3L95X

Crystal structure of the human notch1 negative regulatory region (nrr) bound to the fab fragment of an antagonist antibody
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
230
Chain Sequence
b'GSACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGDVRGSIVYLEIDNRQCVSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-NRR1 fab fragment light chain
publication title Therapeutic antibody targeting of individual Notch receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 67
structure length 230
sequence length 233
chains with identical sequence Y
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00066 Notch LNR domain
X PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l95X02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3l95X01
4ZLPA 5CZVA 2OO4A 3ETOA 5CZXA 3L95X
chains in the Genus database with same CATH superfamily
3LAMA 1DJ0A 1OO0B 5H9FJ 3B7WA 3TAPA 2G4BA 4PUHA 4DV6C 1IKVA 3UX3A 2ZH3A 2R7UA 3OR2B 4LRAA 5A8KA 3IRXB 1V6HA 2DNPA 1IWGA 2J7UA 1JXVA 2CZVC 3CC4S 5F8LA 3DRPA 4UQTA 1S1XA 3DLKA 2O1PA 1WH9A 4FPIA 4LFAF 1KKHA 2LFVA 4I67A 3FMBA 2NXCA 4JI5J 3GU0A 1C2PA 4GC6A 3M1VB 4RW6B 1O51A 5F0UA 2HRUA 3EZOA 5BYRA 2X1GA 3TZZA 4OI0A 1KP6A 5A6WA 3RBDA 2MSSA 1HI1A 3IGVA 2MQLA 1FJEB 1QUPA 3ENWA 2HQIA 4DV3C 4ZP9A 3UD3P 1U09A 2BMBA 1IBMJ 1WELA 2WBMA 4DBQA 2IVYA 4K4SA 4DZDA 1RAFB 2OPLB 1RG9A 3TVYA 4ZCMA 1CSJA 4W90B 2DK2A 4NLSA 1TKDA 2ZH4A 3CJSA 3HT3A 4F67A 2YWKA 3B4MA 1QSYA 1IN0A 3E3XA 1XMBA 3EMTA 3KXDA 4WXOA 1M5KC 3DNCA 3ET6A 4X4RA 1SJ3P 4F25A 4UOCA 1BD6A 1IR2A 4WFYA 3D5MA 3IWXA 4RNNA 1IXKA 2J9EA 1RAGB 3C16B 5IZHA 1X9SA 2IRYA 4EU0A 4ED5A 4NCGB 3CMAS 2GIQA 2QFIA 1YJWS 3HKZD 3BGRA 3ZFVA 2E66A 3ZZZA 3IGNA 4GS5A 4DFJA 2CG4A 4WJBA 3NL0A 4CZCA 2XI3A 3I4PA 1MWQA 1TKZA 2FLOA 5AJ3J 1F5AA 3CW2C 3MM9A 1DLOB 1UJ4A 2J0SD 1BQMA 4LF2A 3RAXA 1JLAA 1F5CA 5KTQA 1KS2A 2DNOA 4L6V3 4LQ3A 4U8YA 4ZIVA 1MWZA 3DU6A 4DSIA 1T9YA 2Q66A 1WF2A 4PCQA 3TA0A 2NUUG 4CLTA 4DV3J 2EK6A 4X2BA 4K0KF 3QO9A 2VASA 2RU9A 3H5XA 5BXIA 3TJ8A 2ZFHA 4CNYA 3OPKA 1JLCB 4FDFA 3FCHA 1RT1B 3D3BJ 3NGRA 3H20A 1VJQA 4ECTA 1N32C 1U1MA 3OL9A 1WEYA 1GFWB 1QUVA 5U47A 4RWXA 5KEIA 3CCES 2PD1A 1WWHA 2Z57B 1U1NA 4YR2A 2GO8A 1KOHA 2QYGA 3FBBA 3ZNUA 2YX1A 2EFOA 4PXCA 4KAIA 4AL5A 2QYCA 2HEKA 1HQEB 2F3JA 2NS1B 3KMSA 1U1RA 5K20B 4KHPF 4KSEB 4NA2A 5BYQA 1RAAB 3RGIA 1YSJA 2PA3A 3PYEA 3EYZA 4PQUA 4FF1A 5KOWA 4WXWA 2C3OA 1CEZA 4G3IA 3MAAA 3IXQA 4ITSA 1IBLJ 4DSKA 3N2QA 4QIWD 4Q8FA 1WC5A 2J8AA 3C5EA 2FHJD 1UEKA 2WP0C 3ULHA 3W2WB 2XI2A 2W8KA 2EFQA 4ZKAA 4EEYA 2LEPA 4HHJA 3G4SS 1AXQA 1X0PA 4O4GB 4DX5A 1S0VA 1JJHA 1GMWD 4ID5A 4B9SA 1TQLA 1RISA 2V68A 3UR3C 1YX2A 2YWCA 5IWAC 2F4FA 3RAQA 4MFBA 4DQRA 4DQIA 3IG1B 3CJEA 4CM2A 4OX9C 2J6TA 1DZ5A 3WDOA 5KFVA 2FQQB 2RKIB 3A4IA 2BOPA 1LXJA 4DV4F 1FDNA 3CCLS 2P6TA 5F3TA 3N28A 3R2DJ 4F26A 2DHGA 2MZQA 1JX4A 5FDLA 1RLCL 3BS9A 5CD4A 1N32J 4NLVA 3PEJA 2VF3A 4WKRA 4PZVA 2VU5A 1YG0A 1V3ZA 4DR2C 2C2RA 2LDYA 5EGYA 3HHKA 3GTYX 5AT1B 7AT1B 1T5DX 2FGCA 1TK5A 3CIMA 2MQMA 2JLEA 3KJQB 1K0TA 4LUBA 4B3SJ 3UDVA 3I96A 1LQLA 4NMXA 4B3OA 4CLSA 3N01A 3OTBA 3U1NA 4LFCJ 4G36A 5L1LA 1HD1A 3KHLA 2DKOB 4OLOA 2YCBA 4J9VA 5GAEU 4CO4A 4C8YA 3A3PB 2CRLA 2A6OA 4RLFA 4KGKA 2AMCB 4LRCA 4DL3A 2HSEB 1H72C 1N34C 4KB7A 3S7RA 4OYBA 3K5NA 5L38A 3MECA 2D1QA 2AP6A 5IWAJ 5EWEA 2NYIA 3PRDA 2M3DA 3NOGA 4ZPBA 3DOKB 1SJ1A 3IR7B 2PC6A 2ZZNA 3W5ZA 1VQSA 4KH0B 2Q1LA 1BY9A 3VAKA 2UUAC 2I1RA 4JI4F 2M7SA 5HVFA 4RUBA 1F5BA 1S57A 4YHHC 3SSSA 4X4UA 5LSLA 3TW0A 4OYOA 2WD9A 3GG1A 2ZH1A 1WC6A 1URRA 4RW4B 2IMWP 4NMLA 1HNIB 4DFPA 2HRYA 1NJXA 4QR2A 5GAHI 4DR2J 1MROA 3OLAA 3DFEA 2PROA 2W1BA 3Q8VA 1VQOS 1FXRA 3VTIA 3KK1A 3GR1A 2QE5A 4OJ1A 5ETQA 3GFYA 2XCPA 4FUTA 2XGPA 3HVAA 1TL1B 2JFKA 1R31A 4J9UE 3NCRA 2P2CB 3T41A 4QWDA 3M2VB 3DU5A 1I5OB 2CFXA 1PC4A 1YJUA 3BBBA 3EGZA 4GXQA 4WF9Q 2ZBCA 1XNRJ 4HI1A 1FF2A 1BMQB 4CO3A 1N34J 2C28A 4OX8A 1HBNB 3MCMA 2BJOA 1T11A 5F8IA 1VBZA 3KUGA 2ZOMA 5B7WA 1D8ZA 2CDRB 4D4GA 1HWKA 3HZEA 3MF5A 3FCVA 1RA7A 4RKUC 4ZVGA 4DU7A 2LQBA 4E98A 2B8QA 4NZ6A 2UUAJ 1RKIA 2YKMA 1HNVB 4X64F 2GIFA 2GJFA 4YHHJ 4NEYA 1FRXA 3HMJG 3JAMD 4HVZA 5FIIA 2UVVA 3TI0A 1RUSA 2QLJB 1UKKA 1S1UB 3RBXA 4LBPA 1I94F 3GG0A 1BQNA 5HK4A 4YB1P 5DLFA 3HJVA 2Q6BA 1ZAVA 1VOMA 1C0UB 2OIHA 3WIUA 2AHOB 4PR6A 2KXFA 2AYAA 3DM2B 1BUXA 1S10A 2HQ3A 1VC6A 5KFYA 1RHMB 2R9LA 3QFWA 1A9NB 4KJIA 4JI8F 3HHNB 5DQHA 2X1BA 2OHDA 2E5LF 2HNZA 2N4CA 4C3MA 1IQTA 3D6HB 2MZJA 1FO1A 1N33F 1S59A 2CZ9A 4ZMMA 2UU9F 2OP5A 3RW6A 2OEKA 4RUCA 1D1UA 3TR3A 4QWAA 1S1TB 4X62F 3V6DB 2WB1D 4OZ3A 5F9LA 3R1HA 4KKOB 3FRZA 4Y2KA 4GKJC 2IA6A 3M30A 3RR7A 2FJXA 1XEZA 5I3UA 1T9WA 4XIUA 4PG6A 3JB9k 4I6WA 4GVLA 4ID8A 1VBYA 4C11B 3HP6A 2BJ8A 2UUCF 4DN9A 2MKSA 3HF5A 1FERA 3V6KA 1RACB 5KFOA 3IAM9 1RT6A 4M5DA 4ZVHA 4ZP7A 3N6NA 5JMNA 3PIOQ 3EGWB 4WS9A 4LMZA 4UW2A 1H3DA 4P10A 4A8FA 1VIXA 4OJ3A 3HSDA 2IRUA 1Q53A 2DT9A 3NYQA 2MEWA 2RUSA 5IQ6A 1RTIB 5GMDA 1S6OA 1MKYA 3A9UA 5D78A 3MD3A 4URQU 1APSA 1SL2A 2CJBA 1S1WA 1RA6A 3M8QA 5D3GA 5G0RA 2AZ3A 1YBTA 2RQKA 4IR1A 3T1AA 5KFIA 1U1OA 2WOMB 3V4IB 3AF6A 2M5YA 4CO2A 3G6ES 4FUQA 2OPRB 3MR3A 2DPIA 5DRKA 4ZPAA 2CNOB 4G1QB 3PR4A 2IFXA 3DLJA 2BQUA 1MW7A 3MEDA 3ZTSA 2DH9A 4LFAC 2L08A 1WF3A 1CQNA 2CPZA 4LF6C 5CH7B 4DU8A 2JC0A 1W7WA 4OHZA 5A2QD 1Z2ZA 2BKNA 2V5HG 1WDDA 4CH0S 5LJ5Y 3CO9A 2H4WB 4Y0FA 1XMQC 4FTFA 1PG4A 2QW0X 1T05A 1HARA 2V6AA 2ONFA 3G82A 1NYEA 4ISBA 4ZVOB 3CJTA 2D9OA 2EI5A 5JRHA 2OPPB 3PHTA 4QIVA 4QW9A 1ZBTA 3NGUA 4I9GA 2BE9B 3QAEA 3OR2A 1SCJB 2W4PA 3J7YI 4KGZB 3KHGA 3K0JA 4HTIA 3R3TA 5H9EK 4WK1A 2IA0A 3OXLA 2CNNB 1HR0J 3CQ2A 4CH1A 3IBCB 3PIPQ 5IM0A 2YY3A 3KLFB 4JI1C 1TL3A 4A8XA 2D3ZA 2NLWA 8RUCA 2VG5B 3B78A 5LSOA 2QMWA 2W4CA 3FZBA 3FBFA 3I4HX 1V5VA 5KFSA 2A0FB 2CZ4A 1F60B 3MM8B 3KTQA 3OT9A 2DYJA 1YTYA 2E8EA 2J0QD 1HIYA 4WIIA 4BSZA 3NGSA 3O3LA 1S4EA 1T8EA 3CDBA 5E3PA 2CJ9A 2CVEA 2IRXA 4OJHA 4P75A 4L73A 3HPOA 1GAOA 3CVKA 2CQCA 1NH8A 2OPLA 1CLFA 4H4MA 1Y10A 5F8GA 1JLFA 2CYYA 3UVJB 4L76A 1M0SA 3P5BP 5IS2A 3EVMA 2HWIA 4LFAJ 4KGXB 1Q8KA 1MXAA 2GX8A 2XTJP 3PJ9A 1RT3B 4CQ1A 2FUG9 3NGTA 3I32A 2LA6A 4DF4A 1IB8A 3IR6B 5C25B 3H4BA 2UP1A 1PCAA 1HWUA 3EGNA 1X60A 2CJAA 4WE1A 4UOGA 2KYZA 1VQYA 4IUFA 3CMQA 1SC3B 1BA3A 5ETTA 3DAYA 4ILMA 4GO5X 2MKYA 1TV6B 2BEFA 2Q6CA 4DCTA 5GADI 2CPDA 4DXLA 4P2XA 1S6UA 4TN2A 2HHXA 4EZ6A 1HHTP 2HVIA 4KIAA 1JNRB 3BBFA 2QEXS 1H98A 5DQGA 4Q44A 2DGTA 4O44B 2YKAA 3CF5Q 1OSCA 4HT7A 2EBGA 1VRUA 4H4OB 2R8KA 1QSSA 2MJNA 1RP5A 5CZXA 4BBYA 1ULTA 2IAJB 1LW2B 4HDHA 5EWFA 4P7VA 2OFHX 2EK1A 2DHMA 3KNGA 4DL2A 4S0MA 1U4BA 3AA8A 3D28A 2QMUB 2H9ZA 4HHUA 2NSBA 3TZXA 2LCWA 1R0AA 5L1JA 3P5TL 2F65A 4N5SA 4KHPC 1R27B 1OIAA 2G0CA 1L2FA 4DR1F 4ECUA 1R7IA 5KFWA 2AZ1A 2DNYA 5L9NA 2MMAB 3BN4A 1XK8A 5LSRA 4FKXA 2BE7D 1YJTA 2V2ZA 1JLCA 4Q0BB 2XHWA 1RT1A 3JSYA 1Z4UA 2KRRA 1GXLA 7FD1A 5LCIA 1RWKB 4YB7A 3JQMA 3GILA 2D69A 3I6PA 4NOHA 3WHIA 3MMAB 4U7CA 2NZ4A 2RH3A 2RMLA 4DSEA 3JSMB 1UVKA 4L75A 1WSRA 3E51A 3K59A 1ZM2A 3CWJA 4DL6A 1YK9A 4NLUA 1F1BB 3CSKA 2YNGB 3S6EA 2J7WA 4PG8A 2LU2A 4JYAC 3M8PB 2AJ0A 1JOSA 3MOJB 3FEYB 2O3DA 5I42B 5IC6B 5C24B 4UQGA 4F2RA 4K0KJ 2NPFA 2UUBF 4DV4C 4DOZA 4KBIA 3CEDA 4KFBB 3JTOA 2ADCA 5L9XA 4H4KC 1M90T 1HMVB 4I9FA 1BHNA 4WTOB 1WC0A 1BLUA 3QIDA 1KVIA 2DGVA 3A4TA 4F4WA 3JAMY 3U1MA 1X5PA 5B0BA 1ZPWX 2AJ4A 2RQ4A 2W2QP 3S82A 2KZZA 3JAMU 3DHWC 2B43A 1ZOTA 3G6YA 2DXDA 1JQGA 5KYTA 4OI4A 4DV2F 4KHPJ 3U7JA 3G8SA 1SUQA 4XDDA 2EBEA 2X1AA 4LF9F 1UAWA 5M2UA 3ZXWA 1UW4A 1RWPB 2RKIA 1RT5B 1V25A 1UFWA 3TP2A 3C46A 2DH8A 2IVMA 3OUYA 2NR0A 4V1Ak 2EXUA 4WIQA 4C0OC 4AXIA 3HK2A 2QSWA 1WKLA 4OYAA 2WVCA 3AOAA 2WAQD 1VQ7S 2W01A 4ECSA 5K85A 2ASBA 3CC7S 3M32A 1AUDA 1LK5A 2C2KB 3OFFA 2QFJA 4K4UA 1N5SA 4OHVA 3UQSA 4OYCA 2ROGA 3SXLA 4K4ZA 3HSJA 3CDUA 4B3MF 1T95A 4ECRA 2PDAA 5K9FA 2LXFA 1B64A 5J2NB 1IVZA 1MMLA 4Y65A 5LT5A 2B5JB 4DV4J 2ZC4A 2HHTA 2MY7A 2XEXA 2FTRA 2G2OA 3PKMA 1AB8A 3BBCA 1LNQA 1XBWA 1BE4A 3D2WA 1FUGA 3VAIA 4CLKA 3FJ2A 1S49A 1PKUA 3H8YA 5D4OA 2ZHBA 3LPYA 4X4OA 3CCZA 5DDPC 1IKXB 5HJXA 5K8FA 1SH0A 1HQUB 4WV3A 1C1BA 3L7UA 2DNQA 4CDIA 4NX9A 2QMXA 2KN4A 3AOCA 3Q22A 3D6TB 3T5LA 5HQLA 1LEOA 3CCSS 1Q95G 3DOKA 4I4BA 1VI7A 2KT3A 5L1IA 4KR0B 3JQKA 2RQCA 1SB6A 1USPB 4HYKA 1F9HA 4Q5VA 1CVJA 1Q8LA 4CT9A 1Y00A 2JEGA 1ICEB 4JI0F 4F3QA 3QRQA 2R7VA 4LF4F 2OMOA 4RW4A 4OZLA 3H7HB 1T3OA 4IO1A 4YOEA 1GK8A 2AJ2A 3NGDA 2B6AB 2KZMA 4AL7A 3OW2R 3W61A 1PSDA 2FIUA 4M8LA 2XC9A 1VLAA 2CVIA 3FC9A 3JSRA 4KYZA 4NRTA 1FCAA 2KB2A 4KTQA 4LRDA 4LBHA 3CCMS 3F44A 1IM4A 5D0EA 3Q8QB 1NZ8A 4NI2B 4PABA 3OLBA 3RV2A 3BKTA 4JI4J 4DR7C 4X64C 3M2VA 3G8TA 1TAUA 3SZ2A 4KRWA 1FK9A 2N4DA 1GXTA 2DXEA 2CKWA 4PRFA 4ED3A 3SDEA 3ZC4A 3GIRA 5HJYA 1MU2A 2V8GA 4Q2MA 5EHHA 1I94C 2MXYA 3Q8UA 4DR4C 2UV8G 1M6XA 2CY1A 4NA1A 1LW0B 3VAMA 3TVZA 3JS9A 3PFOA 3N54B 3MWBA 4ZCIA 1QVFR 4CI0B 1O8BA 4IZ6A 2ZKTA 1MMNA 2DB1A 3FSYA 3OHAA 1T9VA 3BDEA 1SJFA 5KFAA 5H9FK 2KI2A 3C6UB 3T6JA 2ADBA 4ICLB 4DUZF 4OHWA 4A8SA 2ERRA 1WEXA 1KRPA 5DM7Q 1HBUA 4KPCA 1OPZA 4JV5F 1S1UA 3QGHA 1JLQB 1TR0A 5HLFB 3THVA 1F6TA 3QT5A 1VK8A 2N7CA 3T1HF 2HW3A 1X4DA 2BE2A 3VGUA 4OYPA 4QIEA 5ETLA 1L3TA 3US5A 1GXUA 3L9ZA 4MT1A 2R2TA 1RADB 3FK4A 4CLZA 5C42B 3PV8A 1VLYA 4I2QB 1FRHA 2WONA 3GV5B 4DV1F 2A6MA 2UUCC 4DCPB 2K8GA 2KM8B 2DPJA 4X64J 4DMZA 1SJRA 1B7YB 2XYHB 4RW9A 4ZVTB 1Y7PA 2O66A 1FDAA 2Y1RI 5A0YB 1JB0C 2C2NA 4OHYA 5F8HA 2RUGA 3AOBA 1S1TA 1JKHB 5IT0A 1I94J 1WC3A 2MPUA 3V6DA 3GSIA 5KFBA 2N3LA 4RW8B 3DCAA 4KKOA 5HSPA 1KFDA 1NK0A 1SH3A 3T5HA 3HCXA 2HJGA 5ETRA 3D6MB 1RTJB 2ACYA 1U24A 1YVFA 3N9UC 3IPLA 4PWDA 4I0WA 1N8RT 3LWLA 2LQ9A 2FJDB 3MM6B 4JI8J 1L3SA 4DPOA 2E5LJ 3I0SA 1XWLA 3KLIA 1N5YB 3CJKB 2ALZA 3CULA 2VFSA 5D0GA 1P1TA 1N33J 1VS3A 3KG0A 3H5YA 1OMSA 1E6YA 2Y3YA 4URSA 2VQFC 5J2PB 2UU9J 1KD1T 2K06A 5ADZA 1KN6A 5KFMA 2D41A 2NPIA 2HYIB 1S12A 4X62J 2BJEA 2J0XA 1JJ4A 1ZTWA 4ZA1A 2MKIA 1RTIA 5KFTA 2WVFA 3CJ3A 1FRKA 3H0PA 1P6TA 2HK3A 5K14B 3M6VA 1TKTB 2YX7A 2ZH5A 3QRRA 3ETCA 2XM3A 1ZAXA 6AT1B 2VG7A 2HHSA 3GZ7A 2ZWOA 2ZKUA 1PAUB 3HZGA 2E1CA 4RUAA 1ZYQA 2N7YA 2KHCA 2UUCJ 1FRLA 4F02A 3M4XA 3PKYA 1TUWA 3V4MA 1KEKA 2LKZA 2IVFB 3GJSB 4C0BA 4WBFA 4EBCA 1J5EF 1IKWB 1RQ0A 2NSCA 4Z37A 5HAOA 4I7FB 2QVXX 3LP2B 1N0VC 1QAIA 2YNHA 1O90A 4NYOA 3BH6B 1FRIA 3BJYA 1XRCA 2XNRA 1F9EB 1A6LA 3U27A 3GKUA 2RRNA 3LP1B 2KL8A 3VAHA 4ZPWR 1DY3A 4ES3A 1TTHB 1TH5A 5ETOA 3VNSA 4WCEQ 1UA0A 1QSLA 5IT4A 2QZ8A 3DOLB 3LH2S 5KG4A 3CCQS 4ECVA 1MMDA 3AF5A 4USKA 3EPIA 3E01A 3GQCA 2DR9A 1Q8IA 1WHVA 2FJWA 3GFZA 3BQ1A 2BH1X 1WACA 2GHWA 3THTA 2HK2A 5D4NA 2BA9A 2DBBA 2NQPA 4Q45A 3LTOA 2W25A 3QNWB 4F0KA 2YQ1A 4QYZK 4CNZA 3DRPB 1XNQF 2P2JA 4J9KA 3KLFA 2IIHA 4B9VA 3DLKB 3BO4A 1GX6A 3BDPA 3DMJA 2B4UA 3BQ0A 4IFYA 4USUA 4OX7A 3MR6A 1PBAA 4IYQA 1GMUA 2VFTA 3MGJA 3MM8A 4X66F 3MFIA 1VR6A 2HBQB 3FSXA 2YQ0A 3IEUA 1SKRA 1DRZA 4R0EA 3O44A 1CG2A 3LGNA 1RABB 1WC1A 1EKSA 1XN9A 5IFMA 4ECYA 2YNIB 2AJ1A 2X3DA 1HKAA 4YFUA 2C3MA 2VONA 1WF0A 3W2VB 4QWCA 1YBUA 3GYNA 1RJJA 4DV6F 3TDEA 4LQ9A 5CABA 1AYEA 4ED1A 4A8YA 4J9PA 2JWNA 1ROFA 4YEAA 4ALZA 3M7VA 3SSQA 4TXSA 5C25A 2GS8A 1NK4A 2MSTA 5DZ6A 1ML8A 3CJ5A 2F63A 3FFIB 4EBEA 2K3IA 3BGFA 3ET6B 2O67A 4P6QA 1DTQB 2BKPA 2MCQA 3F0NA 3DRXA 4JUZA 2QLXA 1NHVA 4EYIB 4JI6C 1TV6A 3TNVA 3NS7B 3MM5B 4Y00A 3TQ1A 3LUSA 2ZC3A 3D7SB 1HH2P 5GMEA 4TKTA 2CQHA 4BCAA 4O44A 1KLNA 2BOAA 4WP9A 2GZOA 2AV5A 3FBEA 3BGRB 4PG4A 2V4JA 1GMVA 2JLFA 2H48B 3DXBA 3EE3A 3OL6A 4DZ6A 2Z2LA 4C9DA 3QT8A 4EBDA 3NP5A 2Y8WA 2B9EA 1Q79A 2Z51A 3CQ3A 1S9EB 1TKZB 4CO1A 1REGX 3HHLA 2I6WA 2Y1IA 1SL0A 3MM9B 1DQ8A 5KFKA 3CD6S 3HXMA 4NLYA 3R7SB 2D3O1 2G9OA 4B9TA 2IHR1 2KXNB 5BJRA 3NGKA 2DVIA 4C98A 4QWEA 1U0HA 5J1NA 4A46A 3N0VA 4OZ5A 3F56A 5KG5A 2FJVA 4B9UA 4Q0BA 2CJXB 2IM2A 2F8EX 4RW7A 3D0HE 3MMAA 1RHJB 1SXLA 2GAHC 1FTCA 5KG2A 2IDLA 2ZITA 1UW9A 1NHUA 1XR6A 2DY9A 3X1LB 3EXCX 4N41A 3K5OA 3UCZP 3AQPA 3PDNA 4OJGA 1S77D 1E6VA 3EXYA 4DV2C 2IM0A 1F2GA 1X31C 2G2ZA 1KQSR 2R2UA 5BUSA 3TQIA 4DR1J 5I42A 1UCNA 2CQ2A 5KFGA 5HVGA 2GC8A 2HQDA 3ENVA 4F3OA 4PQUB 1NCLA 1V3SA 1R6VA 2HZVA 1UJ6A 1ZM9A 3MAAB 1YZ7A 1Y5NB 1N36C 2E1AA 2ZH2A 1S0MA 3KK2A 3GJQB 4X4NA 4RX6A 1FJCA 1AFIA 4IR9A 5H1SV 2OJ3A 3WBZA 3K2YA 1FD2A 1HI0P 4AYBD 4FF3A 2V0NA 4RLEA 5I4MA 3R5DA 3X3UA 1NAQA 1XHJA 2VB6A 3LQVA 3R2CJ 3VAFA 4ID5B 1DTTB 2X51A 3Q24A 2ZHAA 5M2PA 3CCUS 2KFZA 2C1EB 1ZB8A 1NB7A 1WOOA 2BW7A 1SQGA 2KT5A 4JI3F 5T14A 2O01C 1NU4A 2UUBJ 4HTJA 3HX9A 4OZ1A 3MURP 4C7QA 3B8HA 3IAS9 3EZ5A 2FJAB 2V67A 3KK3A 3K17A 3VHQA 1YGYA 4CO0A 4MKAA 2H5IB 5KOXA 2BYCA 5HP1B 4OYXA 2EC0A 3BM7A 5CYMB 5FDLB 2KH9A 4ZCKA 3DGPB 1HNZF 1VBXA 4UT4A 3V81A 3EZUA 2V9WA 3UOWA 5E41A 2D27A 4WPAA 2YQ3A 2XO6A 4CM0A 3D67A 2ZJRQ 5DGAA 5IOLA 1U8SA 3ICLA 4DV2J 3MMJA 5K5MA 4NE9C 2YWBA 4LF9J 1RAEB 4F8RA 5DLGA 1DURA 4OX9F 3OXFA 2B5JA 2VDHA 1SBRA 2BANB 5DJBA 2CXCA 4M63A 3BYRA 4DEZA 1ZZFA 4HLBA 4GKKC 4P9SA 2UUTA 1XRBA 5G4DA 3VVUA 4JI0C 3KKFA 2I8EA 2W4DA 1SV5A 4LF4C 4PG5A 2ASJA 4O0NA 1ZA2B 3QGIA 3ETOA 2HAFA 3MEKA 3W3SA 4FN5A 3K57A 1PIEA 1AMUA 2ZNZA 1JLEB 1UWDA 1HQUA 2JEJA 2FHKA 3DXSX 2DIUA 3QZ8A 4GVBA 1H2UX 3MECB 4B3MJ 1UPMB 1U26A 2PMWA 4GC7A 3VVTA 2BV3A 4K8RA 5BSVA 2BJ9A 4UOFA 4ES1A 4F7VA 2EVZA 1RXOB 5E7OB 4ZDNA 1GPMA 4FYWB 1D8YA 4KE5A 1RT4B 3VAGA 3AA9A 4MTNA 1S1VA 1RGVA 3R44A 5IFIA 3GMGA 5KFJA 2BUNA 2EEYA 3UZ0A 3OR1B 3NS6A 1VCTA 2E44A 1GT8A 2P5VA 3J80D 2E5IA 4LIRA 2D3OR 3BPSP 2HS0A 3O2EA 3UDCA 2V2KA 1MROB 1SC6A 2C2OB 4J9MA 1MNEA 4JB8B 3IS9A 3THPA 2BKOA 3BR9A 4XPCA 2HAIA 2FB0A 4B3RF 2F5GA 4WU3A 2XLIA 1UPPA 4J91A 4NI2A 1HW8A 2K1RB 4TY8A 2MQOA 4DUZC 3NKYA 1WI8A 3R6LB 1NK6A 3OVAA 3QJPA 4TPSB 4JI0J 2FHJA 4LF4J 5D8HB 4K5RA 3H4DA 5KYVA 4FYYB 2RE1A 4JV5C 3QWPA 4U9RA 1XMOF 1K47A 2PMHA 1SIZA 4U95A 3PESA 2VH7A 2DNMA 2V94A 3T1HC 2CQBA 1LW0A 1Q86T 3L09A 2J9CA 3MCNA 2CUYA 1F0XA 1NPRA 5HROA 2W7PA 2W9CB 1GMWA 4EK2A 1UVMA 1PYOB 2EFNA 3EVOA 4FF4A 5IV4A 5CHCB 4USJC 1PO6A 4RBVA 3TUIC 1H0HB 4K0BA 3IWLA 3MPDA 5I3PA 3C6UA 1U47A 5F8JA 1QM4A 1T0TV 4CP5A 4EMDA 1HW9A 3LF0A 2YKMB 1B0VA 3OSPA 1OQ6A 2JEIA 5J2QB 3QMQA 4FYDA 2B9XA 1JLQA 5HLFA 3A8KA 4YMEA 1FFGB 4X4QA 2IY5B 2F9JA 3BB5A 4RM3A 2V69A 3O1LA 1BQNB 5F3ZA 4DWIA 1TZ0A 2XY6A 2WK4A 3L7OA 2VIHA 5ETNA 3PX6A 2MQNA 1HNXC 2YWFA 3T9ZA 2ZUAA 3ISZA 2E7VA 4I2QA 2XWXA 5LL6d 1LWFA 4EO8A 1S7IA 1RU2A 2FGOA 3CB4A 3O5TB 1PU1A 3IMQJ 3A1YG 1FNXH 1YQHA 2Q79A 4DUZJ 3GIJA 3TA2A 1R43A 3CJ0A 4CT8A 3OBIA 3NCQA 5A0YA 1FRJA 2VC0A 2IDEA 2HVZA 1M6XC 4ELVA 4B3TF 4MKVA 3T1HJ 4Y2CA 5L8RC 3GV8B 4ZN3A 4DUYC 4FVMA 1L3UA 4DLGA 4CTAA 4ES2A 5GAGI 1RBAA 3LAXA 4K59A 3M30B 1WCJA 2UXDF 3UD4P 1NXIA 4X4VA 1D9AA 4XO0A 4XX2A 4NLWA 4WKYA 4DV1J 3UCUP 3MM6A 4OI3A 2NYHA 3LA0A 4OYIA 1N5YA 3RZAA 3CJKA 3DHXA 2H65B 4M94A 4NLRA 1UFKA 2Q3PA 3ITHB 2LDIA 5J2PA 1RT6B 3SEOA 4RU2A 5L39A 1RDRA 5LJ3Y 2GA7A 5HL7Q 5LXRA 4ZIWA 1RB0A 4O3OA 1P4EA 2HFSA 1RWNB 2QL5B 4ZP8A 5C2GA 1KDNA 3HHLD 4GXRA 2RIJA 1U02A 1TKTA 2NXNA 2XGQA 3CW9A 2GO9A 5DM6Q 1EP4B 4GKJF 3D4JA 1X9WA 1NEEA 1VDHA 3KLHA 2WVEA 4PYAA 1S1WB 3ILLA 2MZRA 4W4MA 3C15A 2K3KA 5G0RB 4UF4A 4L3NA 3GPAA 2OELA 4H54A 5FD1A 2WVDA 3CCWA 4I56A 2AT1B 1V26A 1QD1A 1IKWA 1S79A 1IQZA 1JJ2R 2D7SA 4I7FA 4I69A 2DTJA 5KFFA 4F2SA 2ZD1B 3CJQA 2UVRA 4PXEA 4ENOA 2JSXA 2ZE2B 3MEDB 4FPRA 3MAQA 3W8PA 3KDOA 3A3NB 4ED8A 3F73A 2DJWA 4G37A 2QA2A 1NLKL 3VR1A 4X66C 3WC0A 1U6FA 2AYEA 2J0WA 2XSFA 1XS3A 1UP1A 3DGVA 3M8ZA 3UW1A 2E5HA 3G82B 1VQ5S 2CPIA 4IRCA 3SYZA 1J5EJ 3Q8PB 3OL8A 3DLGB 5KAKA 4ZJQA 3AD9C 2R7WA 1TFYA 4Y34A 3I08A 2EFPA 4OZNA 5HMWA 2HZCA 3FMWA 2DGOA 4F4AA 5IM0B 2BQRA 5CYQB 1TL3B 2EKNA 5E2QA 4LF6F 5KFEA 4FS2A 5K8PA 4LR9A 2UV8A 3RAMA 1SVDA 2P02A 3ONQA 2AJFE 2ZOFA 1XMQF 1RYRA 4O3RA 2NZCA 4IKAA 1U2CA 4WWSA 1N6QB 2YNIA 1VQMS 2HFVA 2XR1A 3W2VA 2DISA 2P20A 4ANEA 3P45B 1VIOA 4Y2AA 1X7VA 3HDSA 3FEXB 4H4MB 9RUBA 1JLFB 1R8PA 4JI7C 1EQ0A 3QT6A 3LUYA 4ECQA 3E8OA 1XNQJ 4DR6F 4MJKA 2C3UA 4DCUA 4JI1F 5E0OA 3DRRB 2DNRA 2LYVA 3FFIA 3SI8A 5KG0A 2ZH9A 1HI8A 1OPIA 2F7VA 1YJNS 3D0GE 1DTQA 4X66J 4WE1B 3MM5A 3Q2SC 3GIKA 3J81j 1UKUA 2KZFA 3R6GB 4L2ZA 4IDKA 5KG1A 2OI2A 1DHMA 1SC4B 5KFQA 4ZHRA 4P74A 4DV6J 2CPHA 2JFDA 4JV2A 2W9BB 1IR0A 2OH2A 3KYLA 2IJFA 3A12A 3R5GA 1VRUB 3MM7B 2PN6A 4F0MA 3FRYA 2ABYA 1S9EA 3OFHA 2B0GA 1Q0NA 4PUGA 3J80Y 5THWA 4OLPA 4DG1B 3R7NB 2ALYB 1RKJA 2CJQA 3J80U 1X0FA 3OHBA 1J5OB 4NRUA 1IR1A 1R0AB 4KHMA 2G1DA 2HFNA 2AF6A 3DHVA 2VQEC 1V9OA 2GHPA 1AROP 3QYYA 3ADAC 5JUMA 4QR1A 2MYFA 2XWYA 4YP3A 4DSJA 4MKYA 1OYEA 4LF8C 5KFCA 2OLWA 5CCMA 2FC9A 1CJKA 5IT9Y 1Y5LB 1UETA 2G0IA 2FVPA 2XLKA 1VQ8S 2Z0GA 5IT9U 2G0JA 1B4SA 1Y0HA 5BUQA 5B0FA 4O3PA 1LKZA 3DLBA 4HEA9 4NYZA 2BR0A 4ZJZA 4DPUA 4JI3C 4NLTA 4DV5F 5F8MA 4YB6A 3W60A 3HFVA 2LECA 5BURA 2HVDA 4A4JA 3CTRA 4I6YA 1NMEB 4L4QA 3VCDA 2CJKA 1NKBA 2R7OA 5C2CA 2LMIA 1HNZC 2J6UA 2FDNA 2WSCC 4P73A 4K4XA 4R5PA 3N6MA 2KZ0A 4TLQA 4TU7A 4NXNC 2YH1A 5LMNC 1VLOA 2XYGB 1DTTA 3FEZA 1OWXA 2GCFA 4A8KA 3D54A 4NPOA 2M70A 5KT2A 3RBZA 3P8BB 4URGA 1HBOB 1ZS6A 4JYAF 2VA3A 2B9YA 1SUQB 1RAJA 3AH6A 3WQPA 1FWLA 4CCHA 4RUHA 2CPJA 2Z8QA 5HI7A 3M8SA 1HBMB 2BACA 2L9WA 3OUYB 4ZCLA 3I9ZA 5HP1A 5CYMA 1X4BA 2HGLA 1MDFA 3DGPA 3QPIA 2G1HA 5SUHA 4Y3CA 4JV1A 1WG4A 2M9KA 2QLWA 2MKCA 4UY8T 5CA5A 4YR3A 2ZJQQ 1FKOB 1ZM3A 1PJ6A 3M32B 4RBUA 1N88A 4A48A 3J81U 2HMIA 3RW7A 2D9PA 4DL7A 3W7BA 4DI6A 4JI3J 2P6SA 2FVCA 2BANA 2JZ5A 2RRAA 2PGCA 2HG4A 1TL5A 3BPDA 1S0NA 1K73T 3RR8A 1S6QA 3PNIA 3UDLA 4WFAQ 1WUUA 3SBMA 5D77A 5MAOA 2I5JB 1W26A 3HLUA 4YR0A 1WOPA 2RNEA 1HNZJ 1X5OA 2CQ4A 3NWRA 1JLEA 2RD5C 2OPQB 3NAIA 2XNQA 3CCTA 3D68A 1I6JA 4DV7F 1IBCB 5A8WB 3I0RA 2FZGB 3G9CA 1C1BB 4KH1B 1VQ4S 2IBOA 4J9RA 2AX1A 2YNFA 5DETA 4B3RC 2HBZB 1CQMA 5BSUA 2C2EA 2MZSA 3D66A 2DNLA 4OX9J 3J7ZT 4FYVB 2V63A 1FI4A 4PWWA 1RT4A 1Y11A 1TELA 2QV6A 1FT8A 2QA1A 4IH6A 2H1YA 2HHVA 2BZ2A 1U8WA 3HD2A 1EZZB 1NH7A 2VG6A 2R8GA 3BKUA 3BGOP 3OR1A 2A18A 1GNKA 1XMOC 3R9WA 3EPGA 4IG0B 2DITA 1CJVA 1FJGC 3TRGA 3HVWA 2KFYA 2QL9B 2JLGA 4R1LA 4LFCF 3AODA 2FHMA 5KT4A 2AYMA 4RNHA 3PO5A 2F9DA 3Q23A 1WHXA 2VJVA 3GIMA 4TU8A 1JLBB 2VOOA 2MTLA 5C5JA 2HS3A 3T1YF 1UFLA 1NUEA 4A8WA 3KJFB 2K1RA 1C4CA 4DPXA 4MKBA 2GAGC 1AT1B 4B9NA 3KNAA 4IOCQ 3AB4B 4WP8A 4MMOA 4OIXA 1FK9B 2GQ2A 2R3VA 3SDEB 2DNHA 1LFPA 4DG9A 1MU2B 2Y1JA 4Y6IA 5EX3A 1IUJA 3P49B 5B0AA 2P9CA 2CU6A 4AXJA 2M5OA 1Y4ZB 1CC7A 5DDQC 2W9CA 4R0MA 1KQGB 2JVRA 2I9SA 4P71A 1B0TA 4ZPDA 3I82A 5HBMA 4PROC 1KKGA 5FLXU 2WSFC 2CQ1A 4EO6A 4B3RJ 3ILJA 3Q8YA 2EFVA 4RBTA 2GVZB 4P2SA 3GR0A 4WFXA 3PROC 3KLVA 4OYWA 5KFHA 2MY8A 1RTZA 1N0UA 2EGTA 2KTQA 1IJEB 5DGBA 2K2PA 2HFOA 3K8WA 3H42A 1Y9OA 1NDKA 4F4XA 1TVRB 4DR7F 4PXBA 4C48A 5KFUA 2MGZB 1KOOA 2OTJS 1DAXA 2XBPA 5J2QA 4F4KA 1XMOJ 3MTKA 1HBUB 3T5JA 4K4YA 3M6XA 4B3TC 1HHQA 2Y27A 4JI2C 3SFGA 4DR4F 2P2MA 2BE2B 1YJRA 4J9NA 3NY0A 3E7XA 4RMNA 1U45A 3KMQA 1SQFA 3GYGA 3BO3A 2QL8A 2UXDC 4P52A 1AZSB 3PX4A 4ZLLA 3DOMA 2MHEA 2AGQA 1EX8A 2KG1A 2RDDA 2WONB 2IPOB 2PT0A 1F2HA 3DRSA 2E29A 1VRQC 1G7CB 3GJTB 1HPZA 2HLUA 3CD5A 1FX2A 1G2EA 4U8VA 4RW9B 3BSOA 3SCKE 2AKWB 1U6BA 3V2UC 3VQSA 1B7FA 1GQEA 5GTDA 3AXKA 2F4VF 4N47A 2DRBA 4M95A 1NK9A 1RWXB 1VHFA 4AQYC 1N5QA 3C8YA 4C8NA 4Q8EA 2DGQA 1MLAA 2QT7A 1SQEA 3HT0A 2CPXA 2Z58B 1RAOA 3W9HA 4PWDB 3K5PA 5A1IA 2P8IA 3ITHA 3I0SB 3QSIA 3A13A 3KLIB 5L1KA 2HHWA 5K8MA 2C22A 3MD1A 4WU2A 3TYTA 1GTEA 4PYDA 1E6YB 2XSJA 5HMYA 3UWTA 4DDFA 1NK7A 5AE3A 4B3TJ 3PY8A 5EX0A 4ZOSA 2MQ8A 2OTLS 3UE2A 2P2QA 3VGSA 4RVNA 2B9WA 2GMHA 1EP4A 1RT7A 4CLPA 2ZH6A 1FKPB 5D0RA 4DLEA 1GH8A 2UXDJ 1V60A 2LXIA 4C8MA 5KT5A 2KM8C 1D09B 2XHCA 1KFSA 2ACMA 5GVQA 2ATLA 1RK8A 2VG7B 4K4WA 2XYPB 1SI9A 3BEGB 1VHIA 3OFGA 2XS5A 4O3SA 2XG8A 1M5OC 3CIZA 2C42A 3R1LA 2VQFF 1X8DA 3C6TB 4NLDA 3ZZRA 2ZD1A 2W2OP 4R0JA 3H5UA 5DO2A 2ZE2A 3W9IA 1XIQA 3GFHA 2YNHB 2XULA 5B0EA 2XMVA 3DLEA 4LSNB 3V6HA 3IRWP 2QN6B 3UNYA 1YDLA 4GKJJ 2HLTA 2D1TA 4QPTA 3LNVA 4PUOA 1HQ2A 3ILOA 3B54A 3L4BC 2CAJA 3UNGC 1VQ9S 2CQPA 2YKOA 2L9DA 4AT1B 2OO4A 2EG2A 3D3CJ 1TL7A 3E01B 2DR5A 2B7CB 2H4YB 2MB0B 1T02A 2MLZA 4ZVRB 4D3HA 4EUVA 1RU1A 2C2ZB 3DLGA 1P4EC 1U7LA 3IFEA 2L41A 3ENAA 4LVOP 1NZAA 1FD8A 2ZEJA 1OS5A 1KBRA 4DR6C 2E8FA 1RTHA 3HHDA 3G6VA 5CYQA 5ITHA 2VPWB 3PTWA 3DMJB 4OL8A 2ZM6F 3PYDA 2BJ1A 3E7WA 3P4UB 4IFYB 4HACB 2R8HA 4FS1A 4U67Q 3LNOA 5BSMA 2NCKL 3FQLA 3MCOA 4M5GA 2VZ9A 1N6QA 2FC8A 4TQRA 2M0GB 2SXLA 4DJBA 4R1MA 2HHUA 5DV9A 3BQ2A 3NRBA 4DQQA 4UZBA 1EETB 3BKFA 3LGXA 3IR5B 4M5HA 3DRRA 4LF6J 3IEVA 2HNDB 3KLEB 3NS5A 5KFPA 2GJ2A 2KXHA 3AAWB 4J37A 1XMQJ 4L72B 4OV6A 3PW2A 4I1TA 3KG4A 2YWGA 1U48A 2X3GA 1VC5A 3PFEA 4DX7A 4BDPA 3A8JA 6FDRA 2RAQA 5HQ8A 4NZ7A 2FHOB 3V5RA 2KHDA 2W9BA 4AD6A 1C1CA 4V19J 1N5VA 4OI2A 2V4JB 3MM7A 4A47A 2ZOGA 3UD5A 4P72A 2Z2ZA 4MIAA 4OFZA 4DR6J 5E7QA 1HWLA 1TK0A 2ZZMA 3T19A 4DG1A 5DDOC 3PW5A 4JI1J 5CYJA 3HHLB 4DCSA 3JQJA 4FVCA 4D4IA 4LSLB 2OMLA 1J5OA 2DGUA 1RBLA 4WFBQ 4RR5A 2ZBPA 4YDDB 2B4VA 4LREA 4JI6F 4DV5C 3A8EA 4RWWA 2H3EB 5BR8F 3DLLQ 2RVJA 4USWA 3PACA 1U0HB 1U1LA 3FUYA 3NCPA 4KT0C 2F40A 2LQ5A 5T8TA 2J8SA 3DLPX 1JJCB 5LOQA 2QJ3A 4HKQA 4RW7B 1NO8A 4ECWA 1J27A 1PC5A 5ETVA 4G65A 5F41A 4TYBA 4J5OA 1H7XA 2NXJA 2QLFB 4PUIA 3TARA 1Y5IB 2OBVA 3DLHA 4YQWA 1S72S 4M5LA 3MEGA 1FVSA 1FDBA 3M2UB 1L3VA 1MN7A 1E6VB 4KY3A 4XK8C 3T5KA 2RF2A 4ED6A 1TL4A 3QJLA 3IO1A 2GVDB 1UZHA 4LF5F 3GB0A 1A0OB 4WYLA 2VPYB 1N4LA 2VODA 1AW0A 4ANDA 4K7QA 4NLQA 2BVZA 3KK2B 4NYPA 2AGOA 1KVJA 1I3OB 4RPFA 4ATNA 4X4PA 4KO0B 1IBLC 2VKRA 2APOA 4ZLNA 2MMYA 1N2FA 3RB6A 2FJEB 2WB4A 2E5JA 3H25A 2VD3A 4H4KA 2IMOA 4HR2A 4C3LA 5SZTA 1YJ7A 5D0HA 1WI6A 3K5LA 1REVB 5F9NA 1HBOA 1KLMB 3MPVA 3LOUA 4DV5J 5B0GA 3TANA 4MIBA 1U6ZA 4G1PA 3FVYA 4ZVUB 2RHSB 1T9UA 4QZVB 1HBMA 1EQMA 4WYWA 1NSKL 3RYLA 3NNHA 5F8NA 2CJYB 2EW9A 1K0VA 2CNLB 2PFDA 3KK3B 4FZVA 3K7RA 4ED4A 1N36F 2HHHF 3JTNA 3SSRA 2UXCF 2RS8A 5DG8A 1SKUB 2PI5A 1PILA 4B17A 3K8VA 1X5TA 1K9MT 2KRBA 2L48A 3L3CA 3V81B 4FP9A 1FKOA 1EB0A 4DV7C 1YIJS 2QLBB 2Z4PA 2L3MA 4UTGA 2QIFA 4O3NA 1WF1A 3LGMA 1KQKA 4EI2A 4HH1A 3MCSA 4JYAJ 2YKNB 2GFFA 5KG7A 1T7PA 3CCRS 5LMUF 1W2IA 5KFXA 3EWGA 3HJFA 2LLZA 2DCLA 1WOSA 2ZBIA 4WZMA 3POTB 2W8LA 4TYAA 3H59A 5RUBA 3EDRB 2HNYA 3LP0A 5J2MA 3IA0A 3RU0A 1ZTTA 3TEHB 1UZDA 2I5JA 5GAHU 4DV0F 4B3SC 1ELOA 4WFNQ 1SV5B 2GGPA 3BSAA 1T03B 2POKA 2DPLA 3OQ2A 3TAMB 2OPQA 4LFCC 3G7SA 2UXBF 4FYXB 2D28C 1VC0A 4DR5F 5A8WA 1S7HA 3K5MA 1FWPA 3NG8A 3M8YA 4GVBB 2FVQA 2W7OA 1S9GA 1X4GA 5J1PA 3NEKA 2Y0SD 1H73A 2E9TA 3T1YC 2D3UA 4QYZJ 4B9LA 4MK9A 1H7WA 2RQMA 1Z1ZA 3R9LA 1Q5YA 3HO1A 1TMJA 1PJ5A 5T41A 1O0PA 2RRBA 4OXIA 1NBEB 4GKKF 1S1VB 4B02A 4Z7CA 4DX6A 2F1FA 4R8UB 4IG0A 4DX8H 3SQOP 2QTWA 4DSLA 3C66A 5A76A 4N8OA 5D4LA 5DG7A 4DV7J 1OJ4A 3M2RA 3JYTA 2LVWA 3ZTRA 1C4AA 3PYGA 4HH0A 2ASYA 5B0DA 4J9OA 4K2JA 1UEUA 2AEJA 4ZITA 2HFUA 3IS9B 1JLBA 2G13A 2BABA 2VPZB 2FY1A 4F04B 1GX5A 3FCCA 4DF8A 2BM1A 3LPEA 2CA9A 3RG6A 2HHPA 4F50A 4WFZA 1U0SA 4TY8B 1VQPS 1KTQA 4QBUA 3L8CA 2K7KA 3IBFB 2YBVA 2KG0A 2DHHA 2HQFA 4W92B 1VQLS 4EYHB 2A3JA 5T7LB 4TVAB 2QA4G 5CQGA 4M5IA 4Z2XA 4N7TA 2X7IA 3RB3A 3T6BA 1RSCA 3PBKA 5HROB 4K5SA 3QIPA 2HPUA 4LFBF 1XNRC 1TKXB 1CBKA 2J9DE 2GVZA 1L5UA 3H40A 3T1YJ 1TFWA 4LRFA 2GW8A 2QGFB 3M6UA 3NNAA 2JNVA 4LR8A 4AUKA 3G96A 2E5GA 3GONA 2PE8A 1TVRA 1RHQB 1WKJA 3FNNA 3S1TA 3DRYA 2MGZA 2KYXA 1NSQA 2J7KA 4ELUA 1MSWD 1VQ6S 3MEEA 1YHQS 4PG7A 3H2LA 1JNZB 1WKKA 4WTYA 2OD4A 1R8CA 2F4VC 2C3YA 5EN1A 3C19A 2GHVC 3Q0AA 1UL3A 1FESA 5B08A 6FD1A 5M2RA 1LQ9A 3QZ7A 1AZSA 4QW8A 4DPTA 2QG9B 3QRPA 4NWBA 5CAAA 4CO5A 1LWFB 3R27A 3DYAA 2MM9A 2M52A 4ZPTR 4NOZA 3GSDA 1VGYA 3HSGA 2WTFA 3SMZA 3AD7C 4DR7J 4U6PA 1KC8T 3MFHA 4YB5A 3GFXA 1CS4B 4DPWA 2AGPA 1D3WA 5ETPA 3UCGA 3CMES 1M1HA 5HN0A 4DR4J 1SKWA 2CG8A 1ACMB 1RWOB 3MZIA 1UEVA 1D9FA 3B82A 1W25A 3HFZB 1XQIA 2DEJA 4O3QA 4CTAB 2WCXA 5IXUA 1HNXF 3IM8A 1CJUA 5CXTA 3BREA 1P7LA 2LQJA 2FPHX 1FEHA 2DHSA 3MDFA 2DRAA 2VBYA 2RT3A 5J1EA 1X9MA 3MPYA 1PAEX 1RLDA 3CE8A 2JOQA 4KTVA 1X5SA 2RSQA 4B08A 4PPDA 5L46A 2F4VJ 1S6PA 4A8OA 3OTOF 4DUYF 2G2YA 3OTEA 4J7CA 4BHQA 2W9AA 1FKPA 3G87A 4CYUA 3OJUA 4AFFA 1FKAF 4LR7A 3EM1A 2GJIA 4JBCA 2XY5A 3UI3A 4K4TA 3S8SA 5HO4A 1R89A 3KLHB 2XCAA 1ZAWA 4X4TA 3C15B 1R8BA 4KHRA 3J7YU 4UZCA 1CC8A 1WNEA 3PW4A 2HBRB 4YS2A 2MLXA 4FNIA 3C6TA 3Q2TC 3PXGa 2FY8A 1TAQA 4IH7A 2ATCB 3SCLE 1XJWB 3DDIA 2C3PA 2IYIA 5HVHA 3MAHA 5EWGA 3OVSA 4JP8A 1JMTA 4LSNA 2IJRA 1RAHB 1N52B 4NLGA 2ZM6C 1NJYA 4NASA 1LOUA 3CCJS 1IBKF 5D4PA 1YITS 5C7PA 3MMCA 3BGUA 4JOUA 4MIWA 3IM9A 2VBXA 3M8RA 5JXSA 4CLFA 3NI2A 4RZRA 1YI2S 4ZP6A 3NBPA 2YH0A 4R25A 2O5DA 3RRKA 3V6JA 1G6BA 4QYRA 2VQFJ 1MDBA 1NJIT 3KFWX 3DI6A 1T9XA 2V8HA 2NXUA 3MR5A 1FRMA 2WBRA 3IBWA 4TY9A 3ZZOA 5CD4H 1PYSB 4U7UD 4LE5A 2VC1A 3W66A 2ASLA 3HSZA 5FJ4A 3OVBA 5GADU 1VK3A 2CQGA 4ZS6A 4HACA 1X4HA 1HR0C 2R2SA 4KV8B 1U2FA 3W8GA 3BZQA 3RB4A 1T5HX 4PHTA 2PO4A 2XMWA 3C2PA 2I38A 4B9MA 1RCOB 1SJQA 2V7BA 3QLHA 4OQJA 2R8IA 2OSQA 3Q86A 1RWVB 1HL6A 2A1BA 4CIOA 2AD9A 1Z2LA 1EETA 3HVTA 1BC6A 4U5YD 1NDCA 4DL5A 2IC3A 2DR6A 3D1QA 4DCJB 3BSCA 2HNDA 4O23A 3KLEA 2ZM6J 1N54B 4PWUA 5JVHQ 1ZA1B 3BGLA 4DL0C 3C14A 3QQCD 2Y0BB 2EPIA 1RY2A 2RDJA 4FXWA 2BRKA 2LP4A 5BR8C 2PFFB 1HNWF 4OV1A 4TQSA 2NREA 3AJ1A 3QJJA 1NNDA 4ZK7M 1WSVA 4LSZB 4NCBA 1FNOA 1Q82T 2HURA 4IDKB 1FE0A 3EUNA 2OEMA 2YWWA 4ZHRB 1LK7A 5KFRA 1TK8A 1K8AT 4JI7F 3A3OB 1FFWB 3ILIA 4ECXA 3D0IE 1PGZA 4AE5A 2DIVA 3PRBA 2KO1A 3KUEA 4M5KA 1HYSB 5T8SA 2EKYA 3ZZUA 3NXZA 2OFGX 3SV3A 3IRXA 4LSLA 1UWAA 2AX0A 2V4QA 2DH7A 1MXCA 1S99A 3RRHA 5CCLA 1LWEB 2QVYX 1M5SA 1YKWA 7FDRA 3PZPA 4A8QA 2AIRB 3HI9A 4LF5C 4U96A 4DFKA 4N77A 3M1VA 3CDWA 3Q8RB 2EG1A 4DFMA 3H2UB 4RW6A 4RNFA 2ZDOA 5LM7E 4KPYA 2BQ3A 1SL1A 4LVNP 4IR7A 1P1LA 3W63A 4Q43A 2RU3A 1CJKB 2PI4A 4PAAA 4RU9A 3MI7X 4DL4A 3BV8A 3I9V9 2XY7A 2V50A 1KWMA 1IJFB 2XS2A 1YRXA 3M2UA 2RS2A 2VOPA 2JEFA 2CWKA 3CT9A 2GQCA 4FBTA 4JI6J 5BR8J 2GVDA 3WX4A 3PRVA 2ZJPQ 3FDSA 1IWAA 5KFZA 2AYBA 1EIYB 4USVA 4JV0A 1EGAA 2VQEF 1QE1B 4LRBA 1G1XA 3AB2B 4DQSA 4C3KA 2HHHC 3C16A 3ISNC 2UXCC 1NK5A 4LF8F 4DS5A 4J90A 3KG1A 2LXUA 4RO0A 2FLPA 4NCGA 2XMTA 4K0KC 2AWZA 4R5PB 4KO0A 1MD9A 4E0DA 3R97A 4CRJA 2B56A 4MH4A 1WORA 2WRMA 1TUVA 3M05A 1O6XA 2KFNA 1REVA 2M2BA 1KLMA 1S4FA 4NXMF 3K58A 2VUGA 1U2RA 5LMUC 1EKRA 3VF0B 4DPYA 2B7BB 4Q7AA 1DLOA 4LF5J 4HHHA 2Z56B 5AXMA 1X4FA 2H5JB 3M9MB 2GQQA 4M5NA 1LWXA 1SPBP 3BSNA 4TU9A 3PJWA 2YKQA 3SFUA 3H90A 3C3LA 1G3OA 3N4WA 4DUTA 1X4AA 5A1GA 3R7BB 2MQPA 2WW4A 5B09A 4DV0C 4QQBA 9ATCB 2CQ3A 1LWCB 1VBKA 1NY8A 3ZZTA 3A26A 4NLXA 1RHRB 5K8NA 1FLOA 2DGSA 2V8PA 2UXBC 3IC1A 1WG5A 1X4CA 1BGXT 2I0XA 4Z7YA 4ODJA 4NXNF 4DR5C 5LMNF 2XMMA 3O8WA 2ZZTA 4ZVFA 4IFVB 2MKJA 3RBEA 2E9RX 1XR5A 2YKNA 1OY8A 3W9JA 5HQMA 2HMIB 2M8DB 3POTA 1S48A 3EGVA 1BWEA 4X65F 5KFNA 4M1KA 4DG8A 1HQEA 3WIVA 2DNZA 1IM6A 1QM9A 2ZVSA 1N36J 2HHHJ 4XPEA 1S6QB 3OJSA 2H54B 2UXCJ 1ZETA 3TX0A 1T03A 2R42A 3TAMA 3GPCA 4F36A 3A25A 2RILA 2R4FA 2E9ZA 3W2WA 1QAXA 4LF7F 3I0RB 3SCIE 3ENQA 4ECZA 1R6YA 3Q83A 2KT2A 4RNOA 1Y3KA 4IQMA 5LMUJ 2V34A 4O4GA 2YNFB 4X4SA 3M6WA 3BF4A 1ZM4A 4ILLA 2BW2A 2VICA 2IBKA 2M5HA 3AJ2A 5MLCV 1C0TB 1QAJA 1CULB 3RG2A 2W2PP 3IG1A 2DY1A 3SQGB 3KOAA 2DNKA 3GCXP 4DV0J 3OD2A 1T9TA 4E8UA 1UVJA 4R8UA 2OPSB 2VG6B 4NZ0A 2QRRA 2MDAA 2AW0A 2E1RA 4OZ2A 2RJZA 2UXBJ 3G2XA 1CJVB 3QGGA 4DR5J 2LEBA 3G8QA 4IQXA 2HGNA 3VWSA 4IRKA 4WP3A 1FNMA 4F3MA 4YY3F 4LFBC 4ZN1A 4NEZA 2LA4A 5E3QA 2HQGA 2K7JA 2XQCA 2DNNA 3EX7B 2AQ4A 5GMKa 2CIMA 4ETZA 4ZLJA 4C6AA 3PG9A 2N3OA 3HD1A 1NM2A 3D1OA 3IN5A 4C8LA 2RDIA 2DNGA 2OUGA 4GKKJ 4ANCA 4GO7X 5IT9D 3VNRA 1RCXB 2CXEA 5T7LA 4MYTA 1NPPA 2D7VA 2MJUA 1A7GE 4JI4C 2DHAA 1FJGF 3KJVB 3MHYA 3RTVA 3A8IA 4WZQA 2WSEC 2QX0A 1K0RA 1TKXA 1WDTA 2OD6A 1UA1A 2R2RA 2CADA 5HBMB 4A8MP 4ZVQB 2F8HA 3E2EA 2HQCA 5DDRC 4C8OA 3TZYA 1RT2B 3SO4A 4GRSA 2D1CA 1YZ6A 2M8HA 3EQ6A 3P6YC 4BWMA 1O92A 2R7RA 1CJTB 4QWBA 2CWXA 4KTTA 1UWBB 4IRDA 3ZTOA 2MKHA 3QAUA 2LEAA 5EDWA 3KLGB 1KHVA 3OV7A 3CDAA 3AHPA 1KTVA 2UZAA 3KDNA 3TVKA 3VGVA 2XMUA 4BWJA 4HT5A 1DQ9A 2FLNA 3PO4A 4LFBJ 1T3NA 5KG6A 3VNQA 4EGLA 3PYFA 2GIRA 4NCAA 4Q2LA 2YPYA 1HNIA 2CQ0A 4WK3A 4HDGA 3TUFA 4C97A 2FZKB 4PEOA 2D1RA 2V9KA 1VMBA 4EWTA 5BYSA 3DOMB 2VA2A 3VZIA 1NK8A 2MLYA 3ZNJ1 2HGMA 4V19X 3FCEA 3DRSB 5A2QY 1CS4A 2DCUB 4I2PB 5A2QU 1HPZB 1FTRA 4JV5J 1TL1A 2CQDA 5AXKA 2ROEA 1JLGB 3MPWA 2VV5A 4DR3F 3UDEA 4MH8A 1GEHA 5BSTA 3M9OB 3J81D 2HWHA 3OTOC 1M5PC 4JI2F 3NPDA 3PJXA 2PEBA 3Q8SB 2XS7A 1PG5B 3WX8A 4J9QA 5D15A 2COLA 3PX0A 3DDNA 2LQ8A 1HBNA 1SIWB 2CPEA 2Y9HA 1RTDB 1HD0A 2JHEA 1M1GA 2MHNA 5HATA 1QDUB 4RVOA 1WG1A 2VDIA 2GMLA 3K6RA 3G71S 3H2VE 3L95X 4L7IA 2PA8D 2VSQA 1I51B 4RNMA 5A6PA 2JL9A 3VGTA 2XSJB 3PEHA 4JI8C 1VEHA 1KONA 1HWJA 3RB0A 2E5LC 2X1FA 2FD2A 4NLOA 1FX4A 1KR4A 2W2MP 1HNVA 2CPFA 1JWWA 4P2FA 3Q89A 1N33C 1NJWA 3UEBA 5IQQA 2U1AA 4Y28C 2UU9C 1IBKC 4QJVA 4W98A 4AQYF 1RT7B 2XMKA 1B70B 3ZZYA 1HNXJ 1Q78A 4X62C 1KQFB 1RHUB 1F3VA 5KT3A 2IM3A 5E3CA 2A2DA 1CPZA 1C0UA 1QJHA 2ZVIA 1L3KA 1QVGR 3QFHA 4USHA 2FJBB 1KNZA 1X4EA 3DM2A 2PIIA 2VHGA 3NNCA 3DKDA 3WC2A 5A8RB 1S97A 4OI1A 1MG7A 3ZZPA 1SKSA 3D1HA 1I1GA 1NB2A 3HM9A 3KJNB 4P2MA 4G6VB 3OTOJ 3U02A 4OMFG 2DGXA 3SV4A 1MXBA 1MN9A 2JDJA 4DUYJ 1Q81T 1PG3A 3DLEB 1EARA 2W7AA 4BLGA 4D56A 2F8MA 4ILRA 2FVRA 3R5AA 2Y1LB 3MMBB 3ZTQA 1OYDA 5KFDA 2A2CA 2NCLA 4OX6A 3EJMA 1Q7YT 1OY6A 5AXNA 4PUOB 2VZEA 2ZHOA 2ASDA 3I07A 3EICA 3NMAA 3TX8A 1FWKA 3GWCA 4DCOB 5AXLA 1TL7B 3CNQP 3CD7A 2MQQA 2JNJA 4FBUA 1NDPA 3P96A 1V5IB 2E1MC 4C11A 4PXDA 4N8NA 3HULA 1FHTA 1DBDA 1H2TZ 2ZNYA 1R0CB 2ZUGA 2HIQA 1U49A 1U1KA 8AT1B 1YRUA 5FLXD 2QSFA 1RTHB 2P2BA 3FQKA 3QT7A 1FXDA 5BSRA 4X84A 1VRTB 1VQKS 3UN5A 1NDLA 2WW8A 3B6BA 1IBKJ 2M88A 3TR5A 4K2XA 3ISND 4KV8A 4UY85 4XDCA 3CPWR 1NKCA 1ZB9A 3AD8C 1UTAA 4OYMA 1HNWC 3VQTA 1WHWA 3S01A 2CQIA 3IP0A 2KVQE 4K4VA 3I5AA 2IM1A 2H5EA 3MXHP 1PA4A 2JC1A 1NKEA 4QU6A 2WOMA 1EHWA 3V4IA 3QBCA 1NPKA 1ULRA 3KHRA 3PHEA 2HKEA 4CLUA 3UO0A 1TP7A 1YBAA 2OPRA 3ZTPA 2OSRA 2A10A 1KVKA 1Q8BA 1LV5A 1RAIB 4G1QA 1AUSL 1DARA 2JRSA 3AXMA 3TAQA 4BC7A 1UVIA 2JX2A 3MTJA 4KGVB 1FEEA 3TUZC 3FKBA 1O9TA 3GJRB 1ITPA 4U7UK 3I56S 1IKYB 4IG3B 2L9NA 1VJWA 4QOTA 4JI5F 4DN0A 4DQPA 1FDDA 2ZH8A 3B4DA 4LIWA 4OYZA 1QLNA 1K44A 1GTHA 3J7Z5 1QWIA 2B3TB 4C4WA 4CH7A 3M8WA 1JXLA 2H51B 3FSIA 1C1CB 2OPPA 3RJMB 1HYSA 4IOBA 3MR7A 1IBMF 1NHKL 2YTCA 1IKVB 4BS2A 3CGIA 4FKYA 5A8KB 3PM9A 4HPVA 1Q4RA 1LWEA 3ZO7A 4TNOA 5D6GA 1P9YA 1S1XB 2BJ7A 1HNWJ 1RWUA 3VV2B 3M9NB 1ZH5A 3CW8X 1RZMA 2VG5A 1QTNB 1MWYA 2Q43A 5AE2A 3UPFA 2QC3A 2BJ3A 2FVSA 4RJVA 2KDOA 1DQAA 1JXEA 2KKHA 3R9XA 2PSZA 2BX6A 2CNKB 2YWHA 2EWHA 4HI2A 3I55S 4JI7J 2AEFA 3QWUA 2VFRA 4O4RA 1Y3JA 2YWEA 1LFWA 3R5JB 2BBEA 2ZBQA 1BQXA 4DS4A 1S5ZA 4QPXA 3UVJA 1YRTA 1YJVA 3CDEA 3MPUB 1U25A 4NXMC 3CXCR 3MEGB 2R7TA 4ED7A 2Y8YA 1RT3A 5AJ3F 3MR2A 2RF2B 2YX4A 1QE1A 3MUTP 2V2QA 3ELHA 4ED0A 1FA0A 4ZVSB 4UUWA 3NAHA 3LGHA 3N5BA 3HVRA 4DR1C 2B51A 1RHKB 5ETSA 2W2NP 2HFZA 2HRTA 3HHLC 4YUDA 1B99A 2M4MA 4DV3F 4QR0A 1RE1B 1VQNS 2GMJA 3UN3A 1M1KT 1P27B 1WTFA 4IO9Q 4M5JA 2CDQA 3JSBA 4H4OA 5B0CA 1OSDA 3O2IA 1H2VZ 3ETMA 4USIA 2IAJA 1LW2A 1EAYC 1WC4A 3VALA 2GNKA 4QIGA 4J9SA 1WEZA 1RWWB 1VFJA 3CJ2A 5HMXA 4ELTA 4NDNA 2VQEJ 4RLQA 2XMAA 2CPYA 4X65C 1XRAA 4Y2MA 3BO2A 1J2VA 1BQMB 2VPXB 3VZHA 1JLAB 3ZZ0A 2BDPA 2AEMA 5ETMA 1B0PA 1TMMA 3AFGA 3LANA 1F9FA 1V3RA 2WZ1A 3NOCA 1D0EA 1LWCA 1VISA 4LF8J 2ILYA 2J6SA 5JJBA 1DFDA 3CD0A 3I87A 4DCVA 3CJRA 2UUBC 1FVQA 2E7WA 3A9VA 2LU1A 2B4OA 2DR7A 4QU7A 2BXJA 1U1QA 3QO9B 3J7A1 3J81Y 1IBLF 4IFVA 3RUBL 4LF7C 2XZTB 2JJ4D 2R7QA 3F41A 3GLJA 5IV3A 3QATA 1BWVA 1BXNA 4NXMJ 5E3AA 4DHVA 4PPZA 3JSMA 1EJ7L 4TLRA 3G86A 4C8KA 2N82B 4ETXA 2Z2MA 3U1LA 2UVUA 1FXLA 2U2FA 1NSPA 4OI6A 3O6QA 2HWTA 3FZ2A 4NA3A 4CLWA 2YNGA 1T94A 3N5FA 3W65A 3M8PA 3NMRA 2P9EA 4BC9A 4LJMA 2HNYB 4Y2IA 3CJ4A 3LP0B 5J2MB 4LF9C 3K89A 5I3QA 1S76D 5C24A 3TEGA 1H38A 2E0GA 5K8OA 3OFEA 4J9LA 1PYTA 4KFBA 2GGPB 3EVWA 3OTCA 5LXYA 3JTPA 4F4ZA 4NXNJ 5LMNJ 2DO0A 2NXEA 3PVXA 4OZJA 2AJQA 1HFEL 1HMVA 2YVSA 4YY3C 3T9NA 2OAUA 1SJ4P 4OZ0A 1N32F 2EFGA 1S9GB 5BSWA 4EATA 5H9EJ 4C2MA 4X65J 2JVOA 1C0TA 5A19A 4FXDA 4I68A 3GIIA 2D1SA 1CULA 4F0HA 3AT1B 4B3MC 3SQGA 3FCWA 1N48A 2I2YA 3CJ8A 4MFBB 2OPSA 1FE4A 1XR7A 2JMPA 4B3SF 4LBIA 1RT5A 3N79A 1SC1B 1NJZA 1H6KX 2HZAA 1K1QA 2QL7B 4D57A 3UX2A 2XLJA 2UUWA 4LF7J 3RRGA 3BH7B 3M2RB 3JYTB 4NL5A 3TJ9A 3H98A 4C0HA 2ZBRA 2E1PA 1YWXA 4FXVA 2V8DA 4CWBA 4CLLA 2GV1A 1D9DA 1LCIA 2QVZX 5KT7A 1PBUA 1NRKA 2R7SA 1R8HA 5IWAF 5H9UA 4G1IA 5DS7A 5J2NA 2VFVA 2P9GA 2ROPA 5E33A 3AQOA 2R8JA 2VFUA 4LF1A 2KDNA 1WTBA 1KHWA 3KJVA 4B3OB 4I64A 5E5NA 5FLXY 4YY3J 1Q1KA 1W2BR 3R5BA 3EDQB 3WZ0A 3QIPB 5IC4B 3G6XA 3OSNA 3H2TA 1IKXA 2XO7A 2J9DA 1RI7A 1FFSB 1UVLA 1RT2A 3TO8A 3UFCX 3GCWP 3R5CA 1R8AA 4DR2F 1QY7A 1R3NA 2HS4A 1CJTA 2HBYB 1UWBA 2VJUA 1U1PA 3GP9A 3HKWA 2DXFA 3J7AN 5AE1A 2OEJA 3KLGA 3I5BA 2BM0A 5DG9A 4ZVEA 1PJ7A 3NWGA 4DR3C 5GAGU 3GV7B 1FJGJ 3MEEB 1WHYA 1USPA 3MOZA 3TZWA 4KGMA 3W62A 3H5SA 3KHHA 2PT7G 1H74A 5KG3A 3LO3A 1Q7LB 4N76A 2MZ1A 3TWZA 4XTTA 1RBOB 1XNRF 4E2FB 5EUHA 2DHXA 5GAEI 1N34F 2ZDPA 2VKZG 2Y4OA 2B6AA 3MUMP 3OXGA 2V2VA 2PN2A 2YXLA 3DYAB 2BRLA 1F3FA 2HHQA 2PMZD 4MYUA 1KSPA 2KU7A 4C8ZA 3NYRA 2WHOA 4I2PA 2R7XA 1G4CA 1O5JA 3KK1B 2HVEA 2EC2A 2IJNA 1JLGA 2VL1A 4NLPA 3KXWA 2XB2D 5KFLA 2OKQA 2FYXA 2UUAF 4M5MA 4K50A 1URNA 4IOAQ 2ZH7A 4PQAA 4YHHF 5HANA 1N56A 5F0WA 4FF2A 4O0IA 3CC2S 3W64A 4L74A 1RTDA 3R8YA 4KQZA 1Q16B 1FJ7A 3NLCA 1YLXA 3PW0A 2IYGA 5E3RA 2ATWA 1CJUB 2WVBA 1QAYA 2XZWA 2DEIA 1UMJA 1XTZA 3L7PA 3TJAA 1AA1B 1WD6A 4QCLA 1OY9A 5J1EB 4DV1C 2AU0A 3HFKA 1TUGB 5DZ7A 4ZVPB 4DR3J 3W5XA 1ZPVA 1LXNA 4ICLA 4USTA 2DD8S 1R0BG 2UVWA 4YN3B 4JI2J 2HIYA 2P2FA 3PCOB 1S6PB 3UR0A 2ZWPA 4CYUB 4ZJOA 1JK9B 4ZLPA 1S0OA 2YPZA 3TUJC 1UVNA 3KUHA 2QO3A 2D74B 2J76E 4FNHA 2NUHA 3CUNA 2Z30B 3FGVA 2C2DA 1HHSA 5C42A 4ER8A 2B4PA 4D3GA 4MK7A 1RYSA 4ED2A 1TU0B 4ZPVR 4F4YA 4MAKA 3KWMA 4EFAC 5A8RA 3BR8A 3AJDA 3TA1A 2YKPA 4ZJLA 5DQIA 2MZTA 2OGUA 4EZ9A 4QIFA 4RL1A 1M5VC 1UJ5A 3SCJE 3D9BA 2HNZB 2VBWA 1OQ3A 3LAKA 2BJDA 1K1SA 2RB7A 8ATCB 3PW7A 3QGPA 4AQYJ 3MMBA 2KVIA 1JKHA 3P3DA 4MTPA 3CQ1A 3OL7A 3MMCB 4RW8A 2PEHA 2DR8A 3VAJA 3BYPA 2HVHA 2B8PA 2J5AA 3PR5B 1XC9A 3GYXB 4XAKA 4OHXA 2DGWA 4ZPCA 3TQEA 1RTJA 3NBPB 2XZDB 3OTDA 4P7TA 1JIHA 1QTMA 5I3UB 1B3TA 4RM2A 2RHQB 3TUPA 3DI6B 2E8CA 5ETKA 3GE9A 1RWMB 1VRTA 3T3FA 1J5EC 3CCVS 3EERA 2DRDA 4M5DB 1XERA 3D6FB 2E7XA 2Z2YB 3LWMA 4HL9A 4DSFA 2V8VA 2FZCB 5CZVA 2W24A 3DN9A 2KJWA 3DDKA 2FLLA 3QSYB 4GMKA 3TOQA 5K14A 4JI5C 3IMLA 2JH3A 2DYAA 4UUXA 3I31A 3AY0A 4USMA 4JM1A 4PZPA 1Q5VA 3CO0P 1VYAA 1ZZNA 3M8QB 1AFJA 3QLHB 1P8GA 5D3GB 4ERDA 1WJ9A 2E7GA 3W1YC 1P9QC 1S9FA 4LT6A 2VBZA 3I5CA 3IWNC 3HVTB 1IBMC 2QA4S 4I6AA 2IC3B 2XMJA 3HHEA 4UOHA 5JVGQ 4IH5A 3LALA 3UN2A 1O93A 2C2MB 4L3KA 3LP2A 4CLYA 2DO4A 3DC2A 1XNQC 1HR0F 3C14B 2AYGA 3BN7A 1IKYA 4KC5A 4IG3A 4YDXA 5HMZA 2KJVA 3W5YA 1N5TA 4MK8A 3LP1A 4N56A 2Y4NA 2V4RA 1NSAA 1HWIA 4PKDB 3DOLA 5KT6A 4AL6A 1M5HA 3JXOA 2ILZA 2MKKA 1T05B 1SH2A 3SIPB 1YJ9S 3N6LA 3LW5C 1HA1A 3FBCA 3MUVP 1HLWA
chains in the Genus database with same CATH topology
3GIMA 2MPUA 4TU8A 3C3LA 3V6DA 3LAMA 1DJ0A 1G3OA 1OO0B 3N4WA 5H9FJ 5KFBA 3TAPA 1JLBB 3B7WA 1X4AA 5A1GA 2MQPA 2G4BA 2VOOA 2N3LA 4DV6C 4RW8B 5C5JA 5B09A 1IKVA 2HS3A 3DCAA 4QQBA 4DV0C 2CQ3A 4KKOA 2ZH3A 3T1YF 1LWCB 1UFLA 1KFDA 4A8WA 3OR2B 2R7UA 1NK0A 1SH3A 2K1RA 5A8KA 3T5HA 1C4CA 3IRXB 4MKBA 1V6HA 2DNPA 2J7UA 3ZZTA 4B9NA 2CZVC 2HJGA 4NLXA 3CC4S 5F8LA 3DRPA 5K8NA 3KNAA 2DGSA 2UXBC 4UQTA 3IC1A 1WG5A 1S1XA 1X4CA 1BGXT 3DLKA 1RTJB 2I0XA 2O1PA 1WH9A 4ODJA 4NXNF 4DR5C 5LMNF 4LFAF 2ACYA 1U24A 1YVFA 2XMMA 3AB4B 4IOCQ 4MMOA 4OIXA 3N9UC 4I67A 3IPLA 3FMBA 4PWDA 3O8WA 4I0WA 4ZVFA 1FK9B 1N8RT 3LWLA 2LQ9A 2FJDB 4IFVB 2GQ2A 2MKJA 3MM6B 3RBEA 1L3SA 3SDEB 2DNHA 4DPOA 1LFPA 3I0SA 1XWLA 4DG9A 1MU2B 1C2PA 3KLIA 2Y1JA 1N5YB 4GC6A 3M1VB 4Y6IA 3CJKB 5EX3A 2ALZA 2E9RX 1XR5A 2YKNA 1IUJA 3P49B 3CULA 4RW6B 2HMIB 2M8DB 2VFSA 1O51A 5B0AA 1P1TA 2P9CA 1VS3A 4AXJA 5F0UA 3KG0A 3H5YA 2VQFC 1E6YA 2HRUA 4URSA 1Y4ZB 1CC7A 5BYRA 5DDQC 2X1GA 4OI0A 3POTA 5J2PB 2W9CA 5A6WA 4R0MA 1S48A 3RBDA 1KD1T 1KQGB 2JVRA 2MSSA 5ADZA 1BWEA 5KFMA 1KN6A 2I9SA 1HI1A 1B0TA 4ZPDA 4X65F 3I82A 2MQLA 3IGVA 2D41A 5KFNA 2NPIA 1FJEB 1QUPA 3ENWA 2HYIB 5HBMA 2HQIA 4PROC 1KKGA 4DV3C 4M1KA 2WSFC 4DG8A 4ZP9A 3UD3P 1U09A 1HQEA 2CQ1A 2BJEA 2J0XA 4EO6A 1WELA 2DNZA 2EFVA 4RBTA 2WBMA 4P2SA 3GR0A 4DBQA 1QM9A 2ZVSA 1JJ4A 2IVYA 4K4SA 4WFXA 1ZTWA 4ZA1A 3KLVA 2MKIA 1RTIA 5KFTA 4XPEA 2OPLB 3PROC 1RG9A 3CJ3A 1S6QB 3TVYA 4ZCMA 1CSJA 3OJSA 5KFHA 1FRKA 2MY8A 1P6TA 1N0UA 1ZETA 4W90B 2DK2A 1T03A 2KTQA 2EGTA 5K14B 4NLSA 1IJEB 3M6VA 1TKTB 2K2PA 2YX7A 5DGBA 2HFOA 2ZH5A 3TAMA 1TKDA 3ETCA 2ZH4A 3K8WA 3GPCA 3HT3A 1Y9OA 4F67A 4F4XA 1TVRB 4DR7F 2YWKA 4PXBA 1ZAXA 5KFUA 2RILA 3B4MA 1QSYA 2R4FA 1KOOA 2MGZB 2OTJS 1DAXA 2VG7A 2XBPA 2HHSA 1IN0A 5J2QA 3GZ7A 3E3XA 4F4KA 2E9ZA 2ZKUA 3W2WA 1QAXA 3HZGA 1XMBA 2E1CA 4LF7F 4RUAA 1ZYQA 4WXOA 2N7YA 2KHCA 3MTKA 1HBUB 1FRLA 3I0RB 3T5JA 1M5KC 3M4XA 3PKYA 3DNCA 4F02A 3SCIE 3V4MA 1KEKA 4K4YA 3M6XA 2LKZA 4X4RA 4B3TC 3ENQA 2IVFB 1SJ3P 4ECZA 1R6YA 4F25A 4UOCA 4C0BA 2KT2A 4RNOA 1Y3KA 4IQMA 1BD6A 2Y27A 4EBCA 4O4GA 4WFYA 3D5MA 3IWXA 2YNFB 3SFGA 4JI2C 4RNNA 1IXKA 4X4SA 4DR4F 2J9EA 1J5EF 3M6WA 3BF4A 1IKWB 1RQ0A 2P2MA 2NSCA 2BE2B 1ZM4A 1YJRA 2BW2A 4Z37A 4J9NA 2IBKA 4ILLA 5IZHA 3E7XA 1X9SA 4I7FB 4RMNA 2IRYA 1U45A 3AJ2A 4EU0A 5MLCV 1C0TB 2QVXX 4ED5A 3LP2B 3KMQA 1N0VC 1QAJA 1QAIA 4NCGB 2YNHA 3CMAS 1O90A 3BO3A 2QL8A 3RG2A 2UXDC 2GIQA 4NYOA 3IG1A 1YJWS 3SQGB 3HKZD 1FRIA 3PX4A 3KOAA 3BJYA 3BGRA 1XRCA 2DNKA 3DOMA 2MHEA 2AGQA 3ZFVA 4E8UA 1UVJA 4R8UA 2KG1A 2OPSB 2E66A 3ZZZA 2XNRA 2WONB 2VG6B 2PT0A 1A6LA 3IGNA 4NZ0A 3U27A 3GKUA 2QRRA 4DFJA 4GS5A 2MDAA 2CG4A 4WJBA 3DRSA 2AW0A 2E1RA 2RRNA 2E29A 3LP1B 4CZCA 3NL0A 2XI3A 3I4PA 4ZPWR 3VAHA 2RJZA 4ES3A 1G7CB 1TKZA 2FLOA 1F5AA 3VNSA 3QGGA 4WCEQ 2LEBA 1UA0A 3G8QA 1QSLA 5IT4A 4IQXA 2QZ8A 1HPZA 2HGNA 3DOLB 2HLUA 3CD5A 3LH2S 3MM9A 3VWSA 5KG4A 3CCQS 4IRKA 1DLOB 1G2EA 1UJ4A 4ECVA 4RW9B 1FNMA 1MMDA 4F3MA 3BSOA 3SCKE 3AF5A 4YY3F 3EPIA 1BQMA 2J0SD 4LFBC 3E01A 3RAXA 2LA4A 1JLAA 1F5CA 5E3QA 5KTQA 1KS2A 2DNOA 3GQCA 2DR9A 2K7JA 4L6V3 1Q8IA 1WHVA 2FJWA 4LQ3A 1U6BA 3GFZA 3V2UC 3BQ1A 2BH1X 2DNNA 1WACA 1GQEA 3VQSA 1B7FA 3EX7B 5GTDA 2AQ4A 2GHWA 5GMKa 2CIMA 4ETZA 3THTA 5D4NA 1MWZA 3DU6A 2BA9A 4DSIA 2F4VF 4N47A 2DBBA 2N3OA 2DRBA 2NQPA 4M95A 4Q45A 1NK9A 2W25A 2Q66A 3D1OA 3IN5A 1VHFA 4AQYC 1WF2A 4PCQA 4C8LA 3TA0A 2NUUG 2EK6A 1N5QA 4CNZA 4X2BA 4K0KF 2RDIA 2DNGA 3DRPB 3C8YA 3QO9A 4C8NA 2VASA 1XNQF 2P2JA 4J9KA 2RU9A 4Q8EA 3H5XA 3KLFA 2DGQA 4B9VA 2QT7A 3DLKB 1SQEA 4GO7X 5IT9D 2CPXA 1GX6A 2ZFHA 4CNYA 3BO4A 3BDPA 3OPKA 3DMJA 3VNRA 1JLCB 4PWDB 2B4UA 3K5PA 3FCHA 1RT1B 5A1IA 3BQ0A 3H20A 5T7LA 4IFYA 4MYTA 4OX7A 4ECTA 1N32C 1U1MA 3MR6A 3OL9A 1WEYA 3I0SB 3ITHA 2D7VA 2MJUA 3KLIB 5L1KA 1A7GE 2VFTA 2DHAA 1QUVA 3MGJA 3MM8A 4IYQA 4X66F 1FJGF 4JI4C 5U47A 4RWXA 3MFIA 3KJVB 3CCES 3FSXA 5K8MA 2HHWA 3MHYA 2PD1A 3MD1A 4WU2A 2C22A 3TYTA 1WWHA 1GTEA 3RTVA 3IEUA 4WZQA 1SKRA 1DRZA 1E6YB 2WSEC 2XSJA 4R0EA 3O44A 1U1NA 1CG2A 3LGNA 5HMYA 4YR2A 2GO8A 1KOHA 3UWTA 1K0RA 4DDFA 1TKXA 2YX1A 1XN9A 2EFOA 5IFMA 1NK7A 4PXCA 2OD6A 4ECYA 5AE3A 2YNIB 4KAIA 2R2RA 1UA1A 3PY8A 4AL5A 2AJ1A 5HBMB 4YFUA 2C3MA 2QYCA 1WF0A 5EX0A 3W2VB 4A8MP 2VONA 4QWCA 4ZOSA 1HQEB 2F8HA 2F3JA 2NS1B 3GYNA 3E2EA 3KMSA 5DDRC 1U1RA 4C8OA 4KHPF 1RJJA 2OTLS 4KSEB 4NA2A 3UE2A 4DV6F 2P2QA 5BYQA 2B9WA 4RVNA 1RT2B 1YSJA 3TDEA 2PA3A 3SO4A 2GMHA 1EP4A 2D1CA 4LQ9A 2M8HA 1RT7A 3EQ6A 3EYZA 4PQUA 4FF1A 5KOWA 3P6YC 4ED1A 2ZH6A 4WXWA 2C3OA 4BWMA 1FKPB 4DLEA 1O92A 2R7RA 1GH8A 4QWBA 4A8YA 1CEZA 2LXIA 4G3IA 4J9PA 4C8MA 4KTTA 1UWBB 2JWNA 3IXQA 4ITSA 4IRDA 4DSKA 5KT5A 3N2QA 2KM8C 2MKHA 3QAUA 1KFSA 1ROFA 4QIWD 4YEAA 4Q8FA 4ALZA 2J8AA 2LEAA 5GVQA 4TXSA 3SSQA 1RK8A 5C25A 2ATLA 2VG7B 3C5EA 2FHJD 5EDWA 2WP0C 1NK4A 2MSTA 3ULHA 3KLGB 4K4WA 1ML8A 3CJ5A 3FFIB 3W2WB 4EBEA 2K3IA 1SI9A 3BEGB 1KHVA 3OFGA 2XS5A 2XI2A 2W8KA 3BGFA 2O67A 4P6QA 2EFQA 1DTQB 4ZKAA 4EEYA 4O3SA 2XG8A 3OV7A 1M5OC 3CDAA 2LEPA 3DRXA 4HHJA 3G4SS 4JUZA 2QLXA 1NHVA 3AHPA 4EYIB 1TV6A 3TNVA 4JI6C 1AXQA 1X0PA 3CIZA 1KTVA 4O4GB 2UZAA 2C42A 3R1LA 3TVKA 2VQFF 2XMUA 1X8DA 3C6TB 4NLDA 3MM5B 4Y00A 3ZZRA 4BWJA 4HT5A 2ZD1A 1S0VA 1JJHA 3TQ1A 1DQ9A 4ID5A 2FLNA 3PO4A 1T3NA 3LUSA 4B9SA 2ZC3A 1TQLA 1RISA 5KG6A 3UR3C 1HH2P 4R0JA 3H5UA 3VNQA 4EGLA 4TKTA 5DO2A 2CQHA 2ZE2A 2GIRA 4NCAA 2YWCA 5IWAC 4Q2LA 1HNIA 3GFHA 2CQ0A 3RAQA 2YNHB 4MFBA 4WK3A 4DQRA 4DQIA 4BCAA 4HDGA 4O44A 3TUFA 1KLNA 2XULA 3IG1B 5B0EA 4C97A 2XMVA 2D1RA 3DLEA 4LSNB 3V6HA 2AV5A 2V9KA 3CJEA 1VMBA 3BGRB 3IRWP 4PG4A 4EWTA 5BYSA 4OX9C 2V4JA 2J6TA 2VA2A 1DZ5A 2JLFA 3VZIA 3WDOA 1NK8A 3DXBA 5KFVA 3OL6A 2HGMA 4V19X 3FCEA 2HLTA 2D1TA 2Z2LA 2RKIB 4QPTA 3A4IA 2BOPA 4C9DA 1LXJA 3DRSB 4EBDA 4DV4F 5A2QY 3LNVA 1FDNA 3NP5A 1Q79A 3CCLS 2P6TA 5F3TA 3N28A 4PUOA 1VQ9S 3UNGC 1S9EB 1TKZB 4CO1A 2DCUB 4I2PB 2YKOA 2CQPA 3HHLA 2L9DA 2Y1IA 4F26A 2DHGA 1SL0A 1HPZB 1FTRA 2OO4A 2MZQA 3MM9B 1JX4A 1DQ8A 2EG2A 5FDLA 5KFKA 1TL1A 2CQDA 3BS9A 3CD6S 5AXKA 2ROEA 3E01B 1JLGB 3HXMA 2DR5A 4NLYA 3MPWA 2VV5A 3PEJA 4NLVA 2B7CB 4DR3F 1T02A 2MB0B 4MH8A 5BSTA 3M9OB 2G9OA 4WKRA 3J81D 4B9TA 2HWHA 2IHR1