3L95X

Crystal structure of the human notch1 negative regulatory region (nrr) bound to the fab fragment of an antagonist antibody
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
230
Chain Sequence
GSACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGDVRGSIVYLEIDNRQCVSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-NRR1 fab fragment light chain
publication title Therapeutic antibody targeting of individual Notch receptors.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 230
sequence length 233
chains with identical sequence Y
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00066 Notch LNR domain
X PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l95X02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3l95X01
2OO4A 3L95X 3ETOA 5CZVA 5CZXA 4ZLPA
chains in the Genus database with same CATH superfamily
1IJEB 2Z56B 2P9EA 3TZZA 1APSA 3ENWA 3M8RA 2JVRA 1RHMB 3BSCA 2LYVA 3D68A 4O44B 3B82A 1Q1KA 1HBNB 1H7WA 2OBVA 4WWSA 5KFTA 1RWWB 2EBEA 3PNIA 3CJEA 3OSPA 4PG7A 4M5DB 4KJIA 2BRKA 4JM1A 2RUSA 5HK4A 1ZYQA 3ILIA 3D0GE 3VWSA 4BDPA 3PYGA 1UA1A 5ETVA 1K0TA 3LP1A 3LW5C 3HPOA 3GFHA 5IC4B 3FCEA 5I3UB 4HDGA 1VHIA 1N34J 2QA4G 4OFZA 5LMUC 4P7TA 1RTDB 2Y3YA 5HMWA 3RW6A 1TK5A 2JNJA 3TVZA 3QGGA 4DPOA 1MROA 4P73A 3MGJA 2LQ5A 2VG6B 3W3SA 5CYJA 2IMOA 1U1LA 1O9TA 2RIJA 2XHCA 2JJ4D 4DR5J 3J7YU 3THVA 2OPLA 1SC1B 1A6LA 2XG8A 3IWXA 4NXMF 4ZN1A 1NB2A 3W65A 1W26A 1EKSA 1P4EC 1XWLA 2IY5B 3PEHA 3V81A 3L3CA 2KVIA 4DCPB 3AH6A 3HZGA 2UXBJ 2GVZB 4LBHA 1UWDA 2PFDA 4QU6A 3SXLA 2C2DA 2O5DA 1FJCA 2BKOA 1UJ4A 3W7BA 2ZWPA 3BGFA 1QWIA 1N5YB 4FNHA 4LSNB 2XB2D 5BURA 3WDOA 4Y65A 3OTOC 2BANA 2HHPA 4YHHF 3OSNA 1XQIA 1WF0A 4KIAA 4C2MA 2DH9A 4CTAB 4ZPDA 4CO5A 3HFVA 4L3KA 1TU0B 1FKAF 3OLBA 2MHNA 2QA2A 2R7RA 3PHTA 4M5NA 2BE2B 3V4MA 2IRXA 1O8BA 1JLQB 1FEHA 2E1AA 2AHOB 3ISND 3QJLA 4ODJA 2XQCA 3IAS9 2JFKA 2HZVA 3PX6A 2HNDA 3X3UA 1PYSB 1WOSA 1JLAA 4RW9B 1RA6A 2V4QA 4KTTA 2DITA 4NI2A 1UPPA 2L9NA 2Z8QA 2X3GA 4NZ6A 2B9EA 1S1XB 2FJWA 4QYZK 2V63A 4J9VA 2EGTA 2V2QA 3I0RA 4F0HA 4LF4F 5LOQA 4OV1A 3CT9A 4RW4A 4ZJLA 1UZHA 5K8PA 3E8OA 1RWPB 1R0AA 1NYEA 2ZZMA 2QV6A 3HZEA 4DSEA 1UJ5A 3DM2A 2LP4A 4OZJA 1HNIB 1BQMB 2B4PA 3TJ8A 4ZVPB 1TKZA 3HP6A 3VZHA 2GMLA 2V8PA 2F63A 5K14B 1L3TA 3KNGA 4ZK7M 4CRJA 4B3MJ 4WCEQ 4DCUA 2ZH6A 5B7WA 4PQAA 3DC2A 4OI4A 4EBCA 1NLKL 2G1HA 4HDHA 3KHLA 3DHXA 1XNRF 1JOSA 2M3DA 3EM1A 3VGTA 3QNWB 2C2OB 3M6UA 3B78A 2W9BA 1NJIT 3CIMA 4NCGB 4ZHRB 3TUIC 4EK2A 1O92A 2XGQA 3JYTA 1LXJA 5ETQA 1M90T 4P6QA 3ELHA 4FVCA 4JI5F 3BN4A 5KFLA 3MR2A 3QGIA 1U0SA 2C2MB 4A4JA 1IQZA 3RR7A 4NYOA 1GXTA 4YY3C 3WC2A 2ACYA 2J0SD 2VPWB 1WF1A 3NAHA 4USVA 4ECUA 2Z58B 3MECA 5EN1A 4OX9F 1CSJA 3CULA 2KJVA 4WKYA 3UCUP 1DTTA 2VKZG 1FO1A 1F3VA 4EBEA 5E5NA 1KR4A 5JVGQ 3DGPB 5KAKA 2AWZA 5GAHI 4DSLA 1QSSA 1LV5A 4OXIA 3IS9B 3UN2A 1I1GA 4DV5F 2DGVA 2AX0A 2F3JA 3CCWA 3BPSP 4YP3A 3VAHA 5F8MA 3MCOA 5HATA 1RE1B 4P52A 3DKDA 4RW6A 2E8CA 2ZITA 3HHDA 1VDHA 3UVJA 2HAIA 2PC6A 3T1YJ 3C3LA 1MDBA 4QW8A 2ZHOA 2VONA 3T5LA 5KFNA 1VQ9S 2ZOGA 3LALA 4W4MA 3Q8SB 4QYZJ 5K8OA 2ZM6C 3L95X 2P2QA 3GV5B 2AYGA 2R3VA 5HMXA 1BWVA 1XR7A 3BBCA 1FCAA 3W63A 1R8AA 3E2EA 2GA7A 5F9NA 3G82B 4PWDA 4JOUA 3B4MA 1WC3A 1MWZA 2JVOA 2DGXA 3D1HA 1U1KA 3GFZA 3N5BA 4LF7J 5DG8A 2LQ8A 4C8MA 1Q78A 4OZ3A 2HS3A 4R1LA 1NDKA 4C97A 5HROA 1TP7A 4L6V3 4F3QA 5ETTA 4B3RJ 1D8ZA 2I8EA 2W7AA 4DFMA 2QJ3A 2UUBJ 2J5AA 3MMBA 3AD9C 2GGPB 2G1DA 3V2UC 2YWBA 4HH1A 1M5VC 2C2ZB 1N48A 1B4SA 2HBYB 3RYLA 2CZ9A 1R7IA 2QLBB 4GMKA 5AE3A 3GJQB 3MM8B 5GVQA 2MEWA 4DFJA 3CQ2A 3GV8B 1RT7A 4K0KC 5E3PA 4F3OA 3OT9A 3VQTA 2CYYA 5BYSA 4OX7A 2B43A 5T8TA 4R0MA 4PUGA 4C11A 5KG2A 3JSMA 4AQYC 5FLXU 2DB1A 3IG1A 3M8QB 2RILA 2R8KA 2CQHA 4DR3J 3K17A 1AW0A 4DL7A 5HN0A 3KK2A 3FCCA 2DNMA 2J9DA 4OJ3A 1WC0A 5IFMA 5B0GA 5GAGI 1N33F 2ASYA 1FT8A 4V1Ak 2KZMA 1NAQA 1KKHA 2CQIA 1FF2A 4O4RA 3BYPA 4MKVA 3DRPA 2Y1IA 4FZVA 1J27A 1LKZA 1OYEA 2JLEA 3R5GA 4ID5A 5DDPC 2RDIA 4P7VA 3ZZ0A 3IEUA 1Y3JA 3LTOA 3UN5A 2V68A 4ED6A 3OXGA 1SL2A 3CXCR 3ZTSA 4DBQA 2EC2A 2D1RA 1JXEA 2PA8D 2UXDC 3SBMA 1IKXB 2UVVA 3ZZPA 1S49A 4OLOA 4U8VA 3FZBA 5K85A 4NLTA 2LECA 3A26A 4CT9A 2CFXA 4YMEA 3FBBA 2ZBCA 5KFAA 1LW2A 1MDFA 2BX6A 3RJMB 3KOAA 2H51B 3OXFA 5HVGA 2KM8B 1YZ7A 2UUCC 4JI1J 4TYAA 5F0WA 3H2TA 1HI8A 1UFWA 3D3CJ 3H2UB 3R9WA 2F9DA 4DU8A 4LF9C 1TKTB 2H5JB 2KKHA 1Q86T 2YTCA 3EGWB 2GHPA 2OPQA 5D3GB 1VEHA 2GNKA 4DR4F 4ZPTR 3T5HA 2Z30B 1K73T 4HTIA 3H20A 3M8WA 2M2BA 3IXQA 4F50A 3LNOA 2DEIA 5CZVA 3JAMU 2Q79A 1FESA 1N54B 2NS1B 2X1BA 4KKOA 5CYQB 4DV2C 4OJ1A 1S0MA 3NGDA 2VL1A 2C3PA 1OPIA 4LRAA 5DGAA 2P9CA 5CYMA 4KRWA 1HQUA 4FDFA 1EHWA 5FLXY 5KFHA 5CXTA 3HHEA 5J1EB 4YB1P 2R2SA 4OI1A 4YOEA 4IO1A 3LGMA 4DL2A 4M8LA 2VICA 1RADB 1KRPA 3LO3A 3QGPA 2UZAA 5H9EJ 1VOMA 4R1MA 2QVYX 3RG6A 1YBUA 1DBDA 2ALZA 1WNEA 5K8NA 4WFYA 4NXMJ 2DHMA 5BSWA 3UZ0A 4PRFA 4QCLA 2L48A 4U5YD 4EMDA 2C28A 2VQFF 1YTYA 4K4UA 1NK4A 1VIOA 4AL6A 2FTRA 3M8PB 1RHUB 2VQEF 1S7HA 2WOMB 3ETMA 1QE1B 2BVZA 2XC9A 2MQNA 3DMJB 4IQXA 4X4VA 3M30A 2B9YA 1Y5IB 2DYAA 4JI6C 3FFIA 3MF5A 2RKIB 2XLKA 1SUQA 5D0EA 3PW2A 1FKPB 1FUGA 4K4TA 1P8GA 4MT1A 3R7NB 4UOGA 5IM0B 3OTCA 4OHVA 4ZMMA 4YHHJ 3R27A 4JI2C 4ANCA 1HBUA 1P1TA 4UOFA 2M88A 2WVCA 2CVEA 4ELVA 2D3O1 1IBMC 1PG4A 1XIQA 4NASA 2VBZA 2YKMA 1FK9A 1HPZB 4OZ2A 4BBYA 5FLXD 1X4EA 2O01C 4F4AA 1VJWA 3EYZA 2K1RA 1JLGB 1RT5B 1NHKL 3KJQB 2A6OA 2ZBIA 1ZPVA 3GE9A 4UOHA 3JAMY 2MZQA 5AXMA 1N6QB 2CWXA 3U1LA 4ILMA 3CIZA 1YHQS 5GADU 1ZH5A 4WXWA 5KT3A 2WVEA 1BC6A 4B9LA 1SQFA 2ROGA 5KFRA 3VNQA 2FVRA 1XRBA 3W61A 1CS4A 3QBCA 4F3MA 3MR6A 2LQJA 1F0XA 3O44A 5HLFA 5LT5A 1WKKA 2KYXA 1FFSB 1O90A 3UQSA 3FCHA 5T8SA 1KOOA 4G1QA 2QSWA 4O3SA 1V25A 4LFCC 3Q83A 4WK1A 3QT8A 3G71S 4LF4J 4NLDA 3CJSA 1PG5B 4TKTA 4Q43A 2JOQA 1G3OA 1RWOB 4G1IA 2E0GA 4H4MB 1T03A 3U02A 1HYSA 3THTA 4U7CA 2P2MA 4CT8A 2W2MP 2G4BA 1WTBA 1VQMS 4DXLA 2YNFA 2F8HA 1I3OB 4PYDA 1S9EB 4DCVA 2MLZA 3EGNA 4DUZF 4LF5F 4ZVQB 3TQIA 1MN9A 3Q8QB 2AF6A 3AOCA 3H42A 2GVDA 4ZJZA 3A3OB 2XI3A 2VODA 5F9LA 5C42A 1XNRJ 4E98A 1SC6A 4JV0A 3CCMS 4X4NA 4B3OB 3S01A 1YJWS 3D3BJ 1EGAA 5DJBA 1R0CB 1TELA 2OGUA 1HNWJ 2GIQA 4JI5J 4B3SC 2AZ3A 3RBXA 3L4BC 1JJ4A 3JAMD 4IFVA 4ECVA 2MDAA 3AJ1A 2PT7G 3MM5A 3F73A 2MQMA 4LF8C 2HHXA 5DQIA 3Q2SC 2C3MA 5BYQA 4OX9J 4P2MA 2YWKA 1USPB 4DR1C 4CH7A 3J81U 4AT1B 2FVSA 3T9ZA 1LWCB 3VV2B 3AB4B 4M5MA 3KJFB 2MKSA 3PYDA 3MEDA 3UWTA 3M6WA 1F3FA 2MTLA 4ZCMA 4C7QA 1YJTA 3HHLA 1N32F 3LUSA 1S9FA 2QEXS 2Z4PA 4DV5J 1U2CA 5D4OA 2HHHC 5LJ3Y 1Q8BA 3T5JA 4DUYC 4L4QA 5G4DA 4XDCA 1KP6A 4QBUA 1KD1T 3N9UC 1XMQF 3E51A 1VQNS 1X60A 1JLEA 2H1YA 2DNZA 2MB0B 5KFXA 4DX8H 4DR2C 3P8BB 3KUGA 4DV7F 5AXLA 3SCJE 3JQMA 4KHPC 1RACB 5IT0A 2B4VA 3GIMA 2XZWA 1T8EA 1HW9A 1YVFA 3CO0P 2HG4A 3UD4P 4GKKF 1HR0F 1AZSB 1UMJA 4ZP8A 2KFZA 2CPJA 1JMTA 4I6YA 1HNXF 2DHXA 4B3TF 2ZJQQ 2ZJPQ 2DH8A 5A6WA 3FRZA 4UTGA 3W9JA 4EUVA 3SIPB 2WRMA 2GC8A 3MUMP 4I68A 4R5PB 2AJ4A 1FVQA 5JVHQ 2BJ3A 3VALA 2E5LC 3I4PA 1T11A 2RHQB 4GS5A 1QTMA 2CXCA 1RHQB 3R5CA 2HAFA 2VG7B 2BOPA 5BUQA 4LVOP 3UE2A 4ILRA 2G2ZA 4OZ0A 4MYUA 5KG5A 3J7Z5 3V4IB 1EETB 1NSPA 1CC7A 4DSIA 2FLOA 4U6PA 2PFFB 2UUTA 4UQGA 1HLWA 4K2JA 1B0PA 2FY1A 1YJUA 1FVSA 4N56A 4NA1A 4QPTA 3FDSA 4OYAA 1JXLA 1SIWB 4TXSA 3J81Y 3OUYB 3QRQA 1R8BA 3ZC4A 4NLUA 3R9LA 4J5OA 4PUOB 2CIMA 3GYGA 4ENOA 4IOBA 2V0NA 2HK2A 3PYFA 3MM9B 3GPAA 3RBDA 4QIFA 1AT1B 2HK3A 3WC0A 2LA6A 5KT5A 1Q8IA 4HT7A 5FIIA 4XPCA 4O44A 4GVBB 3GJRB 3ZNJ1 1H3DA 1GTEA 2UVRA 2ASBA 1IBKF 5HJXA 1L5UA 4NLXA 3ZZOA 1N33J 4LF6C 1Q16B 3NOGA 2GHVC 3K5PA 4K8RA 2IJNA 3GYXB 3R5AA 4ZVSB 3D66A 1XEZA 5A0YA 4HKQA 2M4MA 3DLJA 2X1FA 4GXQA 4LVNP 4NPOA 5I3UA 4ETXA 1S1UA 4TYBA 3IRXB 2E7XA 2IBKA 3BN7A 3VAKA 4U7UK 4PQUB 3CJ0A 4DL3A 3I9V9 3G9CA 3CDBA 1G4CA 2BJEA 3W62A 3ETCA 1FWLA 2VG6A 1RI7A 4NWBA 1VQPS 4Z7CA 3J81D 3D6TB 4QJVA 2AW0A 3W60A 1CLFA 5KG1A 4W92B 2W01A 2GJFA 4P74A 3A8IA 2QMUB 4FF3A 2ATLA 3CJ5A 2BDPA 2PGCA 1KTQA 2N4CA 1KQKA 3E7XA 1SH2A 1FXRA 3IPLA 2E8FA 4O3QA 1V3SA 3MFIA 4DR4J 3M8ZA 2ZH2A 5KFWA 3CJQA 5FJ4A 3TJ9A 2OPPB 4DV6F 2FLPA 3M6VA 1SI9A 1RAEB 2R7UA 2GAHC 3ZNUA 5JJBA 4OMFG 1N5YA 2HFZA 4XO0A 1RT3A 1Q82T 4DPXA 2YWFA 1ULTA 3TAQA 4FXWA 1I94F 2AV5A 4WJBA 4CTAA 1PKUA 2DNQA 3TNVA 1MSWD 1C0UB 1M6XC 3TUJC 3G8QA 1CQMA 5T7LB 1RLCL 2BE2A 1CG2A 4WU2A 4DV4C 3ZFVA 1SXLA 3JTOA 4N76A 3MAAB 5L46A 2XMTA 2V4JA 1JLCB 5DLGA 3IGVA 3UX2A 4ECQA 2NCLA 3DDNA 3A8EA 2HURA 2VQFJ 3T6BA 4GC7A 2JEFA 4RW9A 4PCQA 2M9KA 1QSLA 2DISA 4MK9A 2YQ0A 2KXNB 4KT0C 1GPMA 2VQEJ 4XX2A 4IR9A 3PHEA 3K5OA 2D1QA 1S1XA 3ZTPA 2UXBC 2OO4A 1CJTB 1N5QA 1RYSA 2KT5A 2CQGA 3AXMA 1UVIA 2NZ4A 3OD2A 1B0VA 5GAHU 3SSSA 3RBEA 1T9VA 2GO8A 3EJMA 4DL4A 3DXBA 1HNIA 1BQMA 2XYGB 2W25A 3NS7B 4IDKB 2VDIA 1EARA 3SSRA 4HVZA 2A1BA 4O0IA 5K14A 3BGRB 2KI2A 4FXVA 3R44A 1WH9A 4OL8A 4CLUA 5BSVA 3UN3A 1RHKB 4NCBA 5J2PB 5LMNF 5THWA 1H2TZ 4O0NA 2BE7D 3S82A 4E0DA 4NCGA 4OQJA 1WORA 3ZXWA 2DR7A 2VBYA 3HSGA 4RNOA 1CJUB 1S4FA 1Q0NA 1YKWA 1WC4A 2EW9A 4V19J 5DG7A 1ZA2B 1WI8A 1LOUA 4K7QA 2K06A 4PEOA 2CQCA 1UVJA 5I3QA 3Q2TC 2KU7A 4YS2A 4AXJA 2PEHA 3V6JA 1AB8A 3VGSA 4JI7F 2YWWA 3DGPA 1X31C 1RTJB 2FHOB 4P2SA 3IS9A 1A0OB 1AUDA 3M2RB 2CRLA 4ZS6A 2YWHA 4OHWA 1SVDA 1K44A 1FWPA 4PG4A 3OHAA 4DUZJ 4LF5J 2GIFA 1RAIB 3FVYA 1KWMA 4WTYA 2RS2A 4NRUA 3M8YA 3OXLA 4K2XA 3PEJA 2MKJA 3M6XA 4KHMA 1CJKB 1HD0A 1HARA 1TV6B 5KFGA 2MGZB 4LIRA 1VRTB 3OVAA 3M1VB 2FDNA 4TQRA 1RY2A 1RTIB 3BBBA 2KYZA 2OFGX 2N3LA 3GJTB 4D57A 5A1GA 1Q5YA 1JJ2R 5DQGA 2FJBB 4IG0B 3P4UB 1WJ9A 3G82A 5AJ3F 2ZDPA 1G6BA 2OEMA 2XZDB 2OMLA 3C14B 2DNLA 3FCVA 2NUHA 2CNLB 3CW2C 4C3LA 1TMMA 2ATWA 4PXBA 1WD6A 4LFBJ 3MEGB 2L9DA 1OQ3A 3ZTQA 3N5FA 5GAGU 1RA7A 4ED2A 1BMQB 4A8YA 2CQ3A 3QSIA 2NSCA 3MD3A 1N32J 3QO9B 5RUBA 3CQ3A 4Q44A 4EATA 2MQQA 2KXFA 3Q24A 4IQMA 1FDDA 4CM0A 4X65F 1FRMA 1XMQJ 2RQ4A 1VBZA 2H5IB 2HBQB 1IKWB 2ASDA 1PYOB 2IYGA 1PC4A 3MM8A 4F26A 4DV7J 4IO9Q 1KNZA 3H8YA 1U1MA 4QWAA 2YX4A 1OMSA 1YDLA 1AMUA 1IKVB 3ZZRA 5EWFA 2VG5A 1K47A 4JI3F 3K59A 5LL6d 2YX7A 3FBEA 1WG4A 1HR0J 3ZTRA 1FJGC 4NL5A 2A0FB 3W2VA 1QUVA 5KFOA 3D1QA 2QVXX 4GC6A 1HNXJ 5B0FA 4B3TJ 3I08A 1S6PB 2WVBA 3M8QA 2FZGB 2UUAC 1LWXA 2C3OA 4ECWA 4X66C 2AEFA 1HD1A 2MCQA 5L9NA 3D0IE 1VRQC 1EB0A 5HQLA 4RW7A 3DRXA 4LQ3A 3HVRA 4PYAA 2FJVA 1FFGB 4NZ0A 3OL8A 1IKYB 1R6YA 4DV1J 2MY8A 2UUBC 1B64A 1C0TB 1RDRA 3MMJA 4CQ1A 2BOAA 1RAAB 5LMUF 1FEEA 2RDDA 1IKXA 3G2XA 2VJVA 5F8NA 4K4XA 2JLFA 4G6VB 5D0RA 3QRRA 4MFBB 4YB7A 1HI0P 2AYAA 3PRBA 5BR8C 1ZPWX 2FIUA 1TTHB 4KGZB 2C1EB 2AJ1A 1S77D 3UDLA 1TKTA 3D1OA 4DF4A 1X7VA 2D74B 5D3GA 5IS2A 3TZXA 2EFOA 1TAQA 2RQMA 1IBKJ 3PW5A 4XK8C 3NBPB 3MCNA 4IFYB 2CJQA 1VLOA 2O66A 4HI2A 4DR3C 1VS3A 3H40A 4DL0C 2QLJB 4DR7C 4RMNA 2V2KA 3WZ0A 2XBPA 5CYQA 3EICA 2E5HA 1L3VA 2NUUG 2HFSA 3BF4A 3DRRB 4G1PA 3CUNA 3HLUA 2XS5A 2E1CA 1O0PA 3MXHP 1WHYA 4FPIA 2IJRA 3UCZP 2PIIA 2XYHB 2YWGA 1VMBA 1MXAA 2ALYB 3NAIA 1HNZF 4KTQA 3NNHA 2LCWA 3MURP 1NJXA 3MCMA 3MD1A 3K5MA 3OFFA 2AT1B 2IIHA 1GAOA 3H90A 2NQPA 1PBAA 2HHQA 1ZA1B 3Q23A 4F4XA 3KDOA 2ZOFA 2MSTA 4OYOA 3L7OA 4YEAA 1LQ9A 4X62C 2ZZNA 2QT7A 4WXOA 1AA1B 2PD1A 3CNQP 4JI1C 4KY3A 5KTQA 5MAOA 2MQLA 4KO0B 2J0WA 5A8KA 1Q5VA 2K3KA 4DX5A 3ZTOA 2BJ8A 2WOMA 4N47A 5IQ6A 5HSPA 3D6MB 1SCJB 2ACMA 1KTVA 1QE1A 3POTB 1YLXA 2FD2A 2HHWA 4LUBA 1K0VA 3G6XA 4DV6J 2G2YA 3DMJA 3CCQS 3BV8A 2BYCA 5J2MB 2CJBA 2C2RA 2RKIA 2M5YA 3NLCA 2QX0A 2J7UA 4DHVA 2HKEA 2ASLA 1FKPA 4X4RA 4Q7AA 3S6EA 1XNQF 1QY7A 1Y11A 3OPKA 1I94J 3TO8A 1GMWA 4DCJB 3TA0A 3WX4A 4NOZA 5EGYA 4ED3A 1JXVA 2XNRA 1WSRA 1WI6A 2P2BA 5JXSA 2CPIA 1LWFA 3R7BB 1HPZA 1DHMA 2W9CB 1RUSA 2UV8G 2PSZA 1JLGA 3RV2A 5CABA 1RT5A 3TUPA 3FKBA 4NLYA 2WVDA 3QJJA 4ELTA 3KLFB 2EFVA 3TRGA 3N4WA 1TL5A 3U1MA 3HXMA 4LF2A 3KK1B 2AP6A 3W9IA 4QWCA 2ZH4A 1D8YA 3CCUS 1GTHA 2BMBA 3CJ2A 1SKUB 4YDDB 1D9AA 7FDRA 1LEOA 1NZ8A 1H74A 1PU1A 3UR0A 4C9DA 1U47A 4U9RA 4ZPBA 5A2QU 5GMEA 4PZVA 1HIYA 1SL0A 3EDQB 2ZZTA 3TZWA 4HL9A 1JKHB 1NMEB 1VQ6S 4NEZA 3SFUA 1RABB 2DPIA 5D77A 4H4MA 5LJ5Y 1H0HB 2IDEA 2AX1A 4RR5A 1WC1A 2FQQB 2F1FA 1S1VB 2VFSA 3C6TA 1VQOS 2JC0A 4WV3A 4XIUA 5KFMA 4NYPA 1UETA 2YNGB 5KYVA 1PJ5A 4JV1A 3W2WB 1RCXB 1VQKS 2VOPA 2Q43A 2BH1X 3F44A 4TPSB 5LMNJ 5BSUA 4FYXB 3AA8A 2PN2A 3BYRA 2A2DA 2XWYA 2D7SA 4NLRA 4B3OA 3VAIA 2CUYA 1XTZA 1NZAA 5IOLA 1YIJS 1EQMA 1U6FA 4ITSA 1FWKA 4DEZA 4J9MA 4DQPA 2W2NP 1S5ZA 3KLHA 1VQLS 4OYPA 4HYKA 5KT7A 4U95A 4WS9A 4R8UB 4CLKA 5LSRA 4DPUA 2HWIA 1BE4A 2N82B 2E1PA 1USPA 3N6LA 5B08A 3IEVA 1LWCA 3CJRA 2CJAA 1RYRA 3J7AN 1N36J 3QWPA 4UZBA 1WHXA 5DM6Q 4JI7J 3NMAA 2WW8A 4UT4A 3BEGB 3CPWR 2ZEJA 2JHEA 1KVJA 3C16B 4LF4C 2KB2A 5E3AA 1X5SA 1PJ6A 2QFJA 4K59A 3R5JB 1PC5A 5KFZA 3DDIA 1HI1A 2E1MC 3QSYB 4WFNQ 2PO4A 1F9FA 1C1CB 1VGYA 4DV3F 2XCPA 5E7QA 4URQU 3BQ0A 2N3OA 4K0BA 4K0KF 1MG7A 1N88A 2YY3A 1RT6B 2OSRA 5A2QY 2V9KA 1UJ6A 1J5EC 1M5PC 4CI0B 2MZ1A 2RRAA 1XNRC 5HP1B 2MLXA 1V6HA 2I5JB 2C2NA 3JSRA 5GMKa 1NK9A 1AZSA 1XERA 3HHKA 1UWBB 3JS9A 3SV3A 3H2LA 1YRTA 1S79A 3MR7A 3N01A 3VCDA 3VHQA 5HMYA 3DCAA 1IBLF 2ZVIA 2Y1RI 3GR1A 3C15B 3CC4S 2J6UA 2JEIA 2BBEA 1WEZA 3KLIA 2DKOB 3CVKA 5AJ3J 3VAJA 1YGYA 3US5A 4ZA1A 3TARA 1VRUB 5I42B 2HBRB 4IR7A 1MMDA 1XR5A 3J7ZT 4F4WA 1W2BR 4R5PA 3E7WA 3DLKB 1NHUA 1P9YA 3IRWP 2QO3A 5KFYA 2OD4A 3LWLA 5B0DA 2NPIA 1IVZA 1OY6A 4LR7A 4DZDA 5CCMA 1VQ8S 2VG7A 2WB4A 1PO6A 4QR2A 2OPRA 2V67A 4X65J 1EETA 3V4IA 3KLGA 2IVMA 3J81j 1X5PA 4DV5C 5J1PA 2UXDF 3KJVB 4MH4A 1M1KT 2GV1A 1RWUA 3R7SB 3F0NA 3K58A 2D69A 5A1IA 3OTBA 2BZ2A 1ACMB 3L7UA 1EX8A 2L08A 3OUYA 2FC8A 3R2CJ 1H98A 4X4OA 4RKUC 2UUCF 4JI3J 4PUOA 4URSA 1S1TB 3CJKB 4D3HA 1PIEA 1Q8LA 3RAXA 5EX3A 3CC7S 3M05A 5GTDA 2RSQA 4I0WA 2VFTA 3AHPA 4FF1A 5A2QD 3MM9A 3I32A 1S12A 1E6VA 4KGMA 1NCLA 5ETOA 2XZTB 1S76D 2D1CA 4CLWA 3HVTB 2FZCB 4GVBA 4MKYA 4B9VA 3CCRS 3JTNA 5KT6A 5K20B 1JJCB 1WWHA 1FX4A 3BJYA 3QFWA 2VBWA 5E2QA 5LXRA 3OFEA 2GX8A 3AF6A 2B8QA 3OHBA 3O6QA 1NB7A 1YG0A 2YWEA 4J9OA 3PFEA 1FE4A 3AOBA 4UUXA 3IRXA 4JI0C 5EDWA 2B3TB 2VOOA 5IWAC 2BM1A 2KG0A 4PQUA 1QM9A 1BXNA 1BY9A 1F6TA 1WDTA 5LMUJ 2P2CB 2YNIB 3CEDA 4F0KA 1WELA 2LU2A 2E7GA 1VQSA 2UV8A 5E7OB 4RNHA 3S7RA 2HZAA 2RD5C 1OWXA 2MLYA 2WSCC 3ENVA 3E01A 4DLGA 4ZP9A 1BHNA 2B9XA 2VPYB 4IOAQ 2GJIA 3FK4A 2BE9B 2CG4A 5HVHA 1NK5A 3JB9k 2CNNB 1H38A 5IV3A 1U0HB 4J9SA 2MHEA 2JZ5A 4EZ9A 2C3UA 5FD1A 2POKA 1P27B 2L41A 2HIYA 3IO1A 3V6DB 2VFRA 4RBVA 2E66A 2MKHA 3VNRA 3UDVA 4F4ZA 4JI6F 3NGTA 5KFFA 4JI4F 4NXNC 3MM6B 1WEXA 4TY8A 2IJFA 2R7SA 4IH7A 1N33C 2Z2MA 3AXKA 2R7QA 2W24A 1XMBA 4JI2F 3DOKB 1XN9A 1QJHA 1LFWA 3LP1B 1HNZJ 3O5TB 4RW8B 4XAKA 1IBMF 1NK7A 4ZVTB 5IXUA 4RX6A 1KQGB 2GIRA 3DOLA 5T7LA 4ANEA 5A76A 2PEBA 1RISA 5L1KA 1WHVA 2BACA 5BUSA 3MAAA 1MROB 2XEXA 3GU0A 4U8YA 4FUTA 3H7HB 4YB5A 1LK5A 3C6UB 4BC9A 4Q2LA 3GIJA 2P2JA 3UFCX 1KVKA 3BREA 1MWQA 1S6UA 1NDCA 3HCXA 2DR6A 4J9LA 4IRKA 5SZTA 3KK3B 3RGIA 5D6GA 1YJ7A 1XRAA 1U1OA 2CZVC 1IWGA 4A8XA 3QIPA 2F5GA 5KOXA 4DR4C 2ZFHA 3LGNA 1CJTA 3BKTA 3PKMA 3TW0A 5E3QA 4DZ6A 4QIVA 4RPFA 3K7RA 3MEKA 1XNQJ 2UUWA 2DRDA 3CDEA 4ZIWA 2Q1LA 2H65B 3EXCX 2DR9A 3NGKA 4ECRA 1RAGB 1MU2B 1VQ5S 4I67A 2RH3A 2O1PA 3AY0A 4DN0A 3TAPA 3BGRA 2PI5A 2FC9A 5HMZA 3D9BA 2MMYA 4YN3B 2RJZA 3A8KA 3A12A 2XSFA 4P2FA 2XY6A 3GCXP 2EKYA 2BXJA 2IC3B 3FJ2A 2ZH9A 2QE5A 3FEXB 1BQNB 1CJUA 2EKNA 1YQHA 3WX8A 3W8GA 3PTWA 4LR8A 4CO3A 1TL3B 2L9WA 1KN6A 4LF8F 2AQ4A 4KH0B 1JLAB 2YWCA 1FXDA 3K8WA 4LIWA 1F9HA 5E0OA 1T9XA 4DR1F 3KHGA 1T3NA 3MOJB 5D78A 2HQ3A 2OP5A 4M5KA 4LRBA 5C25B 1P7LA 2CPYA 4C0OC 1U7LA 4QQBA 1LK7A 2PMWA 3N0VA 2B6AA 4UW2A 1RTJA 1J5OB 1R89A 2XMWA 4LT6A 1I51B 4RWWA 2VA2A 1RT1A 4J9QA 2W4DA 3M2RA 4CNYA 2HHHF 5KFUA 1Z1ZA 1FNMA 3AT1B 3ICLA 3BH6B 5LSLA 1RKJA 4TN2A 4RLEA 2F9JA 2ROPA 2BJOA 5F8LA 3DM2B 3HT0A 4C48A 5B0CA 1LXNA 4OYBA 4DR2F 4CDIA 3G87A 3PR5B 2R42A 4KHPF 3W5ZA 2VZEA 2HZCA 3UPFA 3EQ6A 5J2QA 2DD8S 1S0NA 1TV6A 2CU6A 3O8WA 4USJC 3P49B 3A9UA 3M1VA 1T5HX 4Y0FA 4YB6A 4JYAC 1X5OA 3DHWC 3PACA 2D28C 2W9BB 1KLNA 4FP9A 4TLQA 4WP8A 5LXYA 4IG0A 1GX6A 2J9CA 1HW8A 4OYIA 3TVKA 1QVGR 4X4QA 3CGIA 3C14A 3LUYA 1QAYA 4ZN3A 3KHHA 1IUJA 2NYIA 4HLBA 3MMCB 3MEGA 3MECB 1VLAA 2E5LF 4WZQA 3CB4A 3DLEA 2HBZB 3DOMB 3G6YA 2LFVA 3A3NB 1KS2A 2DR8A 2GCFA 1JNZB 1P6TA 1SQEA 4WFZA 3QO9A 2KRRA 4KFBB 4LREA 3ISZA 4QIWD 4K4SA 3QYYA 2NYHA 2E1RA 2HLUA 2NXUA 4USTA 1SJQA 4B02A 4HH0A 1IKWA 4DV3J 4L75A 3N2QA 1SH0A 1IBCB 4K0KJ 3FQKA 4TU7A 4DUZC 1NH7A 1FDBA 2BA9A 4JI8C 3A8JA 2HNZB 4O23A 2AZ1A 2FGOA 2A18A 5AXNA 3NNAA 4QR0A 2ILYA 2IVFB 1IBLJ 3MCSA 2Z2YB 4TU8A 1S6PA 1B7FA 1R31A 2ERRA 1P1LA 1TUWA 1HWKA 4WZMA 1K1SA 2XTJP 2GFFA 3FC9A 3P5BP 1MW7A 2RQCA 1XHJA 4LF6F 2HWTA 4CLYA 4LF1A 2OHDA 2Y4OA 5HROB 1KLMB 2OJ3A 1HNWF 3QLHB 4C8NA 2AJ2A 3M7VA 1IKYA 3FSXA 4EYHB 2J9DE 2EPIA 1B0TA 3MMBB 1C0TA 1AUSL 3I6PA 3H4BA 1T05A 3Q0AA 1FA0A 3TAMB 1N32C 4M1KA 2UXDJ 2XCAA 2VH7A 4OI6A 3EMTA 2JWNA 3T1AA 1CJVB 3EZUA 4NLPA 3LP2B 4IR1A 5KFKA 4F2RA 2JNVA 4ZVHA 2RB7A 3HSZA 4MFBA 4DG9A 4M95A 2H4YB 2W2QP 1FI4A 2UUCJ 2R2RA 2IFXA 1Y5NB 4KBIA 3TUZC 3CF5Q 3H5XA 1SIZA 1GXUA 2M0GB 4ID8A 4OV6A 4X4SA 4ECXA 1LQLA 1YITS 4GKKC 2V2ZA 4I4BA 1HR0C 3QQCD 3EVOA 2OEJA 4C11B 1X9MA 1IN0A 3K5LA 1X9WA 3JSMB 1ZAWA 1R8HA 1HNXC 1X9SA 2BM0A 1S9GA 4UZCA 4B3TC 2A3JA 3TZYA 2E44A 3NBPA 2CQ0A 4IFYA 3SQGB 2GW8A 3DXSX 1KBRA 4YFUA 1LW0B 4N5SA 4QR1A 3I0SA 1RLDA 3GONA 1IB8A 5IT4A 1NBEB 5DZ6A 2H3EB 4DV2J 5C2CA 1RBAA 2Y9HA 4ZKAA 1NRKA 5M2PA 2UXCC 1K8AT 4ZLNA 1U1NA 1SB6A 4RNMA 2LXIA 4ED5A 2GO9A 3MWBA 4C0BA 2CQ2A 2M8DB 4J9UE 3M9OB 3DGVA 4X64C 1QAXA 5DS7A 2XMVA 3UO0A 4NLSA 3KYLA 8AT1B 2PDAA 1RTZA 4DV4F 2KG1A 5C24B 3B8HA 3MZIA 2E5JA 4RWXA 4NLOA 1FJEB 1KHWA 4AXIA 3PW0A 3T1HF 1R43A 2HNYB 4KGXB 4BS2A 2LDYA 2HS0A 2O3DA 1IXKA 2W4CA 1UEVA 1JB0C 4UOCA 4OI0A 4X2BA 4KO0A 2DGSA 3M8SA 3M2UB 1ZAXA 2V50A 2FJXA 3CW9A 5K5MA 2R8JA 3CD5A 3POTA 4AYBD 4XPEA 4KQZA 4WIQA 2DGTA 1DURA 2IBOA 1NDPA 5J2MA 1W2IA 4JI6J 2UU9C 4JI4J 1IBKC 3UOWA 1UWAA 3H5YA 1N4LA 3GLJA 3OVBA 3DYAB 4CLSA 4K4ZA 3R6LB 5HVFA 3JTPA 4OYXA 1GEHA 4JI2J 5KFVA 2CQPA 4ZVRB 1NM2A 2ATCB 4ZJOA 1TZ0A 1BD6A 1JQGA 2RHSB 2I9SA 1IBMJ 4RUCA 4QIGA 5C2GA 2FVQA 1U09A 3OL9A 2YQ3A 5H9EK 2R4FA 1RWMB 1NO8A 1Q81T 5CYMB 2RU3A 2SXLA 1U45A 4PAAA 3KKFA 3H25A 5EWGA 1RJJA 3KLFA 1GH8A 4BC7A 1FX2A 1NXIA 4RVNA 1WKLA 3D4JA 3KK1A 3BM7A 1V3ZA 2D41A 3M4XA 2QYCA 2VD3A 3ENQA 3MI7X 4X84A 1CVJA 4KGVB 4L7IA 3MMAA 5GAEU 3PW4A 3RB0A 4NOHA 1T95A 1RHJB 2CQBA 3K8VA 3HSDA 1PAUB 3GIKA 2A10A 1IJFB 3GG0A 1HH2P 5EHHA 3EXYA 4USMA 3J80U 1O6XA 2Y0BB 2ZOMA 2DGWA 4N7TA 4YR3A 3G4SS 2NXEA 3U7JA 4I56A 4H4KA 2HQGA 4I2PA 3D28A 3FFIB 2QRRA 5A8WA 2BABA 2YKQA 3D2WA 5HBMB 3QPIA 4P9SA 4ICLB 4F04B 2OKQA 1S1VA 1URRA 3GG1A 4A48A 2H48B 1J2VA 1XK8A 1QAIA 3DI6A 4J90A 1HBUB 2YNGA 1X4DA 2FHJD 1I94C 3OL6A 1SC3B 1S6QA 4DQQA 2B5JB 2I1RA 2G0IA 4QW9A 3BGOP 2P8IA 2QIFA 4WTOB 4BSZA 1RWXB 4DR6C 3DU5A 3NCQA 3CMAS 2KHCA 4DDFA 2OPSB 2VZ9A 3HHLC 1HKAA 1VLYA 3O2EA 2HFNA 3CJ3A 4ZCLA 3WHIA 2ZC4A 3MPUB 4L73A 3NGUA 3GKUA 2RRBA 4B9TA 3QT7A 3L8CA 5CD4A 1VQYA 4P10A 1RT2B 9RUBA 1ZS6A 4IG3B 5B0AA 4LF8J 4R8UA 1YRXA 4L74A 3G96A 2CPHA 2R8IA 2HWHA 1RWNB 4DR1J 3GV7B 4PWUA 4RUBA 5DDOC 2ZKTA 1X4AA 2DNYA 2E9ZA 5CQGA 3TP2A 1Z2LA 5MLCV 1FKOB 4Z7YA 4U96A 2HGNA 4V19X 4OYZA 5HLFB 3LOUA 1VCTA 1EP4A 2DY1A 4B17A 1RT4A 4EBDA 4H4OB 1Q95G 1T5DX 4G1QB 1YBAA 2N7YA 2HMIB 2XHWA 2BW2A 3C16A 2HHHJ 1N0UA 1VC6A 3UX3A 3RW7A 4DUYJ 3MPVA 3P3DA 2IDLA 3CMES 5BJRA 1U02A 5I4MA 3PIPQ 4DR2J 4OYWA 2X1GA 3UNGC 2KFNA 2FHJA 2YNFB 4KHPJ 1Y9OA 3DN9A 4Q0BB 1RT6A 2MZSA 1HQ2A 5BSRA 3J80Y 1OIAA 4B08A 2M5HA 2GVDB 1KDNA 4LE5A 2H5EA 2I5JA 1TL7A 1FJGF 2AJQA 1D0EA 2XYPB 1O93A 3K5NA 2P02A 3AD7C 3IR7B 4G3IA 1VRUA 5I42A 5GADI 2UUAF 4HACB 1RAOA 3PZPA 3PKYA 3LH2S 4KR0B 1GFWB 2ZE2B 3MTJA 4KC5A 4FBTA 4ECZA 3DLKA 2WD9A 2CADA 4DWIA 1UW9A 4X66F 3JQJA 2V8GA 4Y6IA 2E5LJ 5IFIA 2YXLA 3R1LA 4ANDA 4JB8B 1Y5LB 4JP8A 3NI2A 2HEKA 4KV8B 3G6VA 5SUHA 1IR0A 4B9SA 1X4BA 3GPCA 3TX8A 1LWEA 1SJ3P 1TL1A 3HHLB 3PROC 3BGUA 4KGKA 5E33A 5B0EA 3MEEA 1SKRA 1TUVA 1NHVA 2CJXB 1YJRA 5DRKA 2EFPA 2V2VA 1CPZA 1R6VA 3JQKA 1ELOA 4ES2A 5LCIA 4N8NA 3ET6A 3CJKA 3NG8A 1NPPA 5BR8F 2D3ZA 3N79A 3J80D 4PHTA 4A8WA 1HBOA 3BPDA 4NMLA 1R8PA 2B4UA 3C2PA 3M32B 1Q7YT 4O3RA 1YJNS 1NSAA 3KNAA 1RAHB 4A8MP 1Y10A 3N28A 3EPGA 3BSOA 1O5JA 3QIDA 3MR3A 1FTRA 2CVIA 2I38A 1EIYB 4LF6J 1FFWB 4WF9Q 3ETOA 3A4IA 1WUUA 4DR7F 4UY85 3NPDA 2RNEA 4CH0S 3EVWA 2KDNA 3M9NB 1VK3A 4EU0A 4DV0F 5BSTA 1RXOB 2BJ1A 4MJKA 2W9AA 1UAWA 4BWJA 9ATCB 3D67A 1JNRB 2JL9A 2Z51A 2R7XA 3Q8RB 1S7IA 3EDRB 2FUG9 5EX0A 2AIRB 3ENAA 1A9NB 4X65C 2B51A 2CPXA 1XBWA 2P2FA 1ZM4A 1RHRB 3LANA 4D56A 2WW4A 4LFBF 1H73A 3PO4A 2DY9A 4ZLPA 4BLGA 4GXRA 2DGQA 5F8HA 3H0PA 2LA4A 4X62F 3RB6A 5JRHA 1WTFA 5KOWA 4AL7A 2QC3A 5DZ7A 3T3FA 1X8DA 2CDRB 5D0HA 1DTQA 4R0JA 1MWYA 3V6DA 2ADBA 1JWWA 1YX2A 1X4FA 5DETA 1B7YB 2P9GA 2PN6A 4RJVA 2LXFA 4PUHA 5A6PA 3X1LB 2IRUA 2IA6A 3MM6A 3CD6S 2HHVA 1DLOB 4RU2A 4OJHA 4DU7A 3U1NA 1U2RA 1SKSA 3DOKA 5A0YB 3TDEA 1HWIA 2WHOA 1RWVB 5U47A 3A4TA 4DSKA 4RW8A 5KFDA 2Y4NA 2IYIA 4JV5C 3ADAC 1S1UB 2WK4A 1U6BA 4I69A 2QL5B 2CDQA 3SCKE 2ZH1A 3R1HA 2HHSA 5AXKA 4DV4J 1RZMA 3HVWA 4I7FB 5IZHA 2GQQA 3NWRA 2ZBQA 2V6AA 1Y0HA 1AROP 4CLZA 4MKBA 2AEJA 3JSBA 3C6UA 3T1HJ 2KN4A 4LSLB 2H4WB 1TVRB 3IBFB 4HI1A 2KZZA 4DV1F 2I6WA 2CNOB 3KK3A 4NZ7A 4NMXA 1JJHA 1UL3A 2HS4A 3I87A 3DLPX 2KZFA 3CQ1A 4LMZA 2MZTA 1S1WA 4PG5A 4L72B 2DRBA 4DFKA 3TX0A 1MD9A 1Q4RA 3IBWA 3RZAA 2JC1A 3RAQA 2CZ4A 3PV8A 2VV5A 1GX5A 2ZNZA 4ZDNA 1U4BA 2K7JA 1NK6A 1RT3B 4O4GB 4ED4A 4K4VA 1HBNA 1MU2A 4CLTA 2QLXA 2QTWA 4LFAF 2LQBA 3HULA 3ONQA 3PXGa 4AE5A 4A8KA 5KT4A 3QJPA 1HNZC 2J76E 4M5DA 3LPEA 2FYXA 3LA0A 3KMQA 4ZVUB 3GSDA 4M5GA 2DGOA 2A6MA 1KC8T 2BJDA 2DBBA 4DX7A 1UKUA 1TKXB 2IC3A 2V4JB 2GMHA 1BQNA 4KPCA 4C8LA 4WYLA 1G1XA 1S72S 3IR6B 1TL3A 1RTDA 3BO3A 1M5KC 2NZCA 1RTHB 3SCIE 4FPRA 2W4PA 4FUQA 4ZVFA 5C25A 4DQIA 3NKYA 5L38A 4FXDA 4EFAC 5DDRC 4K50A 1N8RT 1VFJA 3OW2R 5KG6A 3TQ1A 1RQ0A 4IH6A 4OI2A 1J5OA 4GKJC 1N0VC 5G0RB 3HJFA 2QA4S 1IQTA 1QSYA 3C5EA 4ED8A 2NLWA 4W90B 1RP5A 4WFBQ 3PJ9A 2FB0A 4ALZA 4DSFA 4LBPA 2BQRA 4I9FA 1XNQC 5CA5A 1DFDA 5F8GA 2MQ8A 1UFLA 1OPZA 2G13A 2R8GA 2XMKA 1B3TA 3D6FB 2HFUA 2GVZA 1IR2A 1S59A 1N52B 2ABYA 1S57A 2IM1A 1H72C 1E6YB 4WP9A 2AYBA 2G0CA 2FGCA 3CCES 1SV5B 2F4VF 4LSNA 1U1PA 1J5EF 3QRPA 4ILLA 2XGPA 1VR6A 4FS1A 2VSQA 2GJ2A 1X4HA 2C22A 3SCLE 2ROEA 2LDIA 4U7UD 1FRJA 3N6NA 3NP5A 1ZETA 3W8PA 4OYMA 4C3KA 1RAJA 1M1HA 3MFHA 4B9UA 2XS2A 2I0XA 4EO6A 1N34C 3OR1B 3GJSB 1RBLA 2XMJA 1JLQA 4I9GA 1UTAA 2HGLA 1OO0B 3MMCA 3G8TA 1TK0A 5K9FA 3NGSA 1NPRA 1HWLA 1HWJA 3DOMA 2KO1A 2ZJRQ 2BUNA 3PESA 3LAMA 4A8FA 1F9EB 4KFBA 4DR5C 1XMOF 1SBRA 2KL8A 3BH7B 4Y00A 2EC0A 3RB4A 2X3DA 2ZH8A 3PX4A 4X4PA 2JEJA 2ZH5A 1HNVB 1YSJA 3CSKA 3NEKA 4F7VA 4DQRA 1QUPA 3AA9A 4A8SA 3HKZD 3GWCA 2CXEA 3TR5A 3VTIA 4MAKA 5ITHA 4BWMA 2HNZA 4N77A 3L9ZA 3K57A 2QFIA 2KTQA 4E8UA 4RUAA 4PG8A 1FJGJ 4WPAA 2AGQA 2CPZA 3VAFA 3L7PA 3N54B 4UF4A 4D3GA 3R3TA 1D9FA 4QYRA 4TLRA 2CJ9A 2UUAJ 4OZ1A 4Q8FA 2BW7A 2PMHA 1XJWB 3IBCB 5B09A 2KM8C 1P4EA 1SC4B 4X66J 1FNXH 3DLHA 2FLLA 3O3LA 3IM8A 3CCSS 1Z2ZA 4LQ9A 4ZHRA 4XDDA 1KLMA 4NA3A 2N4DA 1CQNA 2MYFA 2ZNYA 3QLHA 3ZZZA 4NLGA 2KHDA 1F2GA 2Y0SD 2P6SA 1KQFB 1BA3A 3CJ8A 4EI2A 4JI0F 4AUKA 4X4TA 3RG2A 1L3UA 3TAMA 1ZBTA 5IWAF 3DLGB 1VQ4S 2GQCA 2UVUA 2B4OA 2DHSA 2QGFB 2E9TA 3Q8UA 1CJVA 2D1TA 2FJEB 3LP2A 4MYTA 1I6JA 3O2IA 1Y7PA 4USHA 2HVDA 2FLNA 4DV3C 1N36F 2W7OA 2YKAA 4DOZA 2RS8A 3KJNB 5BR8J 2COLA 1T7PA 2JX2A 3A25A 1HMVB 2EI5A 3HK2A 2EK1A 3WBZA 2VG5B 4CNZA 5BXIA 2VKRA 4ZITA 4DCSA 1H6KX 5E3CA 2VJUA 4AD6A 2X1AA 3W2VB 4C3MA 2PA3A 4K5SA 5T41A 2QN6B 1IBLC 2EFQA 4F4YA 2V8HA 3SQGA 2B7BB 3MDFA 4DPYA 3OJSA 3RRHA 5E41A 4B3MC 5ADZA 1LW0A 2OUGA 4DR7J 2RT3A 4NXNF 2WONB 4ZVEA 1OQ6A 1Q8KA 1RU2A 4FS2A 1RWKB 4A46A 4DV0J 3AOAA 5M2RA 1D1UA 3I07A 4RW7B 1W7WA 2QW0X 3U27A 4CCHA 3GR0A 4RU9A 2RVJA 4IZ6A 3VNSA 3CJ4A 3KXDA 2DPJA 4G37A 2QLFB 5KFSA 3TOQA 1T9TA 3J7A1 3KLEB 3IAM9 1W25A 4HHUA 3I96A 5C24A 1F60B 3FZ2A 3D0HE 3PM9A 1TMJA 2LU1A 4FN5A 2NXJA 2GGPA 5HI7A 4OHZA 4DUTA 1UFKA 3A3PB 2HNYA 2BJ9A 5K8FA 3WIUA 4X62J 3LPYA 2R7TA 2CY1A 4P72A 2Z0GA 2F8EX 3TWZA 4CH1A 4ES1A 2DHHA 4I2QB 4OIXA 1M5HA 4FF4A 4RLFA 3G86A 2P6TA 3M2UA 2JSXA 1DQ8A 1CULB 3AAWB 3CW8X 2RE1A 4NCAA 2DYJA 1F5BA 4CO2A 2OFHX 1X4CA 2VFVA 3M2VB 1XS3A 2YX1A 4Y28C 3ZZUA 1SJRA 3T1YC 4IYQA 1REVB 3PCOB 3DYAA 3SI8A 2H54B 4F0MA 3UDCA 5ETLA 1SQGA 3C46A 4CLPA 3AQOA 2WBRA 2EG2A 6AT1B 1FD8A 4A47A 1GQEA 1ULRA 4MMOA 1U48A 3ITHB 2D1SA 2MQPA 4ECYA 3QZ7A 1JX4A 3ILJA 4A8OA 1FTCA 4UUWA 3CCLS 2EFNA 1BWEA 1EAYC 3C66A 4QIEA 5A19A 3OR2B 4DMZA 4LF7C 5DDQC 4KTVA 2KFYA 4F02A 3HF5A 4B3RC 2Y1LB 3OFGA 5KFIA 2NPFA 5HAOA 1FLOA 2PT0A 1U49A 3E3XA 1UKKA 4Q8EA 2OELA 5A8KB 2NR0A 3WIVA 1SJFA 2C2EA 2XSJB 5KG4A 1SH3A 5HJYA 4HHJA 4PPDA 3Q8VA 4QWEA 3CO9A 3QAEA 2WCXA 1PSDA 3VAMA 4L76A 3VAGA 2G9OA 5L1LA 2IM3A 5HBMA 4ZLJA 4JI4C 2GAGC 4ICLA 3GIIA 2DK2A 1HQEB 1X0PA 3HHNB 4ER8A 4LFAJ 1FRLA 3P96A 3GCWP 4RL1A 3RU0A 1P9QC 2DO4A 1D09B 2HFVA 2B5JA 1UEKA 3MUTP 3SDEB 2DXDA 2V4RA 4MIBA 1LWFB 2RU9A 2OPSA 4JUZA 1YZ6A 1LCIA 2DT9A 2J8SA 2GHWA 3GZ7A 3UR3C 2CJKA 3GTYX 4JYAF 3RB3A 3OTOF 5F8IA 2KXHA 2X7IA 1RT2A 3FBCA 4KSEB 2EXUA 4CO0A 4IG3A 5KT2A 2VA3A 4W98A 2Q6BA 3UD5A 1UVNA 2CWKA 2G2OA 3R5DA 1X5TA 5J1EA 1T02A 3MM7B 2HQCA 1UEUA 2MJNA 1NDLA 5D0GA 1L2FA 1UVLA 3I5CA 1QLNA 1FKOA 3QGHA 3LP0B 3H5SA 2HHUA 4ZPVR 2V94A 4CLLA 2MKIA 2D3UA 1ZZFA 1TK8A 3NNCA 2MXYA 3UI3A 4M94A 4ZCKA 4H4OA 4QOTA 4S0MA 2IAJB 3AQPA 3HHLD 2HMIA 3W1YC 4O3PA 2EK6A 4C8ZA 2DCLA 3CJTA 5IC6B 5H9FK 3M8PA 4RNFA 4DL6A 3CE8A 2AGPA 5GMDA 2E9RX 2GS8A 3C6TB 3GMGA 4OZNA 3R8YA 4Q0BA 3LNVA 1FRKA 2F4VJ 4JI8F 1J5EJ 2HVIA 3TJAA 2ZH3A 5IM0A 1D9DA 2J0XA 2Q3PA 2BJ7A 1U24A 4FYYB 4CIOA 1KOHA 2VPZB 2YNHB 8RUCA 1EZZB 5KFCA 2VB6A 3KHRA 2RF2B 6FD1A 2ZD1B 2K3IA 3LF0A 2M70A 1C1BB 1HWUA 5KFQA 2N7CA 4HEA9 4PR6A 3KLHB 1T0TV 2Y8YA 2DNRA 4HACA 4MH8A 2V8VA 2ZE2A 5KG7A 3DRSB 4CWBA 3G7SA 2ONFA 2XS7A 2QSFA 4RLQA 2MKYA 5D15A 2DR5A 5F3TA 3KLVA 1XMOJ 4KV8A 1N6QA 1IR1A 2O67A 2VC1A 2LEPA 3BO2A 4L2ZA 4FF2A 2MKCA 1JLFB 2DNOA 4NXMC 4MKAA 3RR8A 4YY3F 4PWWA 1UPMB 3LWMA 2R9LA 1U1QA 4RUHA 4DQSA 3NS5A 2LEAA 1HBMB 1V5VA 2PE8A 5JUMA 5FDLB 1NKEA 3QFHA 1BUXA 3FMWA 4EWTA 4Y2KA 1PCAA 1S0VA 2ZBRA 1Y4ZB 3IM9A 5HANA 1EQ0A 3Q89A 1KFDA 1ZB8A 2K8GA 1UCNA 1ML8A 2EVZA 3CWJA 2WAQD 4YR0A 1MKYA 5DO2A 4UY8T 5F41A 2HIQA 2Q6CA 3AODA 1NUEA 4NYZA 3NRBA 4YHHC 4HR2A 5T14A 3M32A 2NSBA 3PFOA 4PG6A 4NEYA 1S9EA 4BCAA 2MMAB 1V3RA 1Y3KA 5AT1B 2HQIA 4R25A 1UVMA 3W9HA 5H9FJ 3KLIB 1BLUA 1TKDA 4QWDA 1NKBA 2VUGA 3Q22A 2J6SA 2YVSA 2Z2LA 4I6AA 2Q66A 2ZM6F 3CDWA 1OY8A 5CAAA 2UXCF 4USIA 3HFKA 1M5OC 4JI0J 1MMNA 2FPHX 4G65A 5IWAJ 3PVXA 3R2DJ 2FHMA 2XMUA 3A1YG 3EGVA 5A8RB 2OPRB 3KLGB 3AFGA 2A2CA 4F25A 3T9NA 4N41A 4J7CA 4JV2A 4X64F 5BYRA 2CQ4A 2OTJS 3B6BA 2R8HA 2XO6A 4R0EA 2DNNA 2ZUAA 2KH9A 3HDSA 3D6HB 2ASJA 1M1GA 4I1TA 1PA4A 2DNHA 4HT5A 4P2XA 3D7SB 1TL4A 4KPYA 1L3SA 4RM3A 4LRFA 1N56A 5KFBA 3D5MA 2XMMA 5ETNA 4N8OA 1E6VB 3P45B 5D8HB 1N5TA 2HQFA 1RU1A 1ZZNA 4D4IA 2CQ1A 4ISBA 1FDNA 4ZLLA 1LNQA 3BSNA 3BKFA 3LAXA 4CYUB 4CO1A 2LXUA 4PXEA 2HQDA 2M5OA 1U26A 4J9RA 3K2YA 4USWA 2UU9F 4DPTA 4NXNJ 1K1QA 5ETRA 3A13A 1L3KA 1DLOA 2OIHA 5DGBA 4IUFA 1KVIA 5EWEA 2J8AA 2KRBA 4GVLA 5I3PA 2KVQE 1TFWA 3EERA 4AQYF 5D4PA 1JK9B 4Y2IA 2HVHA 1HNWC 4JI5C 2F7VA 1BQXA 4ZPAA 2OTLS 4C8KA 5C5JA 4HPVA 2M52A 4PPZA 2B56A 2BQUA 2VFUA 4ELUA 1VBXA 4DX6A 2CQDA 1IM6A 1C4CA 5L8RC 4I7FA 4OX9C 2MJUA 3NXZA 1KFSA 1WOPA 3RAMA 3E01B 4LSLA 4ETZA 3FBFA 3IFEA 1TVRA 1TAUA 4KH1B 2EEYA 3TI0A 3FUYA 4KB7A 2RDJA 1M5SA 3R97A 2ZKUA 5KG0A 3VVTA 5J2NB 3FGVA 2DRAA 3H5UA 1RCOB 1HL6A 4NLQA 4DCTA 3KWMA 4GO7X 2JH3A 1HA1A 2W7PA 1KKGA 1V60A 4WBFA 2W8LA 2DTJA 3SSQA 2M7SA 4CLFA 3KTQA 2OH2A 3PR4A 4EYIB 2E7WA 2LVWA 3I55S 4TY8B 2APOA 2E5IA 4LF9F 5JMNA 2ADCA 4O4GA 3LGHA 1DJ0A 1VYAA 2VIHA 4DG1B 2OEKA 5KFEA 1SL1A 4OJGA 2LQ9A 1FD2A 3IMQJ 1VJQA 2CJYB 4OYCA 3I9ZA 4WE1B 4USUA 2VBXA 3IP0A 4DR6F 5KFJA 5F3ZA 3EZOA 1R8CA 3HJVA 3DOLB 4P71A 2B7CB 2YKNB 1VQ7S 1WC6A 1DAXA 4ES3A 4DV2F 1OY9A 4E2FB 1SKWA 1TKXA 2VF3A 1PJ7A 2W2PP 1BGXT 3DLLQ 1AFIA 4TNOA 4FBUA 1G7CB 3T1HC 2VPXB 2V7BA 2QYGA 3QZ8A 2YCBA 1RTHA 5HQMA 2CPEA 2C2KB 4UQTA 1T9YA 4DG8A 3TR3A 4KYZA 3EGZA 5K8MA 3HD2A 4C4WA 2WTFA 3QIPB 1GMVA 3TQEA 3JXOA 1JLBB 2CPDA 5G0RA 2B0GA 4ED0A 4FKYA 3H2VE 1WACA 1QDUB 1SJ1A 1ZTWA 5CD4H 2OSQA 2QLWA 3QWUA 3VF0B 1NK8A 1YJVA 5L9XA 1LFPA 2FJDB 3DDKA 2OPPA 3PJWA 4OZLA 3SYZA 3S8SA 3V6HA 2EFGA 3BO4A 1E6YA 4I6WA 3CC2S 3H4DA 3T5KA 1SV5A 3RRGA 4Y34A 2VDHA 4NLVA 4JYAJ 2AJFE 3VVUA 4EZ6A 3OTOJ 5CHCB 3UD3P 2HPUA 2EWHA 1WKJA 4J91A 1PYTA 4ZIVA 3CMQA 2XULA 4URGA 4C8OA 1C0UA 3SZ2A 2IMWP 2YPYA 3FEZA 3SEOA 4NRTA 1WOOA 4PZPA 2ZBPA 3DU6A 3SO4A 3OR1A 4D4GA 1GXLA 3PJXA 2QVZX 3MR5A 2J6TA 3F56A 1KSPA 1ZM2A 2FHKA 4DFPA 3EZ5A 4ZPWR 2VASA 1JLCA 2FVCA 3DAYA 5IT9U 2R7OA 3CCTA 4MIWA 4RNNA 3T19A 1NU4A 2MZJA 4ZP6A 2B6AB 1K0RA 3GIRA 4ED7A 2ZDOA 1Q7LB 2BR0A 2OPLB 5H1SV 5DM7Q 3NWGA 2BQ3A 4ED1A 3L09A 3NCPA 3KMSA 1RT1B 1HNVA 1F5CA 2MSSA 4ZVOB 2DXFA 2VU5A 5CCLA 4MIAA 3HO1A 1WG5A 3I31A 3V81B 3T6JA 3MPDA 3ISNC 4NX9A 3B54A 3AF5A 3ILLA 3PRVA 4JI8J 2MZRA 4LJMA 4K4YA 2YH0A 4LFCF 1PG3A 2R7WA 1FHTA 3DHVA 1GK8A 2IM0A 2MKKA 5J2QB 1HHQA 1ZB9A 3KUEA 4F8RA 2DJWA 5LM7E 5KYTA 3WQPA 4IDKA 4HHHA 2BANB 4Q45A 3PY8A 4MK7A 1V26A 1DZ5A 3QAUA 5AE2A 1FERA 5ETMA 2KT2A 3S1TA 2LKZA 5DG9A 3TUFA 2NXCA 4J9PA 5J2PA 2MQOA 3CCJS 1R3NA 2H9ZA 5M2UA 3RRKA 2NCKL 4ZP7A 1T9UA 4USKA 3J7YI 2P5VA 4F36A 3BQ1A 3DRYA 3GFXA 4B3SF 1G2EA 2LMIA 3B4DA 2F8MA 3DLEB 2C42A 1GT8A 1TR0A 3UW1A 3TA2A 3UEBA 2HNDB 3BQ2A 2DGUA 3DLGA 4YY3J 3A9VA 2VQFC 3SFGA 1R0BG 1HHSA 3TA1A 2HVZA 4Z2XA 2CG8A 1OSDA 3LAKA 3CCVS 4NI2B 5LSOA 2VQEC 3O1LA 1AFJA 2HGMA 3OQ2A 2DO0A 1VBYA 2RQKA 1M6XA 3CD7A 5D4NA 3QATA 4WYWA 3R5BA 2DEJA 2DCUB 1MXCA 1HMVA 2HFOA 3C8YA 3I0RB 5IT9Y 3BR9A 2JLGA 3KG4A 4NA2A 2HSEB 4AL5A 2D9OA 1RBOB 4DUYF 4GKKJ 2ILZA 4RW4B 1N5VA 2BKNA 2GZOA 1VHFA 5EUHA 3BSAA 1R0AB 1WC5A 2D3OR 1KEKA 2AJ0A 2LLZA 2AU0A 1TKZB 3MPYA 3BB5A 3OL7A 3OLAA 4C98A 4TQSA 5CZXA 1CJKA 4GO5X 2MGZA 3TEHB 2G0JA 1VRTA 1U25A 3BR8A 1EJ7L 1CEZA 2WONA 2XY5A 3GILA 2ZM6J 1RTIA 2WB1D 4NE9C 5L39A 1I5OB 2QL7B 1NNDA 2HLTA 2UXCJ 3HX9A 1N2FA 1AYEA 4O3OA 3AB2B 4FYDA 3JYTB 3I56S 3NL0A 4JV5F 2GQ2A 2WVFA 1KONA 4M5IA 4ZCIA 1T05B 4X64J 1RSCA 4YDXA 3KLEA 1WSVA 2HRTA 1NJYA 3ZZYA 1JIHA 3W64A 2DNPA 1DTTB 2ZH7A 4WIIA 2J9EA 4CP5A 2R2TA 4M5HA 4AFFA 1D3WA 1VI7A 4I2QA 5D4LA 3VGVA 5IT9D 1OYDA 1UZDA 4YUDA 1F1BB 1XRCA 1TH5A 1CULA 2LEBA 3AD8C 1NJWA 1H2VZ 4RW6B 3FRYA 2FVPA 2UU9J 3N6MA 4LF5C 1IKVA 1GNKA 3IGNA 3QT5A 2XLJA 3BDPA 4QWBA 4B9NA 1S9GB 3UVJB 3M2VA 4Y2MA 6FDRA 1T94A 4ECTA 1REVA 4OHXA 3RBZA 1F2HA 3CD0A 4GRSA 3I0SB 3HI9A 2VHGA 4AQYJ 1UA0A 4YR2A 1YBTA 4DV0C 5ETKA 5IQQA 2YBVA 3Q86A 1GMWD 3ITHA 1RB0A 2RMLA 1MNEA 2MY7A 2DHAA 4DJBA 4FVMA 3TYTA 4F2SA 1K9MT 1O51A 4PWDB 2EBGA 2F40A 1YI2S 3OR2A 2OAUA 4CZCA 4H4KC 1B70B 3SMZA 1ROFA 2J7KA 2IA0A 4RZRA 1S10A 4LFBC 1DY3A 2OMOA 3I5BA 1S99A 1PBUA 4QU7A 1OSCA 1TUGB 3EE3A 1FRIA 1X0FA 4J37A 2E5GA 2K7KA 2I2YA 2FJAB 4IH5A 2XLIA 1XMQC 2XSJA 4OX6A 3FSYA 2DNKA 2XNQA 3IA0A 3OFHA 2UVWA 1N5SA 4I64A 1MN7A 2DIVA 3NYRA 3HKWA 2WSEC 3KXWA 4DV7C 2ZHBA 1RT7B 3DFEA 1GMUA 2DPLA 4GKJF 2GMJA 2Z2ZA 4PROC 2WSFC 3JSYA 2J0QD 1UP1A 3OV7A 2Y1JA 1HQEA 4LF9J 3CCZA 1M0SA 2DIUA 5C7PA 4MTPA 1VC0A 3MAQA 2CNKB 2AEMA 3OVSA 2V34A 4NDNA 3NCRA 3RUBL 3G8SA 4ZVGA 5E3RA 3IG1B 2IPOB 4Q5VA 1PGZA 3ILOA 3FNNA 2PI4A 2R2UA 3NOCA 3EVMA 4DR6J 1V9OA 3SDEA 1XC9A 2BEFA 4MK8A 2BKPA 3VGUA 3H59A 3W66A 3KK2B 1XR6A 4M5LA 1R27B 1DQ9A 1IWAA 1U1RA 1RGVA 2DVIA 4CM2A 4B9MA 2F65A 3DRRA 4MTNA 1VISA 3AJDA 1VC5A 2UP1A 4WKRA 1WDDA 3DRPB 4RO0A 4ID5B 2QMXA 1QAJA 2CPFA 4U67Q 1FRXA 5HL7Q 1MMLA 4WFXA 4YQWA 4WU3A 4Q2MA 4DV1C 2D9PA 1NJZA 1FJ7A 4M5JA 2XM3A 3I4HX 3MM7A 3MMAB 2D27A 4F67A 2CAJA 1V5IB 1N34F 2D7VA 3HM9A 4OZ5A 3BGLA 3LP0A 1WCJA 2V69A 5KG3A 3HFZB 1CBKA 4IOCQ 2PROA 1LW2B 3I82A 1DRZA 3FMBA 2IAJA 3PIOQ 4DR5F 3CDUA 2BV3A 3TVYA 4FTFA 4I2PB 3OBIA 2HRYA 5A8WB 3HSJA 2YPZA 3CDAA 2OLWA 2AYEA 4LFAC 2OPQB 3DI6B 3QMQA 4IKAA 3GB0A 2UXBF 1ICEB 4RBUA 4K4WA 4J9NA 2V8DA 1S6QB 2B9WA 3K89A 3HT3A 1U6ZA 4LBIA 3R6GB 4FYVB 2HHTA 1REGX 4WFAQ 3PX0A 1ZAVA 1ITPA 2AMCB 2AKWB 1QM4A 2YNHA 2AYMA 2XWXA 4KKOB 1FNOA 3Q8PB 2RF2A 2ZD1A 1AXQA 3SQOP 4HTJA 1NPKA 2XY7A 3TEGA 1C1BA 4ECSA 1S6OA 5GAEI 1C4AA 2M8HA 2W9CA 3DRSA 4TY9A 1HQUB 4EEYA 2HVEA 3TANA 1QTNB 4K5RA 2BRLA 1NH8A 2Z57B 1ZM3A 1OJ4A 3MTKA 2DHGA 4JBCA 4QPXA 3HVAA 4ATNA 4PABA 2HRUA 3K0JA 1KHVA 4Y2CA 4DS5A 1S97A 1EP4B 2JDJA 1JLFA 2RUGA 3OTDA 4OX8A 1RT4B 2NREA 4ZPCA 2OD6A 3GYNA 1NKCA 1HBMA 2JEGA 2E29A 3OTEA 5L1JA 1A7GE 2RRNA 5FDLA 1S48A 4FKXA 2B8PA 2C3YA 4Z37A 5HO4A 4OHYA 1C2PA 1UVKA 4LFCJ 2JRSA 1WF2A 4DV6C 4OLPA 3M30B 1JKHA 5H9UA 1DARA 1SUQB 4DN9A 2F4VC 3IWNC 4EGLA 3GP9A 2K2PA 2CKWA 3PBKA 2PMZD 3PW7A 1RG9A 1TL7B 5DQHA 2NXNA 3HD1A 1S0OA 4L3NA 3ZZTA 3NYQA 1MXBA 5DV9A 3W2WA 2W1BA 5CH7B 1S4EA 5B0BA 2ZVSA 2YKMB 4IRDA 1FK9B 4B3MF 2AGOA 3IMLA 1Z4UA 4DPWA 4KE5A 3P6YC 1NEEA 4H54A 2YQ1A 2K1RB 3PRDA 4B3SJ 4C0HA 3UDEA 3VZIA 3H98A 1H7XA 2KJWA 4DL5A 2ZWOA 3BBFA 1T3OA 1XMOC 4LRCA 4TVAB 4FYWB 3MUVP 2ZUGA 4QZVB 1LWEB 2CA9A 4OI3A 5A8RA 2YKOA 1TL1B 1PILA 1U2FA 4XTTA 3BZQA 1Y00A 3MEEB 1CS4B 3FSIA 3EX7B 3NY0A 2WBMA 2YKPA 3IWLA 8ATCB 3QT6A 4C6AA 2XO7A 3NS6A 3P5TL 3F41A 1NSKL 3LQVA 2QMWA 3IN5A 1MLAA 1WG1A 4J9KA 3M9MB 3OJUA 4KHRA 1ZTTA 3PYEA 1IM4A 3ET6B 3NMRA 3GFYA 2YH1A 1HFEL 1SPBP 3I5AA 3PO5A 2XI2A 3T41A 1FE0A 5AE1A 3MAHA 2IRYA 1T03B 2JMPA 4ZOSA 1HYSB 5KEIA 2ZHAA 3R9XA 1C1CA 1VIXA 1YK9A 1HBOB 2DNGA 4NLWA 1TFYA 3BDEA 4CYUA 1VBKA 3UNYA 3G6ES 2QG9B 3KG0A 2KDOA 2KT3A 5ETPA 3W5XA 5C42B 3T1YF 4O3NA 5LMNC 1NK0A 5HP1A 1FRHA 3ZO7A 5BSMA 1UWBA 4PXDA 4A8QA 1NSQA 3NGRA 2Y8WA 3HMJG 4Y3CA 3C15A 4ERDA 1RKIA 5DLFA 1WF3A 5IV4A 3ULHA 4JV5J 2VC0A 3LGXA 3Q8YA 4IFVB 4IRCA 4X4UA 3UCGA 3MM5B 1CC8A 3D54A 1RAFB 2ZC3A 3MOZA 1QD1A 4RM2A 4LF7F 2V9WA 3GQCA 3BKUA 1QVFR 2HW3A 2MM9A 1NY8A 3EPIA 3W5YA 4LSZB 1N36C 2QZ8A 2Y27A 4JI7C 2FY8A 4B3RF 3MEDB 3MHYA 2UUBF 4LR9A 3KDNA 1X4GA 4DI6A 1F5AA 1U8SA 1ZOTA 2V5HG 1DQAA 3KJVA 5J2NA 3KG1A 3DLBA 4RVOA 2L3MA 5L1IA 1ZM9A 2EG1A 1YRUA 4P75A 5KFPA 1JLEB 3CTRA 1UW4A 1DTQB 5F8JA 2DH7A 3EUNA 4F4KA 1S1TA 4Y2AA 4DS4A 1Q53A 1PAEX 3VQSA 3VR1A 5HQ8A 4DSJA 2E8EA 1U8WA 3V6KA 2HJGA 3PG9A 3IR5B 2QL8A 1YJ9S 3DNCA 2IVYA 4LRDA 3RTVA 2QL9B 3FQLA 4C8YA 3HVTA 2KZ0A 2HYIB 4BHQA 2JFDA 1EKRA 1H2UX 4DG1A 2DXEA 2WZ1A 7AT1B 1URNA 3BS9A 3PDNA 4ZJQA 1HHTP 4WE1A 4DR3F 1T9WA 3KUHA 1Q79A 3K6RA 2AD9A 3SV4A 2FZKB 2OI2A 3IC1A 3GSIA 4DCOB 3KFWX 2YKNA 1OS5A 2U1AA 4RBTA 2XR1A 2IM2A 4FNIA 4CO4A 4DLEA 2W2OP 2U2FA 2F4FA 2R7VA 5ETSA 4EO8A 4WK3A 1FDAA 4G36A 2XMAA 4PKDB 2QA1A 3B7WA 4PXCA 2YNIA 1VK8A 3AJ2A 5F0UA 1TQLA 2X51A 4DF8A 2MPUA 5J1NA 4M63A 3FEYB 1RK8A 4KAIA 1KQSR 4WP3A 1WHWA 3EWGA 2J7WA 3V5RA 4TU9A 7FD1A 1YWXA 2P20A 3FCWA 1WEYA 3THPA 4GKJJ 1JLBA 1S1WB 3MPWA 4PUIA 1SJ4P 1B99A 4JI3C 3C19A 4JI1F 1FXLA 2E7VA 2WP0C 2IHR1 2W8KA 1U0HA 2RAQA
chains in the Genus database with same CATH topology
1IJEB 1DURA 2P9EA 1ML8A 2IBOA 2EVZA 5J2MA 1W2IA 3CWJA 4PG4A 2UU9C 3OHAA 1APSA 2WAQD 4YR0A 3FVYA 1MKYA 5DO2A 3ENWA 1IBKC 4UY8T 3M8RA 4WTYA 5F41A 2RS2A 4NRUA 3OXLA 2JVRA 3UOWA 3BSCA 4K2XA 3PEJA 2HIQA 3H5YA 2LYVA 2Q6CA 2MKJA 4O44B 3B82A 1Q1KA 1HBNB 1N4LA 1H7WA 4NYZA 3NRBA 4YHHC 3OVBA 3M6XA 2OBVA 5T14A 3M32A 2NSBA 3DYAB 3PFOA 5KFTA 4K4ZA 4KHMA 3JTPA 4PG6A 2EBEA 3PNIA 3CJEA 5KFVA 1S9EA 4BCAA 2CQPA 3OSPA 1HD0A 1V3RA 1HARA 1TV6B 5KFGA 2MGZB 1Y3KA 4LIRA 1VRTB 4PG7A 3OVAA 3M1VB 4M5DB 4KJIA 2FDNA 2HQIA 4R25A 4TQRA 2BRKA 1RY2A 1UVMA 1RTIB 4JM1A 1TZ0A 1BD6A 5H9FJ 3KLIB 1BLUA 2I9SA 4RUCA 4QIGA 2FVQA 2KYZA 1TKDA 2OFGX 4QWDA 1NKBA 1U09A 3OL9A 2YQ3A 2N3LA 1ZYQA 2VUGA 3D0GE 3VWSA 4BDPA 4D57A 5A1GA 3Q22A 1UA1A 2R4FA 1JJ2R 2J6SA 2YVSA 2FJBB 5DQGA 2Z2LA 1NO8A 1K0TA 3LP1A 4I6AA 3LW5C 4IG0B 3HPOA 5CYMB 1Q81T 2RU3A 2Q66A 2ZM6F 3GFHA 3CDWA 2SXLA 3FCEA 1U45A 5AJ3F 5I3UB 2ZDPA 1G6BA 3KKFA 2UXCF 4USIA 2OMLA 4HDGA 3HFKA 3H25A 1M5OC 1MMNA 5EWGA 1RJJA 2DNLA 2FPHX 2NUHA 3KLFA 1GH8A 4BC7A 4C3LA 2QA4G 4OFZA 2ATWA 5LMUC 4P7TA 1RTDB 4RVNA 4PXBA 5HMWA 3PVXA 3KK1A 3BM7A 1WD6A 3RW6A 1V3ZA 2D41A 3M4XA 2FHMA 3MEGB 2L9DA 1OQ3A 1TK5A 2QYCA 3TVZA 2XMUA 3A1YG 3N5FA 3QGGA 4DPOA 5GAGU 5A8RB 1MROA 1RA7A 2OPRB 2VD3A 4ED2A 3MGJA 3KLGB 3ENQA 2A2CA 4F25A 3T9NA 2LQ5A 3MI7X 4N41A 4X84A 1CVJA 4A8YA 4JV2A 2VG6B 4X64F 4L7IA 2CQ3A 5BYRA 3MMAA 5GAEU 3PW4A 3W3SA 5CYJA 2NSCA 2IMOA 3MD3A 1U1LA 3QO9B 2CQ4A 2OTJS 1O9TA 2RIJA 2JJ4D 4Q44A 3RB0A 4EATA 2MQQA 4NOHA 2KXFA 2R8HA 3Q24A 4IQMA 1FDDA 4R0EA 2DNNA 2KH9A 1T95A 3HDSA 3J7YU 2CQBA 2ASJA 3K8VA 3THVA 3GIKA 2OPLA 4I1TA 1PA4A 4X65F 2A10A 1IJFB 1FRMA 1A6LA 2XG8A 3GG0A 5EHHA 1HH2P 3EXYA 3IWXA 2DNHA 4NXMF 4HT5A 2RQ4A 1VBZA 1IKWB 2ASDA 2ZOMA 2DGWA 2IYGA 1PC4A 1TL4A 3MM8A 1XWLA 4KPYA 4F26A 4YR3A 1L3SA 3G4SS 4IO9Q 4RM3A 1KNZA 3H8YA 3U7JA 3PEHA 4I56A 4H4KA 4I2PA 1U1MA 1N56A 5KFBA 4QWAA 3V81A 3D5MA 3D28A 2YX4A 2KVIA 2XMMA 3AH6A 3HZGA 3L3CA 3FFIB 1E6VB 2QRRA 4N8OA 5A8WA 5D8HB 1N5TA 2BABA 2YKQA 1ZZNA 1AMUA 1IKVB 3D2WA 4D4IA 3ZZRA 5HBMB 5EWFA 3QPIA 2CQ1A 4QU6A 4ISBA 4ICLB 3SXLA 2C2DA 2VG5A 2O5DA 4JI3F 1FDNA 2OKQA 1FJCA 3K59A 3BSNA 5LL6d 1S1VA 1URRA 3LAXA 1UJ4A 3GG1A 4A48A 2YX7A 1WG4A 4CO1A 2LXUA 4PXEA 1J2VA 1XK8A 3W7BA 1QAIA 1FJGC 3DI6A 4NL5A 1HBUB 2YNGA 1U26A 1QUVA 1X4DA 2FHJD 3D1QA 3W2VA 5KFOA 4J9RA 3K2YA 3BGFA 2QVXX 3OL6A 2UU9F 1QWIA 4GC6A 1N5YB 1S6QA 4DQQA 4FNHA 2B5JB 5B0FA 4LSNB 2XB2D 1K1QA 2I1RA 5BURA 4QW9A 3WDOA 3I08A 1L3KA 1DLOA 4Y65A 2QIFA 4BSZA 1S6PB 3M8QA 2OIHA 5DGBA 3OTOC 2BANA 2HHPA 4IUFA 4DR6C 1KVIA 4YHHF 3DU5A 3OSNA 3NCQA 5EWEA 2J8AA 2KRBA 2UUAC 3CMAS 1WF0A 4KIAA 4C2MA 2C3OA 2KHCA 4DDFA 2OPSB 2VZ9A 4ECWA 2DH9A 3HHLC 5I3PA 1TFWA 1VLYA 2HFNA 4CTAB 3EERA 4ZPDA 3CJ3A 4AQYF 5D4PA 1JK9B 4CO5A 4ZCLA 4Y2IA 2ZC4A 2HVHA 4X66C 1HD1A 1FKAF 1HNWC 3OLBA 3GKUA 4JI5C 5L9NA 3D0IE 2F7VA 2RRBA 4B9TA 1BQXA 3L8CA 4ZPAA 2OTLS 4C8KA 5C5JA 4HPVA 2M52A 2MHNA 4RW7A 4PPZA 3DRXA 1VQYA 4LQ3A 2B56A 2QA2A 3HVRA 2R7RA 2BQUA 2VFUA 2BE2B 3V4MA 1RT2B 2FJVA 4ELUA 1VBXA 2IRXA 4IG3B 4NZ0A 1O8BA 1JLQB 2CQDA 1FEHA 5B0AA 2E1AA 4R8UA 1YRXA 3OL8A 1C4CA 5L8RC 3ISND 4I7FA 3G96A 3QJLA 4ODJA 2CPHA 1IKYB 2HWHA 2R8IA 4OX9C 1R6YA 2MY8A 2MJUA 3IAS9 2UUBC 1B64A 1C0TB 1RDRA 2JFKA 3GV7B 1KFSA 3PX6A 3RAMA 4PWUA 5DDOC 2HNDA 2ZKTA 3MMJA 1X4AA 2DNYA 3X3UA 4CQ1A 5CQGA 3E01B 2E9ZA 4LSLA 4ETZA 3TP2A 5LMUF 1FEEA 3IFEA 1TVRA 1Z2LA 1TAUA 1IKXA 5MLCV 1FKOB 1JLAA 2HGNA 4RW9B 3TI0A 4V19X 5HLFB 4KB7A 3LOUA 1RA6A 1M5SA 2RDJA 2V4QA 5F8NA 4KTTA 4K4XA 2DITA 2JLFA 1EP4A 4G6VB 4B17A 2ZKUA 2L9NA 2Z8QA 4MFBB 1RT4A 5KG0A 4EBDA 2X3GA 4H4OB 4NZ6A 1T5DX 4G1QB 1YBAA 2N7YA 5J2NB 2HMIB 2XHWA 2BW2A 4YB7A 3FGVA 1N0UA 1VC6A 3RW7A 1HI0P 3MPVA 2DRAA 1S1XB 2FJWA 2AYAA 3PRBA 5BR8C 1ZPWX 3H5UA 1HL6A 4NLQA 4DCTA 2FIUA 3P3DA 3KWMA 3CMES 4GO7X 5BJRA 2EGTA 2JH3A 1HA1A 5I4MA 2W7PA 3PIPQ 3I0RA 2AJ1A 1S77D 3UDLA 1TKTA 2X1GA 3UNGC 1KKGA 3D1OA 4LF4F 4DF4A 1X7VA 2KFNA 2FHJA 2YNFB 4OV1A 2W8LA 2DTJA 3SSQA 3CT9A 2D74B 4RW4A 1Y9OA 2M7SA 5K8PA 3E8OA 3KTQA 2OH2A 5D3GA 5IS2A 3DN9A 3PR4A 4EYIB 2E7WA 1R0AA 4Q0BB 1NYEA 2ZZMA 1RT6A 2QV6A 3HZEA 2LVWA 2MZSA 2EFOA 3I55S 4DSEA 1UJ5A 5BSRA 3DM2A 3J80Y 1TAQA 1OIAA 2RQMA 4B08A 3PW5A 4OZJA 4TY8B 4LE5A 1HNIB 1BQMB 2APOA 2E5IA 2H5EA 4XK8C 4LF9F 3NBPB 2ADCA 2B4PA 4IFYB 2CJQA 4O4GA 2O66A 1TKZA 3HP6A 4HI2A 3VZHA 4DR3C 2GMLA 2I5JA 1VS3A 1DJ0A 4DG1B 3H40A 5K14B 1L3TA 3KNGA 4DL0C 4ZK7M 1FJGF 4WCEQ 5KFEA 2AJQA 1SL1A 4DCUA 2ZH6A 5B7WA 4RMNA 4DR7C 4PQAA 3DC2A 1D0EA 4OJGA 2LQ9A 1FD2A 2V2KA 2E5LC 4OI4A 3WZ0A 1O93A 2XBPA 5CYQA 4EBCA 3K5NA 2E5HA 2P02A 4HDHA 3KHLA 3DHXA 4OYCA 3I9ZA 1L3VA 4WE1B 1XNRF 2NUUG 3BF4A 2VBXA 3IR7B 4G3IA 3DRRB 4G1PA 3CUNA 1JOSA 2M3DA 3HLUA 2XS5A 4DR6F 2E1CA 5KFJA 1VRUA 1O0PA 5I42A 3M6UA 3B78A 5F3ZA 5GADI 2W9BA 1R8CA 1WHYA 2UUAF 3MXHP 3UCZP 2PIIA 3DOLB 3PKYA 2YWGA 3CIMA 3LH2S 4KR0B 3PZPA 4NCGB 2ZE2B 1VMBA 3MTJA 4KC5A 4ZHRB 4ECZA 3TUIC 4FBTA 2B7CB 3NAIA 2YKNB 1VQ7S 1MXAA 3DLKA 1HNZF 1O92A 2XGQA 1DAXA 2WD9A 3JYTA 1LXJA 4ES3A 1M90T 4P6QA 4DV2F 4DWIA 4X66F 4KTQA 3NNHA 2V8GA 4FVCA 4Y6IA 1SKWA 1TKXA 4JI5F 2LCWA 3MURP 1NJXA 3BN4A 5KFLA 1BGXT 3DLLQ 1AFIA 4TNOA 3MD1A 4FBUA 3K5MA 3OFFA 3QGIA 3MR2A 5IFIA 1G7CB 3R1LA 3T1HC 1GAOA 4A4JA 1IQZA 3RR7A 4NYOA 2NQPA 1Y5LB 2VPXB 1GXTA 4YY3C 3WC2A 2V7BA 2HHQA 3NI2A 2ACYA 2J0SD 2VPWB 3QZ8A 4KV8B 1WF1A 3NAHA 3G6VA 3Q23A 5SUHA 1IR0A 4B9SA 1X4BA 4F4XA 4ECUA 2YCBA 3MECA 3GPCA 3TX8A 5EN1A 4OX9F 1LWEA 1RTHA 1SJ3P 2ZOFA 2CPEA 2MSTA 4UQTA 3L7OA 1CSJA 1TL1A 3HHLB 3PROC 4YEAA 3CULA 2KJVA 1LQ9A 4DG8A 4WKYA 3UCUP 3BGUA 4X62C 4KGKA 1DTTA 2QT7A 2VKZG 5E33A 4WXOA 5B0EA 2ZZNA 3MEEA 1SKRA 1FO1A 2PD1A 1TUVA 3EGZA 5K8MA 1NJWA 4EBEA 4JI1C 5KTQA 5E5NA 1KR4A 5JVGQ 5MAOA 2MQLA 4C4WA 4KO0B 5KAKA 1NHVA 2WTFA 2AWZA 5GAHI 1YJRA 2J0WA 3QIPB 5DRKA 5A8KA 4DSLA 1QSSA 2EFPA 1LV5A 1CPZA 1JLBB 2K3KA 2CPDA 1ELOA 5G0RA 2B0GA 2WOMA 4N47A 4ES2A 4OXIA 3IS9B 5IQ6A 1I1GA 4N8NA 1KTVA 1QE1A 4DV5F 4ED0A 2DGVA 2AX0A 2F3JA 3CCWA 3H2VE 3POTB 2FD2A 2HHWA 4LUBA 1K0VA 1WACA 3G6XA 3CJKA 1SJ1A 1ZTWA 3NG8A 4YP3A 3DMJA 5BR8F 3CCQS 3VAHA 5F8MA 5CD4H 2D3ZA 2OSQA 3N79A 3J80D 2BYCA 4RW6A 2E8CA 5J2MB