LKZA 2DH8A 1QAYA 1P27B 3V6HA 2R4FA 1CULB 2GHWA 2QLFB 4FS1A 4PYDA 1CJVA 1R8PA 5I42A 3FRZA 5H1SV 2DNKA 2KZFA 2P8IA 1P8GA 4JV1A 2WD9A 2WSCC 4OX9C 2LP4A 1P4EC 1NK8A 4I69A 5IQ6A 1NLKL 1X5PA 3BPDA 2C3YA 5MAOA 4DV4J 3UVJA 1IR2A 2V0NA 4DL2A 4ITSA 3RRHA 4LSLB 1SPBP 5LSOA 4U67Q 2W4CA 2MSTA 1Y5LB 2J6UA 4CYUB 4DV2J 3X3UA 1I94C 4IFVB 3U7JA 2AX1A 1MWZA 4RWXA 3HF5A 3M2UB 1N5YA 3UN5A 2K1RB 2C2RA 4KTTA 1HBMA 2XMAA 2MZTA 1FKPA 4IH5A 5ETLA 2LYVA 2EVZA 4RW4A 2E5JA 4LBPA 3MD1A 4C48A 5EHHA 3JTPA 3D0GE 2VBZA 2DGVA 4JI6C 3M1VA 1S0NA 1RE1B 3Q22A 4U7CA 4C8LA 2JEJA 3TYTA 3MZIA 2C1EB 2CQCA 2WRMA 3MR5A 3HHDA 3W65A 4C4WA 3E7XA 5C7PA 2BDPA 1UL3A 2MSSA 2LQJA 4P6QA 1O90A 2E5HA 2HVIA 1KLMA 1D09B 1Q78A 4IDKB 4ES1A 3FMWA 2HZVA 4JI5C 2V2KA 3ZZOA 4F3QA 5J2PB 1WOOA 4KTQA 4DQRA 1VR6A 3BEGB 3Q8RB 5A8KB 2D9OA 2KN4A 2PN2A 4LQ9A 5CHCB 5HROA 5LOQA 2YPZA 2ZKTA 3WX8A 1QE1A 2UU9J 2AJ2A 4NLSA 1NRKA 1VRQC 4ID8A 3MAHA 1JB0C 3HVRA 1VQ5S 1HBUB 2CVIA 1LWFA 3QLHB 4EO8A 2R7OA 3H4BA 1C4AA 3LALA 2X1AA 4ED2A 3CQ3A 5M2RA 3BB5A 1YLXA 2E1RA 2IA6A 3S7RA 4W98A 2EBEA 4FDFA 3Q8SB 1Q5VA 2F63A 2XSFA 2JWNA 2UUBJ 3QGIA 2CQGA 1RJJA 5SUHA 3TA1A 2WTFA 3L95X 2GJFA 4B3RC 1SH3A 3RBXA 2VA2A 1YZ7A 1NU4A 2P6SA 3W2VB 1T8EA 1GT8A 3ELHA 2KZ0A 3DLBA 3JAMY 2AJ1A 3DGPB 2XMTA 3P8BB 4DR7C 5SZTA 3G71S 3D7SB 5LMUF 4NCGB 4WK3A 3L4BC 3MPUB 1U1NA 1FJGC 1XNRF 1RT3A 3CCQS 2A2DA 3EVWA 2QA4S 1S1VB 1TL7B 3KDOA 2XC9A 4LF7J 2J9DA 4NOHA 1N32C 1S9GA 2BRKA 3ZZYA 4MK8A 5T8SA 4PWWA 1OYEA 2W2QP 2JL9A 3VNQA 1MROB 1UJ4A 4ILRA 1T95A 3MAQA 3OUYA 1HNWF 4K2XA 1IWGA 2QJ3A 1RBOB 3HK2A 2F8HA 4ETZA 2WBMA 4ZVRB 4KGXB 4X66C 3N4WA 4M1KA 4O3PA 1WTBA 1X4DA 3A4TA 5JVGQ 1CJUA 4RNFA 3BQ0A 3I56S 3B7WA 4J7CA 2XNRA 5HI7A 1S10A 1FXLA 3PFOA 3NS6A 4NLPA 2CPDA 1IM6A 1AA1B 1HQEB 2JX2A 3SZ2A 1AXQA 4DI6A 3B8HA 2IVFB 1C2PA 1UEUA 3WIVA 2FVSA 3ZZPA 3CGIA 2DRBA 2VFTA 1B7FA 4UUXA 2W4DA 4WFYA 2Y4OA 4QWCA 4GO5X 2M7SA 3JQJA 3KNAA 2VICA 1HQUA 3PYGA 2KTQA 2KKHA 2EEYA 4A8XA 2YWEA 2XLIA 3N5BA 2HWTA 5IWAC 3JTNA 5G0RA 3UCUP 2Z57B 3DRPA 2NQPA 3UX2A 2RDJA 4PUHA 2G9OA 3IAS9 1UFKA 3G4SS 3OXGA 3D6FB 2HQIA 2BE2A 3VNRA 2W8LA 2AEMA 3GZ7A 1QD1A 2O3DA 4K0KJ 3DM2B 2OMOA 2VG5A 4ZLJA 4N8NA 1VGYA 3CDUA 5A0YA 2LFVA 5H9FK 2GIFA 1S6PA 3HKZD 1WHWA 3LGHA 1O9TA 1UFLA 4CH1A 3UNYA 1OQ3A 4CLTA 1VLYA 4CRJA 2ZDPA 1EQ0A 3G6YA 1AZSB 1U1LA 3PYFA 4Z37A 3EICA 2QV6A 2RQCA 1FE4A 2BH1X 2GVZB 1NHKL 2MKHA 3TX8A 5CABA 1VRTA 3B78A 4ERDA 2X3GA 4DV5J 3JQKA 4O4RA 4B9NA 4LF9C 1TL3A 4NCBA 3NS7B 1Y00A 5DS7A 5J2MB 2HHUA 5L46A 4RW7A 1FK9B 4CO0A 3SCJE 2DHAA 1NKCA 3B54A 4K50A 3RBZA 4C8NA 5M2UA 2WBRA 3UX3A 2YNHB 2G2YA 1TFWA 1LCIA 5KFEA 4I9FA 4FBTA 4HI1A 2OPLB 3P3DA 4ECVA 1XN9A 3DHVA 3FQLA 2XG8A 4DV0J 1TK5A 5E3PA 1SXLA 4YEAA 4OJ1A 3PZPA 3SSRA 4O3QA 3TJ8A 2RIJA 4TY9A 3MAAA 4MKVA 2P2MA 1NPRA 5HATA 4DL3A 2FVPA 4DR5J 4LVOP 3H8YA 4RNOA 3LGXA 1MW7A 2P6TA 3CC7S 3UDEA 2XBPA 2J0SD 3T41A 1HNVB 1R6YA 4RPFA 1DTQA 4JI2J 5KFMA 2MXYA 2BXJA 1JLQA 3D0HE 2J6TA 2ZH7A 5D4LA 2E9TA 2VG6A 2Q79A 2LXFA 4E8UA 2PA3A 1VCTA 3WZ0A 3LPEA 1ULTA 3ADAC 2OPPB 1Z4UA 4KIAA 1YIJS 1WF2A 3AB2B 2I5JB 2QFIA 5FLXU 4MYTA 4OI2A 1OPZA 2MZSA 1FDNA 1XNRC 1FJ7A 2F3JA 3SIPB 3OXLA 2DCUB 3H7HB 4TQSA 2GGPA 1PBAA 4ECQA 3Q83A 2AX0A 1FJEB 1ICEB 4WIIA 4NYOA 3PEHA 1U0SA 3T9NA 3AOAA 2Z4PA 1NO8A 2XZTB 1L3SA 4K4TA 4RZRA 1JIHA 2MZRA 4OZNA 4KHPC 1GTHA 4WXWA 2K2PA 5KFTA 4LF5J 4V19X 1HLWA 5AXLA 2MZJA 3MTKA 5DV9A 3QSIA 1ZTWA 3L09A 2XEXA 2HW3A 4NXNF 1HWJA 1PYTA 4UF4A 4JV2A 1PJ6A 1V3ZA 4CLFA 4GVLA 3EJMA 2JRSA 4DSFA 2CQHA 1KP6A 3TQIA 4X62F 3DLJA 2WB1D 4RUAA 2FIUA 4S0MA 1ZPWX 2HFOA 4DOZA 2ROGA 5GMKa 1XHJA 5T14A 2VPXB 1R0BG 5L9XA 2Y27A 1VIXA 4U96A 2PE8A 2NREA 3PR4A 3OTOF 1BQNA 4I64A 2IPOB 3BGRA 1M5KC 2VQFF 1U1OA 2PGCA 2MQPA 2G1DA 3KKFA 4RNNA 3K59A 3QFHA 4YR3A 1IQZA 3IGVA 3M30A 2XO6A 2VFSA 4JV5J 4FVCA 4YR2A 4EMDA 2ERRA 4ENOA 1JLBB 4L72B 4Y2MA 2VG7B 3DOKA 4MIAA 2DB1A 3C14A 3GPAA 1RK8A 2JLGA 4J9OA 4QIWD 1UFWA 2DTJA 1YRTA 3UOWA 1UJ5A 3LW5C 2MQMA 2HS3A 4DG8A 4R1LA 1V3RA 4DV2F 2V2VA 3GWCA 2RU9A 3Q2TC 1PA4A 2FUG9 4Q44A 1DFDA 2NXUA 2V8DA 2I2YA 4LRCA 2ZH9A 2B4UA 1UW4A 4ZVPB 3K5OA 4NLWA 2V7BA 2E7WA 2CQPA 1MLAA 1TZ0A 1WKLA 2ZH1A 1S1UA 3CCES 1HR0F 4OYOA 3QGHA 4ZVGA 3GB0A 5J2NB 4DXLA 1NSPA 3KK3A 2DR8A 4G1PA 4OYIA 3PX4A 1U8SA 2OP5A 2BOAA 3I9V9 4JI7C 2F8EX 2XLJA 1N6QA 1IBMJ 3CCUS 2MGZB 5KFVA 2B0GA 2HBRB 3K5LA 4ZPWR 3G9CA 2O67A 4PG8A 2V2QA 3SDEB 2K06A 4P2SA 2HAFA 2LLZA 3ZZZA 2GV1A 3KLIB 4GC7A 4UOFA 5K20B 4NMXA 2H54B 4PXBA 1MDFA 3KWMA 3MM6B 1MDBA 1JMTA 2XI3A 2YNGB 2WONA 2QN6B 4DR6C 1F60B 1K47A 3LANA 4C0BA 2DH7A 2DKOB 1Y0HA 2UU9F 3VNSA 2QMUB 4F3OA 2DH9A 2NSCA 1PG5B 1VQSA 2B51A 4KSEB 3HJFA 5LSRA 2BJEA 1VQMS 3OW2R 4F7VA 4IG3A 4DG1B 3A4IA 4BCAA 3GV8B 1S6QB 2CG4A 4DLGA 1NK9A 2IJFA 2X3DA 4TQRA 1M6XA 3LH2S 2UXCC 1LW0A 3JS9A 4B3SJ 1ZAWA 4KAIA 1VBKA 2AMCB 5GAHU 3ISND 3EGVA 3X1LB 2YKNB 4F25A 2R8GA 3PYEA 3AD7C 2GO8A 4TY8B 4CCHA 4PQUA 3MOJB 1N0VC 4PG6A 1JJCB 1RT2B 4YMEA 1UCNA 5CZVA 3CC4S 1PGZA 2XMVA 5THWA 1NYEA 2DITA 3GPCA 2R42A 1F3FA 3O5TB 5KOWA 3EVOA 4ID5B 2V69A 4LRBA 4LF7F 1U6ZA 1FT8A 1XR6A 1OYDA 3VF0B 4ANCA 1WI8A 3B4MA 3CB4A 4WE1B 2DEIA 1SKWA 3BV8A 5E33A 5KFCA 4RLQA 3J81U 5B0BA 2IIHA 3R9XA 1WDDA 4NPOA 2B5JB 5HAOA 4EFAC 2IM3A 2XY6A 5KFAA 1SCJB 2IA0A 4OIXA 4TLRA 1T3NA 1WG4A 1NDKA 3BGUA 7FD1A 3J7Z5 1T05A 1H6KX 1HBOA 3DOMB 4I9GA 5KFSA 4TLQA 3BQ1A 4ED1A 1RWWB 3FCVA 4M5DA 3HMJG 2UXBF 4TN2A 4PYAA 1U26A 3R7SB 4ECUA 1XMOJ 2AJFE 4KO0A 2HHQA 3H40A 4X4VA 5DQIA 4HH1A 5E3CA 4CLWA 5IT4A 2CAJA 3QZ7A 4A8FA 2HNDB 4DFMA 2R2SA 5C5JA 2E9ZA 5GAEI 4R0JA 1EP4A 3D68A 1RAGB 4E2FB 2KM8B 2VQEJ 2B9XA 1S1TA 4FZVA 2Z2MA 3M2VA 5JXSA 1JLAB 3DLKB 5F0UA 2RQKA 1U25A 4ALZA 4ECWA 1RACB 3VCDA 2JVOA 4CM0A 1EARA 1UWBB 1VQOS 2X7IA 1SUQB 3QIPA 3DI6A 4USJC 5DGAA 2VQFC 5FJ4A 3FVYA 3UI3A 5KAKA 5DGBA 4G1QB 4YS2A 4B3OA 4H4OA 1H74A 4AUKA 3R8YA 1BD6A 3JYTA 1GMVA 3NKYA 5A1IA 4BWJA 2P2CB 4I56A 2EW9A 1BQMA 2BW7A 4K0KF 1EZZB 4DSLA 4DV4C 3OSPA 3DDIA 4W4MA 3A13A 2ZC3A 1HFEL 2K7KA 2GQQA 1LK5A 3R27A 4RR5A 4OHVA 3NYRA 4PROC 3L7UA 3MPVA 4L75A 1V26A 2DGWA 1YBTA 2DPIA 4DV2C 5ETKA 1K0RA 3C15A 5C42A 3HXMA
chains in the Genus database with same CATH topology
4NZ7A 2R8KA 2ZFHA 4DV1C 3O6QA 2MKIA 4MFBB 3Q0AA 3PHEA 3IWLA 2KU7A 3T1HC 4YUDA 5CD4H 2MGZA 1UVJA 4ZP8A 2HYIB 3C6UB 4RW9A 2R7QA 2R7RA 2HGNA 4UY8T 4X4RA 1NK0A 3FDSA 2V4RA 2V9WA 1VS3A 5CQGA 4QWBA 3M2RA 1F5AA 3SDEA 4DDFA 4NYPA 3HHLB 2MZ1A 1J5OB 4QYZJ 1RT1A 3E3XA 2DYJA 2OLWA 5EX0A 3KLIA 4F02A 1PG3A 5AJ3F 1KKGA 2OIHA 4MYUA 2RB7A 2M52A 4M63A 1UAWA 1MD9A 4ELTA 1QLNA 3OPKA 2W4PA 4Y3CA 3B82A 2MKJA 3CVKA 1JXLA 1R0AB 1D0EA 3PJXA 2U1AA 4OHZA 5HMZA 2KO1A 4QIEA 3MM6A 2N3OA 2M0GB 4LF8C 1MKYA 2PD1A 4RM2A 1BC6A 2YNGA 3BDEA 4OZJA 4B3MF 1FXDA 4O3OA 4IR1A 1G7CB 3DMJA 3RW7A 4Q5VA 4NLYA 3KK1B 3S8SA 3F73A 4F4YA 2JZ5A 3W2WB 4LFCF 3HFKA 3CJKB 3FFIA 3OSNA 4J9RA 3LGMA 3KHRA 5KYTA 3SXLA 1XRAA 3UCZP 5IZHA 1CC7A 3J7YU 1M1KT 1YI2S 3FZ2A 4KV8B 4ECYA 2IRXA 2VD3A 2KT5A 2X51A 4V19J 2DNOA 2C2EA 2D3ZA 3DLGB 5CCMA 4JI1C 4GMKA 3OL7A 4LF5C 2R7XA 3G6ES 2GX8A 3UDCA 2COLA 2CZ4A 2MDAA 2ABYA 4PWUA 5HBMB 3IN5A 1PO6A 2OTLS 3VAKA 1IXKA 4K4UA 1S6OA 2YTCA 5KTQA 4DR1F 5EWEA 3DXSX 3SV3A 5EX3A 1T3OA 3FGVA 1H2VZ 1XMBA 4OLOA 1UVMA 5CZXA 1ZAVA 1JK9B 5HLFB 4RUHA 3MTJA 2E66A 2CRLA 3V2UC 3G6VA 4Y28C 1WH9A 1B0VA 3CJ4A 3F44A 4DG1A 2RKIA 2O01C 1UVIA 1YVFA 4ZS6A 4DV7C 5BYSA 2QVYX 4PRFA 3HKWA 1S6QA 4DV0F 1JKHA 2YKOA 3IMLA 2ZD1B 3MMBB 4QWDA 1QTMA 2ZH3A 4RU9A 1S48A 1JJ2R 2RE1A 2YNIB 1FRIA 3IFEA 2KZZA 3NYQA 1VRUB 4WV3A 3EPIA 1X9WA 2GCFA 4MIBA 3RB0A 4JM1A 4DSEA 2AYEA 2EFOA 3OXFA 3QGGA 3TW0A 3V6DB 1T02A 2JFDA 4CO5A 4DPOA 2BQ3A 2IYGA 1U2FA 3WX4A 4YY3F 4LF4F 4O4GA 2W9CB 2YKNA 4H4MA 3CC2S 5D3GB 5EGYA 3DRYA 2VSQA 1WEYA 2LEAA 2NPIA 2ZH4A 4B9VA 2B9WA 1MSWD 3TUJC 5DQGA 4WFAQ 3BREA 4TY8A 2AGPA 1HYSB 1MMLA 4OZ0A 4X2BA 3SCLE 4DR5F 3QJJA 1HPZB 5IT9D 2E5IA 4ELVA 3H5SA 2AP6A 3NL0A 2L08A 1ZZFA 2H5EA 5GAEU 1RT2A 3VR1A 2Q3PA 2PMHA 1RA6A 1HA1A 2FVCA 3K2YA 3LOUA 4RBTA 1TL5A 4LT6A 4YB5A 1VBZA 2AWZA 2IBOA 1JJ4A 2E9RX 3N6NA 2IAJB 5KFRA 3MM5B 1ZM2A 2D7SA 3OJSA 1XEZA 3CSKA 3MFHA 2BANB 2OJ3A 2HNYB 2LU1A 2RMLA 1TL1B 4MH8A 2QSFA 1U1KA 4JI8C 1J5EC 5K8OA 5K8MA 3T1YC 1IBKC 2E0GA 3IRXB 1MWYA 4JI2F 3GQCA 2AGOA 5B0EA 1ELOA 1WD6A 3D1HA 3H4DA 1FJCA 1RKIA 4AXIA 3MMCA 2D1CA 4A8WA 2B4PA 1PC4A 4ZPBA 4F4ZA 4FUQA 4HDGA 4HKQA 2E1CA 1RTJA 4X4SA 3PO5A 1DJ0A 3VZIA 4ID5A 3ZC4A 3THVA 3I08A 4DV4F 4DG9A 4R0MA 4NWBA 4GKKC 1XK8A 2MQOA 1LQ9A 2NYIA 1MXBA 3S01A 1QAJA 2ACYA 4NDNA 4Q43A 2UUBC 4QPTA 2DIVA 3T19A 1NB7A 1O0PA 2Z2LA 4WE1A 1WTFA 1QVFR 2P5VA 3UW1A 1UKKA 4DUYC 1QSLA 1U24A 3MUVP 4JV5C 2K3KA 4C8OA 1YQHA 2ALZA 2OH2A 2UVUA 1LFPA 1Y9OA 3HHNB 2RRAA 2DNHA 3RYLA 2FVRA 1ZYQA 4DV6F 4N47A 2ZC4A 3PXGa 2DR9A 1R27B 2AU0A 3PESA 1VQPS 5I42B 2B5JA 2J7KA 2YWGA 1ZPVA 2HVHA 3DHWC 2F9JA 1FD2A 4ZPDA 4DV1F 1CPZA 3GV5B 3UR3C 2ZJQQ 1NH8A 3T1HF 2PI5A 4D4IA 2JDJA 4ED8A 1DARA 3PW7A 4HVZA 2QA2A 4BC9A 4QU6A 4PWDB 1CEZA 2PO4A 3MMJA 1X4BA 3DOMA 4F67A 2OD6A 1VQ8S 1YJNS 1RYRA 1JJHA 2B6AB 3DDNA 5BURA 3TQ1A 1X5SA 1VQLS 2HJGA 5AE2A 4KRWA 3IBWA 3UE2A 1QSSA 3FCCA 4EEYA 1YBAA 1FO1A 3KG0A 1KR4A 4YQWA 2MB0B 1NNDA 2FLLA 1W25A 5K14A 5H9FJ 2OPQA 1VIOA 3J81Y 1C1BA 2KYXA 4QW9A 1W2BR 1S9EA 3LO3A 4YDDB 3ETCA 4JI0C 2YKMA 4OZLA 3KK2A 2R8HA 3ITHB 3U02A 5HP1A 2YWHA 1ZB9A 2BRLA 2GA7A 4HT7A 4NLVA 4CNZA 1DTTB 4O44B 5FD1A 2FJXA 5K8FA 4H4KC 3DLHA 4NZ6A 3C3LA 3POTA 2CJAA 4KPYA 2HNDA 3GG0A 3CJ2A 3LPYA 3CD6S 2FGOA 3CCJS 3MMAB 4HL9A 1OPIA 4FS2A 3SO4A 1X9MA 3VAMA 4LF5F 3I0RA 4IKAA 2ASBA 4OHWA 1LOUA 1KONA 1X0FA 2DVIA 1S1XA 5I3QA 4LMZA 2YX4A 2UP1A 2QT7A 4IH6A 1N5YB 4B9TA 1TAUA 2EK1A 3NGDA 3CDBA 1GTEA 4QR2A 1JLCB 2QW0X 3IWXA 3NNCA 3OFHA 1JXEA 3G8SA 1JLAA 1HBMB 3DLKA 4MJKA 2I38A 1FKPB 2F9DA 1Y5IB 2E44A 1YWXA 1KHWA 4ETXA 5A2QY 5F8NA 5FDLA 1FRHA 2ZUGA 3M4XA 4DN0A 4ILMA 4DV7F 1TV6A 4RW4B 1FERA 5KG2A 2C3UA 3KLGA 1CQNA 2F40A 2FJEB 3RG2A 1FRJA 2J8AA 4ZJZA 3DYAA 1TKTA 3K7RA 2ZZNA 4OYCA 2FJWA 4FXVA 2W9AA 1UWBA 3HI9A 4N8OA 4RLEA 3LUYA 1FDBA 1FRXA 1P1LA 3MGJA 3MM8A 3WDOA 5DM6Q 1K0TA 1Q7LB 4RUCA 1SUQA 4DEZA 5GTDA 2G4BA 1IKXA 5KFKA 3M1VB 1TR0A 4KGKA 1H38A 4OI1A 2GMJA 1BA3A 1AFJA 3G7SA 4X84A 3KXWA 4X4PA 4ZCIA 2FJVA 1R7IA 4G1QA 4BHQA 2XLKA 3RB6A 2AYAA 4NRUA 1FKAF 4U9RA 2MYFA 5KFJA 1J2VA 1Q79A 3ETOA 3QO9B 1X0PA 2KVIA 1Q7YT 2YQ3A 4USIA 3IA0A 2W9BA 1TFYA 2P2FA 2OPSB 1IKVB 3K57A 2B7CB 2ZVSA 3LGNA 3EZUA 1A7GE 4TKTA 4WF9Q 2PEHA 2VC1A 3AJ1A 1V3SA 2VKZG 3OR2B 5KFQA 1SIWB 1RTHA 5JVHQ 2QVXX 4UQGA 1TKXA 4ODJA 4FVMA 2BA9A 1MMNA 1NZAA 2HQ3A 2XCAA 2XR1A 1AMUA 2ASYA 2DT9A 3U1NA 3UD3P 2ILYA 4IUFA 4ELUA 5EUHA 1HD1A 4JV0A 4C11A 3ZZUA 1M90T 4JI8F 2HNZB 5KT7A 4FN5A 1J5EF 2MKCA 3MFIA 5F0WA 4LSNA 1IBKF 4R1MA 3UCGA 5LXYA 4RWWA 2ZH2A 1DHMA 2OSQA 3R5CA 3EQ6A 5U47A 2ASDA 1UP1A 2M2BA 2VZ9A 3RRKA 2E1AA 1E6YA 2LVWA 4ZHRA 3IG1A 3T5LA 3K5PA 1GAOA 4LE5A 1PC5A 3KLEB 1FEHA 3DC2A 1YSJA 2CXCA 2GIRA 2FD2A 4TPSB 1IM4A 4PG5A 5HROB 2HG4A 2G13A 1UJ6A 3PY8A 3SCIE 5L9NA 1S77D 1K1QA 2UUBF 4DCSA 1QE1B 3IRWP 3QWUA 4RW6A 3KLHB 2DNMA 4FNHA 4LF6F 3G6XA 4DSJA 1F9FA 1HI1A 3MEDB 3I55S 5BUQA 4DUYF 1KD1T 2WOMB 3M8QA 4JV5F 2DNNA 1D9FA 4KHMA 3CD7A 2QMXA 4EYIB 1L3KA 1N88A 1LWCB 4AL5A 2UUAC 4CH7A 2UUCC 2DGXA 4EWTA 2HS4A 3PBKA 4MFBA 3VAJA 1TQLA 2RDIA 2NPFA 3C6UA 2CKWA 2BV3A 2E8EA 2XB2D 4DR7F 3M32B 2RF2B 3CPWR 2VFVA 1HMVB 1LWFB 2CPYA 2RJZA 5T7LB 4BS2A 2B4VA 4K0KC 1J5OA 4XK8C 5C24B 5FLXY 3FQKA 1XRBA 3RZAA 2AYMA 2A2CA 3LP0B 1GXLA 2VPYB 3AQPA 1UVNA 2D1TA 4Y2AA 2VL1A 2YX1A 4ES2A 3Q8QB 4J37A 3FSIA 4FF1A 1R0AA 3OVAA 2KG0A 2BACA 1KN6A 3LNVA 1Z2LA 1B0TA 3CO9A 2LA4A 2XS7A 3CW9A 3MD3A 2DCLA 2XI2A 3OTDA 3NI2A 3H98A 2VASA 5A6PA 4WFXA 1TP7A 3CD0A 2WP0C 2M8HA 2PC6A 4NL5A 3GMGA 3ICLA 4ED5A 5D4NA 2ZJPQ 4X4NA 3KK1A 3OJUA 2ZBCA 3W2WA 2CQ4A 4JI0F 2HAIA 3CJKA 3UWTA 3I9ZA 1TL4A 5DRKA 3CF5Q 2DR7A 1URRA 2MQLA 3LF0A 1U6FA 4ZPCA 1R8BA 2WSFC 4DSKA 5B08A 4KV8A 2KH9A 4N76A 5D8HB 3DU5A 4WZMA 5CA5A 4RX6A 1KQGB 1X8DA 2YH0A 3DLGA 2IYIA 3J7YI 1MNEA 4F3MA 3K5NA 3NS5A 4X4TA 1FNOA 5HBMA 1S97A 4NA3A 4M8LA 4R0EA 4Y65A 3UDLA 3RRGA 3NMRA 4I6YA 5LJ3Y 2JEFA 4PG7A 1NJXA 3BO2A 2C22A 1FESA 1TAQA 3F56A 5HLFA 2CPZA 3SFGA 2IHR1 3U1LA 4DS5A 3UZ0A 4XAKA 2ROEA 3OR1B 2GJ2A 1SIZA 3KNGA 4MAKA 5KT2A 1U45A 4DQQA 4D4GA 4DV5C 2HHWA 4MMOA 4FF3A 3GE9A 4YHHF 2E7XA 1RT3B 5A6WA 1U47A 2AYBA 2EFVA 3R1HA 4AFFA 2J5AA