3L95X

Crystal structure of the human notch1 negative regulatory region (nrr) bound to the fab fragment of an antagonist antibody
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
230
Chain Sequence
GSACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGDVRGSIVYLEIDNRQCVSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Therapeutic antibody targeting of individual Notch receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords anti-NRR1 fab fragment light chain
total genus 67
structure length 230
sequence length 233
chains with identical sequence Y
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00066 Notch LNR domain
X PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l95X02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3l95X01
3L95X 3ETOA 5CZXA 2OO4A 5CZVA 4ZLPA
chains in the Genus database with same CATH superfamily
1MXBA 2NLWA 3BBCA 4USMA 2P2MA 4I2QB 3SV4A 3FFIA 2FC8A 1IBKJ 3PW2A 1U1RA 2Y0BB 3PYDA 2IA6A 3BH7B 2I2YA 2XLKA 1RWPB 2E5LJ 3ENQA 2QL8A 3CJRA 2HFUA 2RUGA 3Q8SB 4L4QA 1SC4B 2VPWB 1X4HA 2Z2MA 3KXDA 2YWBA 4OYXA 3CW2C 3LP2A 4RKUC 4NE9C 4F67A 2DR8A 2AEMA 2XS2A 2LLZA 4Q45A 4QWEA 3R2CJ 1GNKA 1WI8A 2HFSA 2W2PP 3AOCA 2BKOA 2GGPB 5F0WA 3M05A 4X4SA 1VC6A 1N5YB 2XNRA 3MUTP 1L5UA 3L9ZA 2ZZNA 2QW0X 3IN5A 2QIFA 4NCGB 4LUBA 1TH5A 2X1BA 3M8PB 4QW8A 4IQXA 1IWGA 3MM5A 4RLQA 2BQ3A 3UX3A 5IXUA 4KGVB 5KYTA 3NYRA 3BSCA 1XMOF 2E7VA 1L3UA 5LMNC 2B4VA 2DJWA 2V6AA 4WWSA 4FTFA 3R1HA 4BC7A 2RH3A 5CD4A 1IKXA 1TAQA 1VBKA 2CA9A 4WE1A 1BQMB 3TX8A 1B0VA 2AHOB 2B3TB 4B17A 2AGPA 3OFHA 2RS8A 3IMLA 5HQLA 2FTRA 2Z51A 1HR0C 1KKHA 4NX9A 4D3HA 2XQCA 1XEZA 3TAMB 2K3IA 1JLGB 2R7RA 1J5OB 5LOQA 4RJVA 2PFDA 1TL3A 4D4GA 3HD1A 3DRYA 2DO4A 2NREA 2DRBA 3AF6A 3K2YA 1NH7A 2JL9A 3I9ZA 3EJMA 5F8NA 4M5KA 4ETXA 5DLGA 3SV3A 3BBFA 4CYUA 4U96A 3UDVA 4YB1P 3PEHA 4KJIA 1KTVA 2WSFC 1W25A 5AE3A 2DNOA 4WTYA 3V2UC 1N33J 1R0AB 1ZA1B 4DCJB 1H2UX 2DCLA 3N5BA 1FE4A 1MKYA 2HRYA 3T41A 1CJTA 1R0CB 4J9PA 3CQ2A 3GIJA 1IKYB 3GJRB 4OXIA 4XTTA 1S6QB 1WORA 3Q2TC 3AH6A 3UR3C 1TKZB 2R7SA 4YMEA 1LW0A 3PVXA 4LBPA 3HT3A 2ZJQQ 4DV7C 1N33C 3BPSP 3T1AA 4DN9A 1SC6A 2JJ4D 3CMQA 3POTA 4GC6A 5CCMA 3CUNA 2OTJS 3D54A 2H5IB 4N7TA 3NWGA 3CGIA 2BE7D 1HBNA 2YY3A 3NS7B 3KLFB 1RKJA 1S6PA 3FSXA 2J9CA 1T7PA 2VV5A 3US5A 1FFSB 5IT9D 6AT1B 5KG4A 3CJ0A 3I5CA 3MEEA 4QR1A 2ZM6C 1WUUA 4EBCA 2ALZA 2NS1B 1NEEA 4G36A 3N6MA 3GU0A 2NXCA 3B78A 4KKOA 5DETA 4JI5F 1S48A 2MLXA 3AB2B 2ZH3A 4YY3J 2OHDA 2PEHA 2C1EB 2X3GA 4HI2A 4LRFA 4YB5A 3QWPA 4K0KJ 2N4CA 3A26A 4I1TA 5A8KB 3LO3A 1QY7A 1OMSA 3LGMA 2N82B 2XCPA 1L3KA 1RTIB 1SL1A 4W92B 3TZYA 5HLFA 4FNIA 2WVDA 2HBYB 4I69A 2RQCA 1GAOA 4IFVB 4C6AA 4GKJJ 5E7QA 2BE2A 2J0WA 2BJ1A 2JVRA 3I9V9 4BWJA 4DQSA 5E3RA 1YITS 4K4SA 5D8HB 1FRKA 4HT5A 2O67A 3OSNA 4DQRA 3R9XA 3H98A 1EJ7L 4WYWA 1T02A 3QPIA 4QOTA 1TL7B 1X4BA 4FBUA 1NO8A 4BS2A 1LWFA 5BSVA 2GW8A 2VDIA 2H54B 2AGQA 3W2VA 1QSLA 3WX4A 1ACMB 4PABA 1E6VB 2J9EA 3GJTB 5D77A 1FI4A 3JSYA 1S72S 2M9KA 2XULA 2HRTA 4X4QA 1IBCB 4ZCKA 4UQTA 3BGUA 5HMWA 4KH1B 4KHMA 1I51B 4OI0A 1RHQB 1F3FA 4L75A 2RILA 4ZLJA 1FX2A 3JQMA 1FE0A 1PC5A 3ISZA 4PUHA 3WC0A 1FJCA 3MR7A 4JBCA 1VOMA 3M9NB 5L38A 1H6KX 1JXVA 4IUFA 2A18A 4EU0A 4PZVA 2QL9B 1R8PA 2YNFB 2IAJB 3C14B 1RB0A 2YWEA 2W25A 3DMJB 5GAGU 5B0CA 5KFCA 3LWLA 1EKSA 3T3FA 5GMDA 2UUAF 5J2QA 2V2QA 1SVDA 3GFZA 1WSRA 2AYEA 3CJQA 3CE8A 3HVTB 4OX9J 4NMXA 1HNIA 4X66F 3TYTA 2MMAB 4JI2F 3R97A 1DQ8A 3IG1B 3ZXWA 2VOOA 3NPDA 3IS9B 3M8ZA 5AJ3F 1OYEA 5T7LA 4RPFA 5I3UB 3WZ0A 3IMQJ 3VALA 3PJWA 2J0SD 4PWDA 4JI4J 4OX9F 4LBHA 1HNXJ 3D68A 2HZAA 2WRMA 4PG8A 4C8MA 1I94F 2E9RX 3QZ8A 1D09B 2VJUA 2RRBA 3H2VE 2UUAC 1UA1A 3W7BA 3MM8A 1Q8LA 3R5BA 4G1QB 3TQ1A 2Z57B 2ZOMA 2FVSA 2CYYA 2R3VA 4DCTA 4DV1F 1VGYA 4MJKA 1VQ6S 3A8KA 2F4VJ 3G9CA 2HHQA 5L1LA 4QWCA 4L6V3 1S57A 1X0FA 1OQ3A 3T6BA 4M5DA 5KFKA 5K5MA 1JLGA 2OAUA 3SDEA 5L1IA 1J5OA 4O3SA 1S6UA 3G86A 3TO8A 2EC0A 2XNQA 3FBEA 3K58A 5E41A 4JI7F 1X9MA 3PKMA 2P9CA 1SIZA 2M4MA 3MR6A 2WOMA 5LT5A 1H98A 3BSOA 4NLVA 5LMUJ 2DNZA 2KHCA 2V4JB 5KFWA 1RAHB 3EPGA 2E1RA 4DI6A 4OYOA 1D9FA 3OVBA 1S7HA 4RM2A 1ZS6A 3KMSA 3ZFVA 4AL7A 2ZZTA 2HYIB 2HVEA 3QQCD 3THVA 3GB0A 4NWBA 2QLWA 1TKTB 4A8SA 4HDHA 2R8IA 4I2PB 4CNZA 4ZPWR 4QU7A 3CJ5A 1YRXA 3DLEA 4CM0A 1YVFA 3VNSA 2R7WA 1IJFB 1MROA 3VQTA 3IR5B 3M4XA 4YB7A 3MUVP 4RUAA 1FXRA 4X4RA 3CCES 1FTCA 1JWWA 3I07A 1JJCB 3S8SA 3JSBA 4PUGA 4X84A 2V8DA 2W4DA 3IWLA 2YNGA 3MPUB 3M7VA 3KK3A 4D56A 1RT3B 4C4WA 4DQQA 4IRCA 4EYIB 4TN2A 4JP8A 4B9NA 4WXWA 4YFUA 4LSLA 4DFJA 1WNEA 2FZCB 4R5PA 2BM0A 4FZVA 1REVA 3U02A 4IFYA 5IC4B 4ED4A 2AIRB 1ZPWX 5DDRC 4B3MF 4J9QA 4EZ9A 1QM4A 2AJ2A 3RRKA 1IQZA 1KDNA 1L3TA 4RM3A 5LMNJ 5AXMA 1Q16B 1UPPA 2C28A 3QRRA 2QYCA 4I9GA 1JLCB 1XR6A 3BM7A 2XMKA 1FRJA 3VR1A 3W3SA 4OHVA 4Z2XA 2I9SA 4I56A 1S4FA 1AW0A 3CDBA 4Z7YA 1UKUA 4A4JA 1YLXA 2DHSA 4ZPBA 4DR2J 4I67A 3DOKB 1Z2ZA 1P9QC 2F65A 4DEZA 2YNIA 4AXIA 4O0IA 2KZZA 2FD2A 3MEEB 4KRWA 2QRRA 2ZDPA 3THTA 3P49B 3UD3P 4Y2MA 2MSSA 2V8GA 3J7A1 3ZZRA 3GTYX 3IM9A 4ZVTB 2JWNA 4X4NA 4X64C 1FKOB 1SJRA 1TMJA 2XGPA 1GX6A 2MQPA 3PHTA 2ZJPQ 3GJQB 3MOZA 3VZHA 2Y1RI 4L3NA 1WC3A 2XSJB 1UWDA 1IJEB 1EP4A 4WP8A 4DZDA 3GV5B 2YH1A 4DWIA 2BJOA 4F2RA 1A6LA 3CO9A 4DQIA 1EKRA 1KWMA 3OTBA 4C98A 3GIMA 4DLEA 4QYZK 1KLMA 2H51B 2E7GA 2QJ3A 1AZSB 5DZ6A 3PDNA 3RR7A 2RKIB 3MMBA 1KTQA 3UNGC 3OTOC 1FWLA 3ISNC 1VQNS 1N5VA 3L7OA 5JMNA 2P2QA 1HNWC 1EARA 2EFNA 4WBFA 1XR7A 4B08A 3OTCA 3F41A 3FGVA 4DV0F 2MGZB 3MEGA 4WPAA 4DFKA 4CCHA 3QNWB 4YEAA 2K7KA 4DL4A 1ZH5A 1UKKA 2NPFA 1FK9A 5CA5A 3M9OB 2PFFB 2AP6A 2GS8A 2C42A 3CDEA 2HHHJ 4USVA 1FVQA 4KHRA 2FY1A 1P27B 1YRTA 1M5SA 1B3TA 4JI2J 1K0TA 2UU9J 2G0JA 4IFVA 4YDDB 5J2QB 3CTRA 3BQ0A 1FX4A 2R8HA 1URNA 2BM1A 2B6AA 1LWEB 5U47A 2PMZD 5H1SV 3CULA 4B3OA 2M8HA 4K2JA 4F4KA 5BURA 3HP6A 3DLBA 2VD3A 3EXCX 5L9XA 4O4RA 1NPKA 4KKOB 1R6YA 5JVHQ 5H9EK 2P2CB 3H20A 4NLUA 1VBZA 4ZMMA 1KQGB 5C24B 5IQQA 4LBIA 4L73A 1E6YB 3S7RA 2VPZB 3SDEB 1HR0F 1RT7B 2QA2A 3R5GA 4M94A 2Z8QA 3DHWC 3HVWA 2RF2B 3LPYA 3SCLE 3OV7A 2B8QA 2HZVA 3FVYA 2PA3A 2I38A 4RLEA 4UT4A 4KFBB 5M2PA 3ELHA 3RBXA 4EO8A 3KLVA 1T3NA 1S0MA 2BJ8A 3I82A 1VQOS 3MHYA 4PG5A 2K8GA 4LSNB 3W5XA 3OHAA 4ZA1A 1S9EB 4C2MA 1WC4A 2D1QA 2HIYA 1O0PA 2HGLA 3BZQA 2KVIA 2DEIA 3FDSA 1C2PA 1U45A 2E1MC 1RTDB 3H7HB 3HULA 1OIAA 3UDLA 3ZTPA 2KG0A 2KH9A 3QATA 4EEYA 1KNZA 4QYZJ 2M7SA 3G82B 3AQPA 4I0WA 4LF6J 2VU5A 3PW4A 4CWBA 2DGTA 2YH0A 3KK1B 1Y4ZB 4C0OC 4OX9C 2RDJA 2DGSA 2CPZA 3M8WA 1RWNB 1WF3A 5IM0B 2ZWPA 1B4SA 2YNFA 3G6ES 2LQBA 4I7FA 2K1RB 3BV8A 1MXAA 3IO1A 3OXLA 1WKLA 4LQ9A 1HI0P 2JX2A 2DHMA 4B3RC 2DD8S 1TKTA 1XTZA 2RE1A 5J1EA 2FHJD 5K14B 3RBZA 5B0EA 2RQMA 4KBIA 3TRGA 2E7XA 4MMOA 4F25A 1RT2A 4BBYA 1U8SA 4PKDB 3KJVB 1JLCA 2W9AA 3HVRA 2CJKA 3I96A 3R2DJ 3QGGA 1V3RA 5ETOA 1JJHA 2FIUA 2HBZB 2IDEA 4O23A 4G3IA 4IO1A 3TR3A 3CXCR 5KFHA 2LQ9A 1QM9A 4ECSA 1TV6B 1M6XC 1HBOA 5CYMB 3MM5B 2XY6A 4G6VB 1Q95G 4ES3A 2BQRA 4LVOP 5D4PA 2N7CA 2QA4G 2GJIA 4KH0B 2FVCA 1JQGA 5HSPA 4CZCA 1NPPA 5DV9A 5EX0A 1V3SA 2CNNB 4D57A 1FKPA 3CJ3A 1CQNA 1U02A 3UVJB 3W9IA 3G4SS 1Y5LB 3G6VA 1RYSA 4X62C 2AT1B 3P3DA 2C2OB 1UMJA 4DPYA 3HHDA 5BR8J 2OMOA 5IT9U 1UWAA 3ZZUA 2ZVIA 3K5OA 4RW8B 1PYTA 2YNGB 1KLMB 4O4GA 1N33F 1B0TA 2EK1A 3KK2A 4OI2A 4EMDA 1I6JA 4CLKA 2DNMA 3W9HA 4WV3A 4X4UA 3CCMS 1Q86T 2L48A 1FRIA 4XPEA 2BOPA 5F8HA 2XWYA 3WIVA 1ULTA 4DN0A 1U2RA 3Q8RB 4DV3C 4DR4F 4IR1A 2FQQB 3ZO7A 5EWEA 1GMWA 1OY6A 2J7UA 2ZH8A 3D1QA 4NRUA 5KFJA 4XO0A 2NZCA 4QIEA 3BO4A 1HNVB 4F0HA 5LXYA 2DRAA 2EFQA 4M5NA 4TY9A 1ZAXA 2O3DA 3DOLA 3HK2A 4JM1A 4LJMA 3NWRA 4EATA 1ZPVA 3M2UB 3ITHA 1FDAA 1R7IA 4KY3A 1QLNA 2FGCA 4LSLB 4PHTA 1RWWB 2HG4A 3OT9A 4GS5A 1QE1A 3QLHA 4LF9C 3OR2B 2LA4A 1GMVA 4OYPA 3ZZOA 3CQ3A 2FB0A 3D66A 4OZJA 2KT2A 3M1VA 4NA3A 1GX5A 4TKTA 3AD8C 4KR0B 2HQGA 3HO1A 2Y4NA 4HTIA 5F8GA 5GVQA 2MZQA 4AYBD 2CPYA 2XSJA 4GMKA 2XHCA 1I5OB 1F5CA 3UDCA 1RWOB 1SKRA 4DV0J 4F3QA 1VQMS 1VRUB 3FEZA 3LANA 3WBZA 4C8KA 2PROA 3KDNA 3NP5A 4USTA 6FD1A 1F5BA 5GAEI 4RW4A 5FIIA 4CH7A 5F8MA 2VBXA 3MECB 4ZJOA 5M2UA 5HP1A 1S10A 2P8IA 4B3OB 4IO9Q 2OELA 4RW6A 5C24A 3TZXA 2BR0A 4Z7CA 3ISND 1T9YA 4PYDA 1X31C 1G3OA 4P2SA 2PMHA 4C11B 4Q43A 4QIVA 3CMAS 2KB2A 5D4NA 5A0YA 1HI8A 1DHMA 4E98A 3CNQP 3KLGA 4RBVA 2ADBA 1KFSA 1YZ7A 2CRLA 3MZIA 4OI6A 4NLSA 1SKWA 3PW7A 2FGOA 2MZ1A 4Q0BB 1CSJA 4ECVA 4B3RJ 2YKNA 3H59A 1XBWA 4H4MB 2UVWA 1XS3A 3H8YA 2WVBA 2CJXB 3JYTB 1VK3A 2QLJB 2CFXA 2PSZA 4C8YA 1USPB 1L3VA 2RHSB 3D3BJ 5HATA 3W5YA 1U1KA 4DCVA 1O93A 2JNVA 2HHHC 2V69A 2MKYA 5B09A 2H65B 3EICA 2LEBA 2GHWA 1W26A 1I94C 3WX8A 3BO3A 3FSYA 1V5IB 2ATLA 2EBEA 4ZP7A 4GKKJ 1TQLA 2Y9HA 2D7VA 2G1DA 5CZVA 4FUQA 4OZLA 4W4MA 3T9ZA 2AYGA 1DTQB 2GV1A 2HK2A 3T1YC 2XZWA 1WI6A 2VFUA 3CCQS 4F4AA 1RABB 4DXLA 2W4CA 1D9AA 1S1VA 1VCTA 1VJQA 4H4OB 4RW7B 2DIVA 2CQIA 1I94J 2IIHA 2RF2A 1N34J 4PZPA 1RHMB 1HNZC 4NXNC 5DM7Q 3BR9A 4F3OA 2M3DA 2D7SA 3A3PB 1XJWB 4WFYA 4EUVA 3CW8X 1YX2A 4BC9A 4TPSB 1MWQA 2CJYB 5IV3A 3KMQA 3MM6B 5D3GA 4NZ0A 3J81U 2R2RA 1WF1A 4LF8J 1G2EA 1HNWF 3L7UA 2F4FA 3FNNA 3TAPA 5E3CA 2IY5B 4K4TA 1KONA 2Z4PA 4QWDA 2ACMA 1EX8A 5CYQB 4B3TF 2XG8A 1VDHA 3IWNC 3HFKA 2CAJA 4ZP9A 2JEGA 1GXTA 2XI2A 3M6WA 4NI2A 3BKUA 4UTGA 5HROA 1HWLA 4CLPA 5HBMB 3A25A 4JI1F 1A9NB 4RW8A 5KFRA 3KK1A 2VBZA 1HNXF 1WF2A 2X1FA 4ZITA 2QC3A 4ZCLA 3EE3A 4ZP6A 5B0AA 2K7JA 2Z2ZA 3U27A 1IKWB 1S99A 2HURA 4QPTA 1Y10A 1D8YA 1SC3B 1YJUA 2D3O1 1U48A 1JX4A 1FFGB 1NKEA 1H38A 1VQ8S 1S9EA 2KYZA 3CJSA 1M6XA 3UN3A 2GO9A 4FPIA 3LAMA 2GA7A 1JJ4A 1FRLA 4ES2A 5KFDA 4DUYJ 4LF1A 2EI5A 3HZGA 2DISA 4CYUB 4IZ6A 1PG3A 3TP2A 4FYDA 3BJYA 1Y7PA 3DLEB 3DRXA 2GQQA 3VHQA 1RT5B 3DDKA 2W9CA 2C3OA 2HQDA 2A6OA 3M2RA 1RTHA 1JMTA 2RUSA 4OL8A 4GVBB 5T8TA 4ILMA 1LXNA 1Q0NA 4IH6A 4C7QA 4KHPC 1JIHA 4NXNF 5BUSA 4QQBA 1MU2B 1DLOB 1GMWD 1RAGB 2AF6A 3PYFA 4H4KC 3TVZA 4FVMA 3RRHA 3D4JA 4NLGA 3L95X 5J2MA 2OPQA 1UEUA 1RY2A 5J1EB 3MTJA 2C2EA 3CF5Q 4F02A 1YQHA 1OS5A 1TUGB 4Q2MA 1CJVA 3T5JA 1N36J 4KC5A 3S6EA 4RU2A 3HF5A 1RT2B 4NLYA 1ROFA 1SIWB 3MM7B 1GPMA 3GFHA 3D5MA 2DPIA 4G1IA 4ID8A 3SCKE 3M8RA 1VRTA 4DL5A 3RU0A 4LFBJ 3SSQA 3KKFA 4LRDA 2DTJA 1FDNA 2CDRB 2JEFA 4LFCJ 3Q8QB 1T05B 4CNYA 2DGOA 4LF4F 2GIQA 3DLJA 3MECA 4G65A 2CKWA 2G2YA 1AFJA 4DUZC 2ERRA 1Y5NB 4K4WA 3CD5A 3HDSA 4DV3F 4ZPCA 2FHMA 2MQLA 3CC7S 4B3MJ 2GZOA 3NBPB 4AL6A 3OSPA 1IKVB 1EHWA 1TUWA 3ENWA 3E7WA 3K6RA 3C16B 4IFYB 4LFCC 2GVZB 4ED2A 1CJKA 5B08A 2CQ4A 4WF9Q 3KNGA 3J7AN 2ZJRQ 5IT9Y 4WP9A 1TKXB 2B9YA 5BYRA 3N6LA 1M5HA 3JTOA 3R5CA 4LF7C 3G8TA 2SXLA 2F8HA 4UOCA 2OPLA 2KRBA 4KGZB 4MIAA 1RTJB 2OPSA 2Q6BA 4NLXA 4ATNA 3TEHB 5K8OA 2UVRA 4DR3C 1K73T 1B99A 1MNEA 1T9VA 2J5AA 3CC4S 4B3RF 5IOLA 3CW9A 1U8WA 2W1BA 2ZUGA 4KIAA 3DI6B 2EFVA 3RB3A 4O3PA 4YOEA 2HFNA 3EZUA 2P2JA 2CDQA 2YWGA 4UZCA 4U8YA 1RHRB 1X4GA 3H4DA 2FJXA 1X60A 5ETRA 4DG8A 1ICEB 1LNQA 2X7IA 3W65A 5F8IA 2HEKA 2MSTA 3V6HA 2G0IA 4DR7F 4ID5B 1HD1A 3FCWA 1HHTP 2E1PA 3H5UA 1T9TA 4HH0A 2WD9A 1WELA 4L7IA 1Q78A 2VZ9A 4B3TC 2IYGA 4IKAA 1DURA 1WD6A 1T5DX 3KHGA 1BXNA 1NM2A 1V5VA 3BB5A 4JI8C 3DDNA 1UJ6A 2HRUA 3FBBA 3I4HX 4ZVEA 1Y9OA 3AA8A 2YX4A 1RAJA 2WVEA 5K20B 1S0NA 1FERA 4P7VA 1RLDA 2VC0A 3GFXA 4ECUA 4H4OA 2DRDA 2FJWA 2UXCC 2F5GA 4TYBA 1HHQA 2W8LA 1RADB 3T1HF 3TW0A 2CADA 5I3PA 4RO0A 1G4CA 4USKA 3KLGB 1Y5IB 1YJWS 4P9SA 3J80U 1GTHA 4RLFA 2POKA 1ZAWA 3FCCA 2PN6A 3OJSA 3A3NB 4Q0BA 2RRNA 3KHLA 5KEIA 4H4MA 1RCXB 5H9EJ 3NS5A 1S77D 3QT6A 3BREA 4U5YD 3UOWA 2M70A 4JI7C 5HP1B 1PG5B 4QZVB 5HANA 4MK9A 1YGYA 1Y0HA 1NSAA 2B8PA 4J7CA 3U1NA 2HHUA 4K8RA 1P4EC 1WHVA 1X5OA 3VNQA 3ICLA 2MHNA 2YXLA 3DN9A 4DPOA 1RTZA 4A8QA 4NCAA 1LXJA 1MN7A 1XERA 1EETA 2ZUAA 5DO2A 2J9DE 3EZOA 2VC1A 1HMVB 4RW7A 5CABA 2HLTA 1VJWA 3GCWP 3O8WA 5I4MA 3GV7B 2JC0A 4GKKC 5HQ8A 2E7WA 2HNDA 2IFXA 2XMMA 3TJAA 1IKXB 4WE1B 2ZH1A 2F4VF 4XX2A 3T1HC 3M2VB 5ADZA 3EMTA 1OSCA 4P6QA 1L2FA 1RWXB 3SCJE 1FWKA 1X9WA 2DCUB 3MCMA 4ZP8A 5LSLA 1RI7A 2W7OA 1RISA 3DU6A 2A10A 2BUNA 2H3EB 2O1PA 1RT5A 2DY9A 3L4BC 3TNVA 2HHTA 2L9NA 2W7AA 3W2WA 4ICLA 2MQ8A 4B3SC 2AYAA 4ZJZA 1UFKA 3LTOA 8ATCB 3OXFA 1WACA 1JLBA 2AGOA 4A8FA 1IVZA 2ZBCA 3FFIB 2GGPA 1PKUA 4QYRA 2JZ5A 1SL0A 4MYTA 1P4EA 2R2UA 4AL5A 2HWIA 4QBUA 2V4RA 4USHA 3GIRA 1T8EA 3SQGA 4MH8A 1EZZB 2FHJA 3W8PA 4UY85 4LFBF 3C8YA 4KGXB 5ETKA 1SH0A 1YI2S 4UOHA 5THWA 3W64A 1TMMA 3OVAA 3UX2A 2Z2LA 4DU8A 3RG6A 2X51A 2QG9B 1RWVB 2X3DA 3U1LA 3CCRS 2DPLA 1R31A 4DR3F 2JEJA 1DBDA 1DTTA 1FVSA 2EFPA 1VHFA 5E5NA 5FDLB 4CTAA 3MD3A 5A8WA 3UVJA 5L46A 4A8MP 3AJDA 4PPZA 5BYQA 3R7SB 2CXEA 3R8YA 2HNZA 3MMCB 3PCOB 2RDDA 3SIPB 3LUSA 3W1YC 5EWFA 1HQEA 1WG4A 4ED3A 4PQUA 1FFWB 1BMQB 2WBRA 3HSZA 1RK8A 4DU7A 1SKSA 1T94A 3HJVA 4ELVA 4HKQA 1CJKB 4DG9A 1DLOA 5MAOA 1XNQF 3BGFA 5J1NA 4R0MA 4O44B 2APOA 2VQEC 2V8PA 2HK3A 3LP0A 1QDUB 3HKWA 3K5PA 2XMJA 2FUG9 5KAKA 2V34A 1K9MT 2VQFF 1FXDA 1KFDA 3W62A 5G0RA 4OI1A 2RKIA 3MMBB 5KFVA 1FKPB 3C3LA 1VQ5S 1FRXA 1TUVA 2MPUA 3FCHA 2HQ3A 4DPTA 5KT6A 3QZ7A 3PY8A 2IC3A 5A2QU 1QVFR 1U1QA 1BQNB 3UW1A 2E8CA 3NAHA 1TL3B 1C4AA 4JI5J 4K0KC 1R0AA 1SQEA 1SI9A 2M88A 3IBCB 3EUNA 1PJ7A 3AD9C 3W63A 1TK8A 1C0UA 4LF5J 2VODA 4PUIA 1RZMA 4ANEA 3FRYA 5L1KA 4C8OA 3MI7X 2BJ3A 1SUQB 2XEXA 4P73A 5GAHU 1DJ0A 3D6MB 3QIPA 2WB1D 4Y6IA 2RHQB 2B6AB 2IJNA 3HHLC 4ID5A 4PYAA 4LF5F 1CULB 2F1FA 1S1TB 2AJ1A 1H3DA 1MWZA 2G2ZA 4TNOA 3WQPA 5MLCV 4OX8A 4RNMA 2RU3A 4AQYJ 2RS2A 4NA1A 4FYYB 2RSQA 3HHLA 4E0DA 1PU1A 1FRHA 2YPZA 4ZVRB 1VRUA 2OH2A 2IAJA 2LDIA 3CVKA 1MMLA 2CQ0A 4J9NA 4IOCQ 5FJ4A 2LU1A 4P2MA 3RB4A 1RLCL 1UZHA 3LALA 1Q7YT 1D0EA 3C2PA 3OXGA 4FF4A 3DGPA 4CO2A 1E6VA 2DBBA 1KVKA 2QX0A 3Q83A 4NPOA 5CQGA 1G6BA 4X62F 1UL3A 4FS1A 2LDYA 1NUEA 1SQFA 1NDLA 3OR2A 4GKKF 3H5SA 4DR5C 2ZHOA 3GP9A 3OQ2A 1X4EA 4ZS6A 4IRDA 2KFNA 2HIQA 4F2SA 3FRZA 3DRRB 1PIEA 1YJ7A 4DV6C 3SQOP 3MMAB 4MK8A 2BE2B 4MTNA 4LFAC 2DGQA 2GFFA 4WTOB 1RAAB 2HWHA 3FZ2A 3HHKA 2LKZA 4PXEA 2MDAA 4W98A 2MMYA 1VMBA 4YDXA 3NCPA 4DV6F 2M8DB 3JSMA 3BGRA 4MK7A 4KAIA 1LW2A 4L76A 5A8RB 3UDEA 1RBAA 2OGUA 2W2QP 4C0BA 3IP0A 5L9NA 1SPBP 1MDFA 4L72B 1USPA 5H9UA 4BSZA 4WU3A 5KFGA 1SJQA 1SJ1A 2HZCA 4OFZA 3VGSA 2OEJA 3L7PA 4UY8T 3K0JA 1N0VC 1BY9A 3H42A 3BN7A 3DMJA 5ETNA 1JXLA 5HL7Q 2CVEA 3R27A 4J9OA 4NLTA 2DXDA 1KHVA 3EGVA 3RW7A 4DSLA 1S59A 3LWMA 3CDWA 2EPIA 3C6TB 3Q8PB 1HWUA 3CJ8A 4ZCIA 2XS5A 2PN2A 3RB0A 3A13A 3PFOA 2UUAJ 2CXCA 3KOAA 1N48A 1HYSB 2YQ0A 2RB7A 2ASBA 4LF4C 2R7TA 4R8UB 4FKYA 3TQIA 3IRWP 4JYAC 1D8ZA 1S1VB 2IRUA 5HMXA 1A7GE 3U1MA 2C2NA 2D1SA 1SJ3P 2EC2A 3A9UA 3G6YA 3P5BP 1C1CB 4PUOA 5HJYA 1QSYA 4DG1A 2ZH5A 1TK5A 3I6PA 4DX8H 3V6KA 3Q23A 1AXQA 3GPAA 3DLPX 2GO8A 2C3PA 4UW2A 3I0SA 4B9MA 2P9GA 1AMUA 3E8OA 5LMUF 2EFOA 3B54A 5KFOA 2DHHA 4KE5A 1HD0A 2GAHC 4B9SA 3OL9A 3HVTA 3KK3B 3M30A 1FEHA 1NH8A 1NK9A 1HMVA 5KT5A 3OVSA 1M5VC 4JI0J 2R4FA 1EAYC 1XK8A 4IDKA 2BOAA 1SC1B 3MD1A 4NI2B 2XI3A 1YBUA 5T7LB 3KLHB 2C2ZB 3DXBA 1X4FA 2MKCA 2C3YA 3LGHA 4M5IA 5DDQC 3M2VA 2V9WA 1W7WA 4C97A 2FC9A 4JI0F 1L3SA 2GIFA 3GLJA 4YR3A 4K4XA 3EYZA 1P1TA 3ILLA 1KVJA 4PXDA 3B6BA 2F63A 1H0HB 1N36F 2IM1A 4OHWA 3CJTA 1OSDA 3THPA 1SKUB 4A46A 5C5JA 2XHWA 3R7NB 5HMYA 2JLEA 3PZPA 3TARA 4TVAB 2Q66A 2E5LC 3AA9A 2IPOB 3OD2A 2Q43A 3NY0A 1UCNA 3HSGA 3VVTA 2UUBC 1NRKA 1V60A 4RW9B 3CCVS 1RAFB 4WKRA 3PBKA 4R1LA 4ELTA 2E1AA 2W4PA 3TA0A 2XMTA 1UVIA 4KV8B 4MKYA 3TZZA 4WCEQ 1O9TA 1K44A 1RWKB 1WOPA 2ILYA 3MEDB 4MAKA 1M5PC 3D6FB 3QGIA 1LFWA 4ZLNA 2XO6A 2HBRB 2ADCA 1NAQA 1NHKL 1O5JA 3GIIA 4DV5F 3OTEA 3W9JA 4DLGA 5D78A 4LQ3A 1REVB 2YWFA 4USWA 1IBMC 1RUSA 3O2IA 1HIYA 2DH8A 2B9XA 3HSJA 1F6TA 4IH5A 1RAOA 2WONA 3G2XA 2K2PA 4N8NA 5D0GA 3DNCA 1CLFA 3D0IE 3K7RA 1TR0A 3TAQA 1S1UA 1Z1ZA 2DR7A 2VONA 1P7LA 4U7UK 4J90A 4DV4C 1HQUA 2J0QD 1HW9A 3NYQA 2OKQA 1N0UA 4R5PB 1IBMJ 2CPJA 2LQ8A 1XMBA 3JXOA 3OTOJ 3DLGA 1RCOB 4CH0S 2ZBQA 1WOSA 2MKIA 3I56S 1T05A 2A6MA 4ZPVR 1D1UA 3U7JA 5C25A 3CC2S 2XR1A 5IT4A 4MT1A 4X64F 3ILJA 2JC1A 2EFGA 1NB2A 3HHLD 3QIPB 4JUZA 1DTTB 2B4UA 2EBGA 2UXBC 2UUWA 2QYGA 2W2NP 4I6WA 1N5SA 2AJFE 2Z30B 2PI5A 2DYJA 1VS3A 5EDWA 1TKXA 3J7ZT 2JRSA 1M1KT 2QV6A 4WFBQ 2FHKA 3KUHA 5A19A 2UZAA 2DNRA 3C6UA 5KFSA 1LW2B 5A8RA 3ZTQA 3BSAA 5CYJA 5KFEA 4DV7J 1GXLA 1NDCA 1IBLF 4FF3A 1AZSA 3J80Y 1LV5A 2KDNA 3EM1A 2ALYB 1VRQC 2DHXA 2YKPA 1FEEA 4OYAA 4CLYA 4EYHB 3EERA 4ZJLA 1UWBB 3EZ5A 1I1GA 1WG5A 3AHPA 8AT1B 1FA0A 4ZPTR 2QVXX 1VC5A 2BJEA 1PAUB 2EKYA 4CLUA 5DJBA 4O3OA 2R42A 2ROGA 2PO4A 2GVZA 1X4DA 2H5JB 2RMLA 4I6AA 5ITHA 4Q8EA 1HYSA 5EGYA 3QSYB 1KN6A 2F9DA 1O8BA 3MCNA 2R7VA 2HBQB 4LSNA 4JV5F 4ECXA 2BW2A 4C8LA 2CPIA 4HH1A 4L74A 3M6XA 1TK0A 4DR6F 1XMQJ 1CVJA 4RNFA 3TJ9A 2Q1LA 3PV8A 4GKJC 4DSFA 1MMNA 1Z4UA 3CD6S 1RKIA 1HI1A 2HHPA 2XM3A 5K8MA 5J2NA 5KG0A 2WHOA 3ILOA 4KB7A 1VLAA 2ATCB 3NGSA 3QT8A 3G8SA 3TUZC 2JDJA 5ETSA 1UZDA 2ZH7A 2ZD1A 2VZEA 2DNGA 2H9ZA 4CLFA 5B0DA 4DX5A 3I08A 1UVLA 2WTFA 2KO1A 1IBKF 2KJVA 2PDAA 3FQLA 3R5AA 2AWZA 4KT0C 2MEWA 2OEKA 4Y65A 3IC1A 2HHHF 5E7OB 1ML8A 5D0EA 4AT1B 4NCGA 1RAIB 2BANB 1B7FA 3PRDA 4LFAF 4PROC 3RW6A 1JLAA 4OYIA 3BS9A 3FEXB 1LWXA 1EQ0A 4FDFA 5KT7A 1OY8A 1YK9A 1ZM3A 1M1GA 1KR4A 4LMZA 4U7UD 2BW7A 4TYAA 4DR1C 1KQFB 3D7SB 4OHZA 4A8YA 2YNHB 3EGZA 2ZBRA 3LUYA 4V19X 3TR5A 2HNDB 4CLTA 1X4CA 1SCJB 1WWHA 3E01A 5I42A 3CD7A 2GVDB 4M63A 1B0PA 2MHEA 2W2MP 5IT0A 2V8HA 2D41A 3W8GA 3C5EA 2FVRA 2N3OA 2K06A 1KQKA 2BXJA 2V50A 4KV8A 4KPYA 3OPKA 2RQKA 3B7WA 1FHTA 2D9PA 3SYZA 2HHXA 5AXKA 1S1WB 2GHVC 2ZE2A 1M5KC 1AFIA 2VQFC 4I7FB 3VZIA 5IFMA 3N9UC 1NJWA 4A8WA 2W9BA 3UWTA 4X65C 2OFGX 4HYKA 1K0VA 2ZM6F 3CJ2A 5DZ7A 3K5MA 5HAOA 3SQGB 1VQLS 4ZIVA 2D9OA 4Y34A 5KFAA 4A8XA 2EW9A 3BGOP 9RUBA 4ZLPA 1QAJA 4P72A 5ETTA 4CO1A 1GEHA 3NMRA 5EX3A 5HQMA 2Y1LB 4ZVHA 2UUBF 1WEXA 2HKEA 3BKTA 2L41A 1XNRC 4AE5A 3W2WB 1ULRA 2MYFA 5F41A 1HBOB 4NA2A 3ADAC 2GAGC 5GADI 3J7YU 1IR2A 1JLFB 1U25A 2RU9A 3GJSB 4DJBA 3R3TA 5EWGA 3NOCA 2BDPA 4M95A 3Q8YA 1S7IA 3S82A 2QA4S 3VGVA 4NRTA 4RR5A 4ZPDA 1XNRJ 4C9DA 3ZZTA 4PQUB 2Y4OA 4OI3A 4AUKA 4NLOA 4QR2A 5IV4A 3Q0AA 2RDIA 4DR2F 3O6QA 4F7VA 2H4WB 7AT1B 1HNXC 4DL7A 2KTQA 2ZHAA 3ETMA 3D9BA 5GMKa 1FJGJ 3RV2A 4WYLA 3ZZZA 1KP6A 2V9KA 4J9KA 5D4OA 1RU1A 3J81Y 3BKFA 3H40A 4LT6A 1H2VZ 1S1UB 2IRXA 1MW7A 2P9EA 3H2UB 3I0RB 4ZOSA 3V5RA 2ZH6A 2FJDB 2GJ2A 3KNAA 2BBEA 3T9NA 4NEYA 4RW6B 1FUGA 5KFZA 2B5JB 2KRRA 3PO4A 4DBQA 4WIIA 2Y8YA 1AROP 3KK2B 3TJ8A 1CC8A 1R43A 3AODA 3M1VB 1IKYA 3Q89A 3SSSA 4DCPB 1PC4A 3MPVA 4ZCMA 4DV4J 1HNZJ 2DR5A 4CT8A 4HLBA 1QE1B 3CCLS 2D3ZA 1ZZFA 2ABYA 2CG4A 2MY7A 2WZ1A 2ZNZA 3FBCA 3UN5A 3GQCA 1PG4A 3I32A 4I6YA 3DOMB 3A9VA 2NXNA 1R89A 4ALZA 4DL3A 1QAYA 3SCIE 2DO0A 2HHVA 4WFZA 1YJ9S 3DOLB 4PG6A 1S6OA 4N8OA 2Z58B 4IYQA 1BGXT 4FPRA 1PILA 1X9SA 2R7OA 2LECA 1R3NA 3QRQA 3G96A 2IM2A 1OQ6A 3QLHB 1U0HB 2DIUA 3SMZA 3C6UB 2E9TA 1CC7A 1GT8A 2UXBJ 3QFWA 2BVZA 4PQAA 2IJRA 5A1IA 5IZHA 3IRXB 4OZNA 2DGVA 4OYWA 4I64A 2OJ3A 1RU2A 1C0UB 1NMEB 1K8AT 2YWKA 4ECWA 3GR1A 4U8VA 2UUCJ 2OD6A 3HI9A 4CO3A 4YR0A 5KFYA 4DSEA 4C11A 1XMQF 1Q7LB 4DPUA 7FDRA 4OV1A 4ZLLA 2V2KA 2IVYA 5C42B 1GH8A 2KT3A 2HVIA 2ATWA 1FESA 4WXOA 2HVDA 3UD4P 1ZTTA 4K50A 3MM6A 3C14A 1QJHA 3B4MA 5AE2A 1P9YA 5D3GB 4NZ6A 4RWXA 5AXNA 4OZ3A 1U1NA 2FJVA 4K0BA 1TKDA 4DV5C 4F26A 1DARA 2IMOA 4JV5J 1TTHB 3F0NA 3K89A 5CCLA 4ECTA 4CLSA 1XR5A 2OD4A 1YHQS 2CQ3A 1UETA 2XTJP 4K59A 5F8LA 3K59A 4F04B 3E51A 3OR1B 2HWTA 3GSIA 4DSKA 3FMWA 1KSPA 1U2CA 2BANA 2QA1A 5A76A 8RUCA 3MR2A 1RE1B 2XYHB 2B9WA 2VUGA 2EVZA 2YKNB 1LWCA 1WDTA 5A2QY 2AJQA 4LF5C 2DR9A 4CLWA 1S1WA 2D74B 2Z0GA 2NXUA 1U7LA 2QN6B 5HVHA 2MLYA 2B4PA 2FJAB 3KHRA 1HR0J 1T11A 2RVJA 4ZVQB 1GQEA 4URGA 1IB8A 1U0SA 3JYTA 4NEZA 2Z2YB 2J0XA 4I2PA 4ZJQA 2MZRA 4DV2J 1C1CA 3UD5A 2GIRA 4PUOB 3IG1A 2B51A 2F3JA 3SBMA 1Y11A 4QIWD 3E7XA 4MIWA 4F0KA 5HI7A 4I68A 5B0GA 2MKSA 5F0UA 5KFMA 3BDPA 1F2HA 4OMFG 4OX7A 2D69A 3M2RB 3JAMD 4M5JA 1WDDA 1NHVA 3C46A 2W24A 4P2XA 1VK8A 4DMZA 1CBKA 2G1HA 4RBUA 3KG1A 1JJ2R 4FVCA 3KLHA 2KZMA 3TDEA 2AX0A 2COLA 1U1PA 1SB6A 2GVDA 2D1CA 1UEKA 1JLEA 2BEFA 1WC6A 4P7TA 1IKWA 2ZNYA 4RUHA 5LSOA 1RT6B 1BUXA 2V68A 2DNHA 1NJZA 2DKOB 1N5YA 3FEYB 1J2VA 2B43A 2ZOGA 3DCAA 3M32B 3QMQA 3BYPA 4OI4A 3V6DB 1ITPA 1WEYA 4KQZA 3RAQA 1RT3A 2NCKL 3L3CA 5K9FA 1APSA 2E44A 5KFNA 1G1XA 4YY3C 1IM6A 1RT4A 4WFXA 5L39A 5JUMA 4TU9A 1DFDA 4DCUA 3F44A 2W9BB 3QGPA 2LXIA 2B5JA 4C3LA 3KHHA 1ZBTA 3NL0A 1J27A 4OJGA 4OYBA 1LQLA 2KXHA 4J9RA 2W8KA 1S0OA 2P20A 1N6QA 2UXCF 2IM3A 3T5HA 1S79A 2V5HG 3ZTSA 2IVFB 1EP4B 2CJQA 2DITA 1HL6A 3UQSA 3EX7B 4TQSA 1UVNA 4WKYA 2VA2A 5B0BA 2R7UA 1PAEX 2HLUA 2CWKA 4LIRA 4LR9A 5CD4H 2FY8A 4E2FB 2WCXA 1MU2A 1FNMA 3AXMA 3LOUA 1RBLA 4LVNP 2XC9A 4EBEA 4ZVGA 2BJ9A 4RZRA 2MM9A 1RTHB 2C2KB 2MGZA 2X1AA 5B0FA 3O3LA 1F3VA 1M0SA 1GXUA 2DB1A 3VVUA 2XMVA 3EVOA 3BF4A 3UO0A 3KG0A 4ILRA 1OPZA 3D28A 3DRPA 3ILIA 1XIQA 3NOGA 4HACA 3PJXA 1N32C 1RSCA 4WFNQ 1U0HA 4ZN1A 4O0NA 4BDPA 1V9OA 3C15A 4R25A 3AQOA 4U67Q 3CJKB 2B4OA 4A47A 1S9FA 4X4VA 3DGPB 2EKNA 3LQVA 4ED6A 1BA3A 4EBDA 3JTNA 4U9RA 1T9WA 3GCXP 3FUYA 2DH9A 3LP1A 4M5HA 4NMLA 5F8JA 4CDIA 3LGNA 4EO6A 4RUCA 4FYWB 4LF7F 2CG8A 3QAEA 3AD7C 5HJXA 3BQ2A 2F8MA 1NK6A 2NUUG 2Y3YA 4OHXA 1CPZA 1IBKC 3IBWA 1ZA2B 3M9MB 2HMIB 3DI6A 1R27B 1UA0A 2DNPA 1EGAA 1WF0A 2VG5B 2KM8C 4DZ6A 3JSMB 1NCLA 3D2WA 1C1BA 2VG7B 3AJ1A 4KGKA 4RL1A 4ECQA 1M5OC 2QFIA 3FQKA 3MDFA 1HBMA 5J1PA 4IG0B 1R8AA 3I0RA 4DL6A 2YX1A 3VGUA 4DOZA 3SI8A 3IEUA 3A1YG 1H74A 1X0PA 1IR0A 2D3UA 2GQ2A 1FD2A 4B9VA 2GMLA 1CG2A 1RTJA 2DYAA 1UAWA 2J6TA 2CQHA 2NR0A 1BD6A 4JI8F 1SL2A 2P6TA 1S1XB 3HPOA 3DHXA 2E5GA 1MDBA 1FO1A 2OSQA 1S76D 2LA6A 1RP5A 2C3UA 5JVGQ 2LMIA 3CT9A 4AQYF 2UXDC 1CJUB 2CZVC 1UWBA 2M2BA 3PIOQ 2ZFHA 3X1LB 3R6LB 3HZEA 1X5PA 4N56A 4JI3C 3WC2A 2VDHA 4WU2A 4M5LA 3SZ2A 1BLUA 3D1HA 3EWGA 3QFHA 3UCGA 2C2DA 1NK7A 4DS4A 4MKBA 4DR7J 2J7KA 5LJ5Y 3KLIB 2KJWA 3HJFA 3HKZD 4ED1A 2OLWA 2LQ5A 2WW4A 2R7XA 1UJ5A 1TVRB 3IFEA 4P74A 2JLFA 1KEKA 2NSCA 2VFRA 3KJVA 1AUDA 3D3CJ 3PM9A 3P6YC 1RA7A 2HHSA 1HKAA 2QO3A 1HNWJ 2VH7A 3MAHA 2V2ZA 1HH2P 2VSQA 5IS2A 1F9EB 2HVHA 1OY9A 3CCTA 5C42A 3EDRB 5EHHA 1VC0A 1OPIA 2AJ4A 3OBIA 1F2GA 3P5TL 4MKAA 2FHOB 4A8KA 1FXLA 1N34F 4JB8B 3TUPA 2AMCB 3CWJA 4NLQA 2VOPA 4TQRA 1VIXA 2LU2A 4JV1A 5C2GA 3MM8B 1NBEB 1VFJA 3KFWX 3D6TB 1MXCA 4TU8A 1UVKA 4JI6C 1DAXA 4KYZA 1X4AA 4ZVFA 3E01B 3ET6B 3UI3A 5I42B 3PJ9A 5HVFA 1JK9B 4RX6A 5F3TA 1OWXA 2V94A 1K1SA 2V63A 3H25A 2C22A 2CU6A 4UOFA 4ICLB 4MH4A 5DRKA 1TV6A 2UV8G 3NNAA 4RUBA 5BSUA 3SO4A 1XMQC 3NS6A 4NLPA 5KFIA 3PKYA 2E5IA 5HMZA 4MTPA 4YP3A 3OUYA 3M8QB 3VWSA 2YBVA 3W5ZA 2DNLA 1LQ9A 2KU7A 3A12A 2JNJA 2XMAA 4LE5A 1GTEA 3LP0B 4GXRA 2OBVA 3PACA 3OFEA 4WZQA 5DQGA 4X2BA 2KZ0A 2LXUA 2B9EA 2OSRA 3RG2A 3O44A 3MURP 2R7QA 5FD1A 5FDLA 1RHKB 3ZZPA 5KFQA 4IG3A 4XIUA 1U26A 1U6FA 5ETQA 1XNQJ 5CXTA 2YKMA 1QVGR 4FNHA 3PEJA 3TUFA 4ETZA 4F4WA 1A0OB 1IM4A 4HTJA 3NCQA 2D1RA 4ECZA 4RNHA 4DR1F 5LCIA 4N41A 2LEAA 3CCWA 3LPEA 1VQ7S 4PG7A 1KC8T 1RHJB 2LFVA 4WP3A 1N32J 2C2MB 4K4ZA 3UEBA 3ZZ0A 1WSVA 1EQMA 1MLAA 1XNQC 1PYSB 4NXNJ 1HPZB 2Q3PA 1RT1B 2A2DA 4DR1J 4MFBA 2DT9A 5G0RB 4KTTA 3MPWA 4JI5C 4DDFA 1H7WA 5A2QD 3MM9A 4FXWA 3Q22A 3LP1B 5G4DA 2Y1IA 4LR7A 3K5NA 4H54A 4N77A 1B7YB 4O4GB 3CJKA 3CO0P 3FBFA 1UFWA 2QMXA 2YWHA 3F56A 4J9MA 4ILLA 4EWTA 2N7YA 3VAMA 4PG4A 4ANCA 4CM2A 3MFIA 3DLLQ 2YKAA 3QAUA 2CNKB 4NL5A 4RNOA 4HDGA 4R0EA 4BCAA 1T3OA 1C1BB 2VG7A 4W90B 4LFBC 1PO6A 4EK2A 1R8HA 4O44A 3OL7A 4F50A 5SUHA 2MJNA 1S1TA 2N3LA 4GKJF 2EGTA 1XQIA 1Y3JA 4C3MA 3CMES 1SUQA 3KJQB 3QO9A 4F36A 1BQNA 2ASDA 2HJGA 3J81D 2R8JA 3PXGa 1MN9A 1G7CB 2CQ1A 2WAQD 3QIDA 3OTOF 4B3SF 1HWIA 1CULA 2AW0A 2W9CB 2R2SA 1KHWA 3Q8UA 1PCAA 2HNYB 2LEPA 4Z37A 3VAIA 2OPPA 1FJEB 2J6SA 2DGWA 4LIWA 1BC6A 3GMGA 1V25A 2YNIB 1TL1B 4M5MA 5BR8C 2GMJA 2RIJA 1T03B 4LF6C 4IOBA 4A48A 2HHWA 3O1LA 5JRHA 2JFKA 3BN4A 3P45B 4PEOA 1RWMB 4ZHRB 2H1YA 1GK8A 3KLEA 4LF7J 2U2FA 3PRBA 3H4BA 4ZN3A 2RQ4A 2CNOB 1SH3A 3DRRA 1YZ6A 3H5XA 4DV6J 2P2FA 2QVYX 5A1GA 1HA1A 1YJTA 1QUPA 4OIXA 1WC1A 1NYEA 3WIUA 3GYNA 4HVZA 1VEHA 1AT1B 2FJEB 2BYCA 4JV0A 2HAFA 3T5KA 3CDUA 3S01A 2Z56B 5J2PA 4K7QA 1YIJS 1O90A 4RMNA 4YQWA 4DFPA 1W2IA 3AOBA 3HHLB 4ECYA 3SEOA 1S9GA 2FZGB 2V0NA 2I5JB 4PAAA 4D4IA 3DKDA 3LAKA 3NCRA 2LP4A 2KXNB 3ZZYA 2DNQA 1YKWA 1KS2A 4JI8J 2YQ3A 2AJ0A 2VG5A 4KSEB 2GC8A 4CLLA 5K8PA 2KG1A 4LF9J 2RJZA 1FJ7A 3AFGA 3Q2SC 2CPXA 1NJYA 1SH2A 1HBMB 2CJAA 1UW4A 4HHUA 3VAKA 3KTQA 1UTAA 3C6TA 2CQBA 2BA9A 4X62J 2VKRA 3PFEA 1R6VA 2PEBA 4K5SA 5BSRA 4LR8A 1LWEA 2GHPA 3M8QA 4L3KA 2MXYA 2CVIA 4XDCA 3CCUS 1RJJA 2O01C 3H2TA 3EGWB 4DV0C 1NZAA 4JV2A 4X4PA 5CH7B 2NYIA 2J6UA 2IDLA 3EDQB 4FYXB 2WSCC 1Q8KA 3CJEA 2QSWA 5AXLA 3LP2B 4OJHA 1Q82T 5KFTA 1AYEA 1NKBA 4JI7J 4NYPA 3RUBL 3NGDA 4J9SA 4M1KA 3OUYB 2ROEA 4YHHJ 3I0SB 2HS3A 3OR1A 1D9DA 4OZ0A 3OJUA 1R8CA 1CQMA 4ZVUB 2KFZA 3OFGA 1N52B 1LWCB 4Y2CA 1FNOA 1J5EF 3K8WA 2QLXA 1JNZB 2UUCC 5L1JA 2CQCA 4OQJA 3B82A 3JSRA 3UN2A 7FD1A 4QWAA 4E8UA 2DVIA 4K2XA 2J8AA 1GMUA 1IWAA 3DRSA 1TZ0A 1NSKL 2LYVA 3TQEA 2JFDA 1HPZA 2UUBJ 1HWJA 4QIFA 2E5LF 1QUVA 3UCZP 3T6JA 1ZAVA 4DFMA 3QJJA 1WHWA 3HLUA 1DZ5A 4Q44A 3CIMA 3TWZA 4JI4F 4N76A 4CI0B 1NHUA 4NDNA 3BEGB 1S4EA 2AQ4A 4RVNA 1QWIA 2NXJA 2BKPA 4RW9A 4KHPJ 1CS4A 2HQCA 2HAIA 3PNIA 5E3QA 4DCOB 4DPXA 2YKMB 5K8NA 3MPDA 2HS4A 1UFLA 2XMUA 1ZM2A 5EUHA 4CO4A 1VQKS 4K4VA 1V26A 2YQ1A 4KTVA 3M6VA 5HVGA 2A3JA 5KFUA 4ERDA 4MKVA 5BSWA 3I5AA 3IWXA 1S6QA 1RT4B 2VBYA 2WBMA 2VPYB 1NSQA 4QJVA 4ZKAA 1QAIA 5FLXY 2CWXA 1U4BA 1FF2A 1Q5VA 3JTPA 4M5GA 1XRCA 2Y8WA 2KI2A 4CO5A 2PD1A 2G13A 2JSXA 3H90A 4CT9A 4HPVA 2IYIA 4NZ7A 2DY1A 4YUDA 3KDOA 4KGMA 3PR4A 1FLOA 5LL6d 3Q86A 4XK8C 4CRJA 3DLHA 3NNHA 3G6XA 3LF0A 1M90T 2HS0A 4S0MA 4HHJA 2VPXB 4N5SA 3MR3A 2ZHBA 1QSSA 4G37A 1M1HA 2IRYA 3KJFB 4CLZA 1VBYA 3ITHB 1HNZF 2L08A 4OZ5A 2KHDA 2KZFA 2MCQA 2XZDB 4FBTA 3UZ0A 1HBUB 2CQ2A 2NUHA 2ROPA 1BQMA 2WK4A 4O3NA 3TEGA 4C0HA 1N56A 5HLFB 1U1OA 3MEDA 5A6WA 1QTMA 3MM7A 2AD9A 1JKHB 4A8OA 2VFTA 3AB4B 2HNYA 2MKHA 4YN3B 3RZAA 2C3MA 2OPPB 3DU5A 4HR2A 5C25B 4RVOA 4P2FA 4CQ1A 4B9UA 2OPLB 1U47A 4IR9A 1TL4A 4RWWA 2E8FA 3HXMA 1N88A 2CNLB 3DLGB 3QT7A 1LCIA 3ONQA 3OTDA 3LAXA 4LF8F 3TI0A 2PT0A 4WZMA 2QEXS 1FTRA 4XDDA 1SBRA 4XPCA 1IKVA 3NGKA 2WVCA 5T41A 1ZYQA 1N34C 2LXFA 2J76E 3ZTOA 3T1YJ 2JMPA 4DR4C 3ENVA 4LRCA 4P10A 2MKKA 3HHNB 2YX7A 3IGVA 3LA0A 2M5HA 2UU9F 4F4ZA 4HHHA 4PWUA 1SV5B 3RAMA 1RBOB 5J2PB 5DDOC 2D3OR 2NZ4A 3G7SA 3C66A 5D15A 4QCLA 1T5HX 4Q5VA 4DUZF 1X5TA 1O92A 3SSRA 2LCWA 2AU0A 1ZB8A 3ETCA 4LSZB 3RB6A 1S5ZA 5A6PA 2OPRA 2VICA 4DV1C 3DYAB 1FDDA 2XLJA 4C48A 1Q4RA 2X1GA 3P4UB 1VHIA 3J81j 3HX9A 2Q6CA 4DV4F 2HFZA 4M5DB 2GMHA 3AF5A 1AA1B 4L2ZA 2F40A 3TOQA 4B9TA 1JLQB 2QMWA 1RWUA 4PPDA 3KLEB 2FLNA 3GONA 4QU6A 3FSIA 3N2QA 5BUQA 3GSDA 4X65J 4FF1A 1S12A 1ZZNA 2BE9B 4WK1A 4GC7A 5DS7A 1TU0B 1WJ9A 3AXKA 3K8VA 3QT5A 1HWKA 5ETPA 2I0XA 1NZ8A 2CPFA 2MZTA 1F9FA 2BRKA 2KT5A 2ZKTA 3SFGA 1IBLJ 2M0GB 3CQ1A 3KJNB 2M5YA 3NLCA 3P8BB 1I3OB 5BSMA 3JQKA 2DNYA 3N01A 1IBLC 3GG1A 2QMUB 4EZ6A 1S9GB 2QL7B 4MYUA 2QGFB 3DRSB 4TY8A 5HO4A 4G1QA 2ILZA 3W2VB 3IA0A 2CPEA 1NB7A 1JLBB 4TLRA 1WCJA 4C8NA 1VISA 3TANA 4JI2C 2R8GA 1DQ9A 2KYXA 4ER8A 4X66J 3NI2A 2L3MA 2AEFA 3GYXB 5HBMA 2B7CB 3RBEA 1JLAB 2DGXA 2HQIA 5ETVA 1BQXA 3PX0A 1LFPA 4NLDA 2DK2A 4ITSA 3K57A 3KUEA 1RT6A 2A0FB 3PX6A 3G8QA 4F3MA 2I1RA 1NKCA 2F7VA 1NK8A 1X5SA 3FMBA 1J5EJ 2FJBB 1JB0C 5DQHA 4JYAJ 5A8WB 2G2OA 4CTAB 3K5LA 4ENOA 1SQGA 5KOWA 1HNIB 2AKWB 1LEOA 2ASYA 1W2BR 2AX1A 3RTVA 4C3KA 3RBDA 3TVKA 2F4VC 3SXLA 4IOAQ 1J5EC 3I55S 5BYSA 3V81B 1NDPA 2YNHA 5E2QA 1RDRA 4OZ1A 2E5HA 4WFAQ 2CQGA 1P6TA 2HSEB 5DLFA 2ASJA 5KTQA 3EQ6A 2E1CA 2V4JA 3CJ4A 3LNVA 4YHHC 1SJFA 5FLXD 5DGAA 1FRMA 4LFAJ 1PJ5A 1U49A 5LMUC 4OJ3A 1HBUA 3PRVA 2AV5A 5BR8F 2CJ9A 2OPQB 1YWXA 1VQ4S 3TUIC 2I8EA 5K8FA 3TA1A 1DQAA 4J9UE 5C2CA 2CQPA 1RXOB 1LOUA 2KVQE 4HEA9 3O5TB 3HM9A 1FWPA 1RG9A 2CJBA 1JLFA 2JOQA 3MTKA 3MAQA 3F73A 3MWBA 3BO2A 3MFHA 1VRTB 2IHR1 4USJC 3BH6B 3VTIA 2PIIA 2XCAA 3MGJA 2ZDOA 4JOUA 3Q8VA 3JS9A 1WKJA 2VBWA 4NASA 4OLOA 4DHVA 4EI2A 3DRPB 4HACB 1XRAA 1NK0A 3VV2B 3E2EA 4ZVPB 4UZBA 2PGCA 2L9DA 1EIYB 1S49A 2OTLS 1NNDA 2ZH2A 3VF0B 4YY3F 1SV5A 1NY8A 1VQSA 5AE1A 1MROB 3GILA 3DOKA 3JAMY 3ZNUA 2H4YB 2NXEA 1HQEB 4K5RA 1UPMB 2BJ7A 4ISBA 1T95A 2MQQA 1XHJA 1FDBA 4URSA 3H2LA 4O3QA 2B56A 3DYAA 3N4WA 3VCDA 4J91A 3R44A 5KT4A 1VIOA 4ZK7M 3IPLA 3HHEA 1U2FA 3R5DA 1WHXA 4HT7A 3MAAB 4NLRA 3V4MA 1JLQA 3HSDA 1VQYA 5J2MB 1QAXA 4EFAC 3FKBA 4DX7A 2IBKA 2CY1A 2CPHA 1FCAA 1VQ9S 3UNYA 5LSRA 1YG0A 2OPRB 3DFEA 3OHBA 2ZOFA 5DG7A 4MFBB 1UJ4A 3MF5A 5KG1A 2UUTA 3OFFA 5GMEA 3VAJA 1BE4A 2MZJA 4X64J 1XNRF 1KVIA 2QLBB 4J37A 3MCSA 2XO7A 4KTQA 4Q8FA 3GIKA 3MOJB 4FXVA 3EVMA 3OL6A 3HFVA 3R1LA 2OMLA 4CIOA 4Y2AA 4NXMJ 2G4BA 1HQ2A 2E9ZA 3NAIA 2O66A 2VFVA 3M6UA 2UUCF 2BH1X 2BRLA 4X4OA 4DV7F 2FYXA 1P8GA 2VASA 3NBPA 2RNEA 3T1HJ 2QE5A 1RACB 2O5DA 3GZ7A 3PG9A 1JKHA 1TFYA 3EVWA 4LF9F 4DR6J 3R9WA 3P96A 5IWAC 2PI4A 1RGVA 1T9UA 4DL0C 3OLAA 1F0XA 3HMJG 1TL5A 3PTWA 5CHCB 5ETLA 5F9LA 4DR5F 4DF4A 2YKOA 4TY8B 4B3SJ 2QTWA 3QO9B 2EXUA 3ULHA 3MUMP 1KKGA 3BQ1A 1DY3A 1TVRA 2OI2A 1PYOB 2KN4A 1YSJA 2PE8A 2QL5B 3FC9A 2ZC3A 3PYEA 3FZBA 3R6GB 5IWAJ 4G1PA 2GCFA 5F9NA 3IBFB 3D67A 1KOOA 2I6WA 1H72C 2G9OA 4DR2C 3IRXA 3A4TA 4DV1J 1N8RT 2JVOA 4TXSA 2VQEF 2AYBA 1Q5YA 2VFSA 4D3GA 5KT2A 3B8HA 3QBCA 1RTDA 2KFYA 2GX8A 2ZBIA 2VJVA 1VI7A 2Y27A 3TZWA 2AEJA 5AT1B 3G71S 3D0HE 4R0JA 1PBUA 5IQ6A 3GFYA 1REGX 4OV6A 2PA8D 1WH9A 2WSEC 1N54B 1O51A 1Q79A 2IJFA 3I4PA 2NYHA 1GFWB 1FT8A 1Z2LA 3NGTA 4QR0A 4WJBA 3ZNJ1 4NXMF 4KFBA 1YTYA 3ET6A 5BSTA 1XN9A 2H48B 1MWYA 4PXBA 1JLEB 2AZ3A 3GYGA 4LF6F 2BX6A 3CSKA 1LKZA 2KDOA 3EGNA 3GE9A 4HI1A 3QRPA 1VBXA 1VLOA 2D1TA 3IAS9 4JI1J 5DGBA 4GRSA 2CQDA 2PMWA 3D6HB 2DXEA 5CYMA 4DQPA 4X4TA 3E3XA 1H2TZ 3UR0A 4B3MC 3B4DA 4K4YA 4R8UA 4V19J 1NDKA 4DF8A 4DV2F 2DNNA 2E29A 3CB4A 4MIBA 5CAAA 1CEZA 5GAHI 4R1MA 3IS9A 3KXWA 1PGZA 4DCSA 2YTCA 4Y3CA 1K1QA 3BDEA 3DGVA 5IM0A 1WC0A 4F0MA 3MR5A 2HPUA 4ZPAA 4DUYF 1N6QB 2AZ1A 2ZC4A 3R7BB 2P6SA 3RJMB 4K4UA 4DSIA 5HN0A 1QTNB 3KWMA 3HT0A 3M8PA 5BXIA 3LNOA 4OLPA 3V6DA 5L8RC 3W66A 2FLLA 2V67A 2FLOA 5LM7E 2UVVA 1PSDA 5KOXA 2ZM6J 4ODJA 1KQSR 2P5VA 2YVSA 1X8DA 4YHHF 4N47A 4IDKB 3TA2A 4DPWA 1WHYA 5IFIA 4WK3A 3RR8A 2NQPA 3PHEA 2DEJA 3J80D 4AXJA 2F9JA 2W2OP 2EEYA 3M32A 4DL2A 3BGLA 2QLFB 2CPDA 1LK5A 2OP5A 4Y28C 2JH3A 1UVJA 3H5YA 4FKXA 3IM8A 4OHYA 5E3PA 4B3TJ 2VB6A 3WDOA 1F5AA 1UW9A 2LVWA 4U95A 2DXFA 1XMOC 3JB9k 1VR6A 3NKYA 2R9LA 4UUXA 3Q24A 5E33A 4UOGA 3DM2A 1KLNA 5EN1A 5DM6Q 2P02A 1FNXH 3RGIA 1YJNS 4KHPF 4USIA 1YJRA 5RUBA 1HNVA 1XMOJ 2HNZB 3MMCA 3CD0A 4I4BA 2R8KA 4JI3F 4ES1A 2UXCJ 2KM8B 2BZ2A 2QFJA 1U1LA 2UXDJ 2VG6A 4ED8A 2VA3A 2D28C 3V4IB 4NYOA 5GTDA 3O2EA 3PX4A 3LGXA 3NEKA 3BR8A 2J9DA 3TVYA 3I31A 4TLQA 1X7VA 2XSFA 3WHIA 3DHVA 3DLKA 1VLYA 3SFUA 2MB0B 2XBPA 4JI3J 5D0RA 3BSNA 2B0GA 2CUYA 3IXQA 3POTB 5KG6A 2ZH9A 4DR3J 2WONB 1S0VA 3PR5B 4WS9A 5ETMA 4IQMA 3N79A 1KRPA 3UE2A 4RW4B 1U6BA 3GKUA 4DV3J 4YR2A 1JNRB 1H7XA 1P1LA 4ZVSB 1HQUB 1U09A 1FJGF 5LXRA 2IC3B 2HQFA 1TL7A 2G0CA 4NOHA 3C15B 3VQSA 1LWFB 4FYVB 4ANDA 1C0TB 5FLXU 1NLKL 3GG0A 4KO0B 1K47A 1C4CA 2CIMA 2WW8A 4CO0A 2XZTB 4QPXA 3V6JA 3M2UA 1OO0B 5CZXA 3A4IA 2U1AA 2KKHA 2C2RA 1UVMA 2VL1A 3IR6B 2EWHA 3MAAA 4OZ2A 1AUSL 5T14A 4ECRA 1KD1T 4Y2KA 4I9FA 1Q81T 4BLGA 5SZTA 3C19A 2VQFJ 1HLWA 2QT7A 3M8YA 1TELA 2MJUA 3X3UA 5GADU 3J7YI 3J7Z5 2UXBF 4NLWA 4LFCF 2QVZX 1UEVA 2MLZA 4DS5A 3UCUP 2GJFA 4IG0A 2OIHA 1FKOA 4P71A 3AOAA 3PYGA 2GNKA 4JI6J 2A1BA 1U24A 1Q53A 4UF4A 2WB4A 1ZETA 3OL8A 2V4QA 5H9FK 1U1MA 1AB8A 1UP1A 5D6GA 2VIHA 4QIGA 4F4YA 4AD6A 2ONFA 5F3ZA 3MEKA 1V3ZA 2NSBA 3QJPA 1YDLA 4JI0C 2IM0A 3N54B 3CEDA 4OX6A 4ED0A 3UPFA 5K85A 2E66A 3T1YF 1IR1A 2NCLA 1SJ4P 4O3RA 5GAEU 2GQCA 2BACA 3MEGB 1NK5A 2HMIA 1F60B 5DDPC 2BMBA 2VKZG 3T5LA 3QJLA 4DR7C 2MQMA 3MMAA 4B9LA 3W60A 2QZ8A 2ZZMA 1MSWD 3FCVA 2HGMA 1HHSA 2JHEA 1WEZA 3MPYA 5KG3A 3T19A 3MXHP 1FJGC 5KT3A 3LH2S 2OFHX 2FPHX 1YBTA 2MY8A 3AJ2A 4RNNA 3AAWB 4DR6C 4RU9A 1S1XA 3N5FA 1XWLA 1IN0A 3NRBA 2WP0C 4UQGA 2W7PA 1MG7A 3A8EA 2HVZA 1YRUA 3QSIA 4DG1B 4PXCA 5KFBA 3NGUA 2Y1JA 1CJUA 3TUJC 5I3UA 2V7BA 4JYAF 3FCEA 4U7CA 4H4KA 5A0YB 4DUTA 5CYQA 4LRBA 5DQIA 1FD8A 3BPDA 4DV5J 1SXLA 1U6ZA 5IC6B 1RAEB 3ETOA 4YS2A 4I2QA 1ZM9A 2XWXA 2XLIA 2VQEJ 5T8SA 1WKKA 3G87A 4Y00A 2XGQA 1E6YA 1WTFA 1ZOTA 4ED7A 2UP1A 4KPCA 1WG1A 2YPYA 1FKAF 2MKJA 3BGRB 3M8SA 2XMWA 3N28A 3QGHA 3KLIA 3JAMU 1TAUA 1NSPA 2YKQA 3D1OA 4BWMA 5GAGI 3OLBA 4AFFA 3PW0A 1NXIA 2A2CA 3RAXA 6FDRA 1CS4B 1T0TV 1TFWA 4FUTA 3DXSX 3ZTRA 2FLPA 2DGUA 4Q2LA 3A8JA 3VAGA 2DHGA 2XY7A 1R0BG 3NGRA 4Q7AA 1N4LA 1DTQA 4GVBA 2QSFA 2WOMB 3IGNA 4URQU 2ZH4A 1Y3KA 4ZDNA 1LK7A 1MMDA 2W01A 4J9VA 5KG7A 1NPRA 1QD1A 1WC5A 3M30B 2HFVA 2OO4A 4HL9A 5D0HA 4EGLA 2XY5A 2V2VA 3KUGA 5DG9A 4DX6A 2IA0A 4JI1C 3HVAA 4OYCA 1Y00A 2LQJA 3PO5A 3HCXA 3I87A 1BWEA 1PBAA 2K3KA 3FK4A 2RAQA 3CCSS 1V6HA 4J5OA 4RBTA 4WIQA 1RT1A 2UXDF 1R8BA 1IQTA 2AYMA 1CJTB 4IR7A 4AQYC 3JQJA 3QWUA 1Q8BA 3DDIA 3A3OB 4P52A 2UV8A 3MMJA 2XYPB 1NJXA 1VYAA 1WOOA 2H5EA 1F9HA 2MZSA 5M2RA 2IVMA 2J8SA 2ASLA 3R9LA 4FXDA 2ZE2B 3R5JB 5K14A 1N32F 2E0GA 4JV5C 2EG1A 3VNRA 3VGTA 2E5JA 5HROB 4P75A 1HW8A 3EXYA 5D4LA 4QWBA 1IBMF 3NXZA 1H73A 2HGNA 1IXKA 1YBAA 3HFZB 4M8LA 3TX0A 1DRZA 4GVLA 4ED5A 1Q1KA 3QYYA 5E3AA 3V81A 1PA4A 1CJVB 2Y0SD 3NNCA 4X66C 5KG2A 3PIPQ 3GWCA 2DHAA 4LF2A 1EB0A 1T9XA 2XS7A 2UU9C 1RYRA 2ZKUA 9ATCB 3VAFA 2ZEJA 4IG3B 3DOMA 1TKZA 3GV8B 3VAHA 2BQUA 4DSJA 3DM2B 2E8EA 1C0TA 1D3WA 5KFFA 4OYMA 1K0RA 3PW5A 2EG2A 4C8ZA 4ZIWA 5JXSA 3ENAA 3S1TA 4LREA 4J9LA 2N4DA 3CPWR 1ZTWA 1MD9A 5KYVA 3BBBA 1N36C 2RRAA 1PJ6A 2FDNA 2P2BA 2PC6A 3I5BA 4KO0A 4OJ1A 4F4XA 2MQNA 4NOZA 4B02A 2L9WA 3C16A 2FVQA 2UVUA 2BKNA 1FK9B 3NG8A 1N5TA 2RD5C 3DLKB 4Y2IA 2M5OA 1O6XA 4LF4J 2V8VA 5LMNF 3MM9B 3FJ2A 2IBOA 3TAMA 2BJDA 5C7PA 4DR4J 2IMWP 1HFEL 1JXEA 1NU4A 1RTIA 2EK6A 2MTLA 2DPJA 4FP9A 3CDAA 4PR6A 4PCQA 3NMAA 4LRAA 5BJRA 4TU7A 2JEIA 2ZVSA 4PRFA 4DR5J 1B70B 4U6PA 2YWCA 5E0OA 3OW2R 4XAKA 4K0KF 2ZWOA 2DH7A 1N5QA 2VG6B 1WTBA 1T03A 2OPSB 1B64A 3V4IA 2PT7G 4DUYC 1RQ0A 3IR7B 2HW3A 2I5JA 5B7WA 5IWAF 3DAYA 1HBNB 3KLFA 2HFOA 1S6PB 5DG8A 2XB2D 3EPIA 3ZC4A 4X65F 2ACYA 4FF2A 1JOSA 2CZ9A 4NXMC 2Q79A 1TP7A 3RYLA 5KFPA 1LW0B 4OYZA 5KFXA 2CZ4A 5J2NB 4F8RA 4CP5A 4UUWA 3H0PA 1OYDA 2NPIA 4BHQA 2ZBPA 1S97A 3KG4A 4PWDB 2WVFA 1ZB9A 1BWVA 4FN5A 1YJVA 4USUA 4DV2C 5KFLA 2YCBA 2KL8A 3DC2A 3D0GE 3LW5C 4PWWA 4JI6F 3K17A 2R2TA 5KG5A 2FZKB 4GO5X 2BV3A 3UFCX 1XC9A 4ZHRA 4ELUA 4IRKA 3GPCA 3PESA 2BABA 2YWWA 3L8CA 4JI4C 3RRGA 1RA6A 1ELOA 1TL1A 1EETB 1RT7A 2KXFA 4QW9A 2D27A 4IH7A 5A8KA 2VHGA 1VQPS 2FVPA 3CCZA 2DR6A 1IUJA 5H9FJ 1KBRA 2M52A 4V1Ak 4DUZJ 4GXQA 3KYLA 2F8EX 3GR0A 4LF8C 3PROC 5LJ3Y 2ZD1B 3W61A 3N6NA 1OJ4A 2K1RA 4FS2A 1NJIT 1N2FA 3N0VA 1Q8IA 5I3QA 2B7BB 2OUGA 3IEVA 1BHNA 1RHUB 4GO7X 3L09A 2DNKA 1KOHA 1HARA 2VF3A 2ZITA 4ZVOB 2OEMA 2JLGA 2XYGB 4CH1A 1URRA 3AT1B 1F1BB 5AJ3J 3AY0A 3CIZA 2J7WA 4Y0FA 3HD2A 1XRBA 2RT3A 1ZM4A 3IAM9 3MCOA 4NYZA 2MQOA 4NCBA 3G82A 5HK4A 1NK4A 3CCJS 3BYRA 3A8IA 4YB6A 5JJBA
chains in the Genus database with same CATH topology
1MXBA 2NLWA 2P2MA 4I2QB 3SV4A 3FFIA 2FC8A 3PW2A 1U1RA 2IA6A 2I2YA 2XLKA 3ENQA 2QL8A 2RUGA 3Q8SB 4L4QA 2VPWB 2Z2MA 1X4HA 2YWBA 3LP2A 4RKUC 2DR8A 4F67A 2XS2A 2LLZA 4Q45A 4QWEA 1GNKA 1WI8A 4X4SA 1VC6A 2GGPB 5F0WA 3M05A 1N5YB 2ZZNA 2XNRA 3MUTP 1L5UA 2QW0X 3IN5A 2QIFA 4NCGB 4LUBA 2X1BA 3M8PB 4QW8A 4IQXA 3MM5A 4RLQA 2BQ3A 5IXUA 5KYTA 3NYRA 3BSCA 1XMOF 1L3UA 5LMNC 2B4VA 2DJWA 4FTFA 3R1HA 4BC7A 2RH3A 3RR7A 1IKXA 1TAQA 4WE1A 2AGPA 2F4VF 1BQMB 3TX8A 1B0VA 2B3TB 4B17A 3OFHA 2RS8A 3IMLA 2FTRA 1HR0C 4NX9A 4D3HA 1XEZA 3TAMB 2K3IA 1JLGB 2R7RA 1J5OB 4D4GA 1TL3A 3DRYA 2DO4A 2NREA 2DRBA 3AF6A 3K2YA 1NH7A 2JL9A 3I9ZA 5F8NA 4ETXA 5DLGA 3SV3A 4YB1P 3PEHA 4KJIA 1KTVA 2WSFC 1W25A 5AE3A 2DNOA 4WTYA 3V2UC 1R0AB 1H2UX 2DCLA 3N5BA 1FE4A 1MKYA 2HRYA 4J9PA 3GIJA 1IKYB 4OXIA 1S6QB 3Q2TC 3AH6A 3UR3C 1TKZB 2R7SA 4YMEA 1LW0A 3PVXA 2ZJQQ 3HT3A 4DV7C 1N33C 4GC6A 3T1AA 4DN9A 1SC6A 2JJ4D 3POTA 5CCMA 3CUNA 2OTJS 3D54A 3NWGA 3CGIA 1HBNA 2YY3A 3KLFB 1RKJA 1S6PA 3FSXA 2J9CA 1T7PA 2VV5A 3US5A 5IT9D 5KG4A 3CJ0A 3I5CA 3MEEA 4QR1A 2ZM6C 4EBCA 2ALZA 2NS1B 1NEEA 4G36A 3N6MA 3B78A 4KKOA 5DETA 4JI5F 1S48A 3AB2B 2ZH3A 2PEHA 2X3GA 4HI2A 4YB5A 3QWPA 2N4CA 4I1TA 5A8KB 3LO3A 1QY7A 3LGMA 2N82B 2XCPA 4W92B 1L3KA 1RTIB 1SL1A 5HLFA 4FNIA 4I69A 2RQCA 1GAOA 4IFVB 5E7QA 2BE2A 2J0WA 2JVRA 4BWJA 3I9V9 4DQSA 5E3RA 1YITS 4K4SA 5D8HB 1FRKA 4HT5A 2O67A 3OSNA 4DQRA 3R9XA 3H98A 4WYWA 1T02A 3QPIA 4QOTA 5BSVA 1X4BA 4FBUA 1NO8A 4BS2A 1LWFA 2GW8A 2AGQA 3W2VA 1QSLA 3WX4A 1E6VB 2J9EA 5D77A 3JSYA 1S72S 2M9KA 2XULA 4X4QA 4ZCKA 4UQTA 3BGUA 5HMWA 4KHMA 4OI0A 2RILA 1FE0A 1PC5A 3ISZA 3WC0A 1FJCA 4JBCA 1VOMA 3M9NB 5L38A 1H6KX 4IUFA 2A18A 4EU0A 2YNFB 1R8PA 5KFCA 2IAJB 4K4TA 2YWEA 3DMJB 2W25A 5B0CA 5GAGU 3LWLA 3T3FA 4DFMA 4LF8F 2UUAF 5J2QA 3GFZA 2AYEA 3CE8A 3HVTB 1HNIA 4X66F 3TYTA 4JI2F 3NPDA 1DQ8A 3IG1B 2VOOA 3IS9B 5AJ3F 5T7LA 5I3UB 3WZ0A 3VALA 3PJWA 2J0SD 4PWDA 4OX9F 2WRMA 1I94F 4PG8A 4C8MA 2E9RX 3QZ8A 2RRBA 3H2VE 2UUAC 1UA1A 3W7BA 3MM8A 1Q8LA 3R5BA 4G1QB 3TQ1A 2ZOMA 2FVSA 2CYYA 4DV1F 1VGYA 4MJKA 1VQ6S 3G9CA 2HHQA 5L1LA 4QWCA 4L6V3 1X0FA 1OQ3A 3T6BA 4M5DA 5KFKA 5K5MA 1JLGA 2OAUA 3SDEA 5L1IA 1J5OA 4O3SA 1S6UA 3G86A 3TO8A 2EC0A 2XNQA 3K58A 5E41A 4JI7F 1X9MA 3PKMA 2P9CA 1SIZA 2M4MA 3MR6A 2WOMA 5LT5A 1H98A 3BSOA 4NLVA 1M5OC 2DNZA 2KHCA 2V4JB 5KFWA 3EPGA 4IZ6A 2E1RA 1D9FA 3OVBA 1S7HA 4RM2A 3KMSA 3ZFVA 4AL7A 2HYIB 3THVA 3GB0A 4NWBA 2QLWA 1TKTB 4A8SA 4HDHA 2R8IA 4I2PB 4CNZA 4ZPWR 4QU7A 3CJ5A 1YRXA 3DLEA 3VNSA 1YVFA 2R7WA 1IJFB 1MROA 3VQTA 3IR5B 3M4XA 4YB7A 3MUVP 4RUAA 1FXRA 4X4RA 3CCES 1FTCA 1JWWA 3I07A 3S8SA 3JSBA 4X84A 2V8DA 2W4DA 3IWLA 2YNGA 3KK3A 4D56A 1RT3B 4C4WA 4DQQA 4IRCA 4EYIB 4TN2A 4B9NA 4WXWA 4YFUA 4LSLA 4DFJA 1WNEA 4R5PA 2BM0A 4FZVA 1REVA 4IFYA 1QM4A 5DDRC 4B3MF 1ZPWX 4EZ9A 4J9QA 3RRKA 1IQZA 1L3TA 4RM3A 5AXMA 1Q16B 2C28A 4I9GA 2QYCA 1JLCB 1XR6A 3BM7A 2XMKA 1FRJA 3VR1A 3W3SA 4OHVA 4Z2XA 2I9SA 4I56A 1S4FA 1AW0A 3CDBA 4A4JA 1UKUA 4I67A 2DHSA 4ZPBA 3DOKB 1Z2ZA 1P9QC 4DEZA 2YNIA 4AXIA 4O0IA 2KZZA 2FD2A 3MEEB 4KRWA 2QRRA 2ZDPA 3THTA 3P49B 3UD3P 4Y2MA 2MSSA 2V8GA 3J7A1 3ZZRA 2JWNA 4X4NA 4X64C 1FKOB 1SJRA 2XGPA 1GX6A 2MQPA 2ZJPQ 3MOZA 3VZHA 2Y1RI 4L3NA 2XSJB 1IJEB 1EP4A 3GV5B 4DWIA 2YH1A 2BJOA 4F2RA 1A6LA 3CO9A 4DQIA 3OTBA 4C98A 3GIMA 4DLEA 2E7GA 1KLMA 3PDNA 2RKIB 3MMBA 1KTQA 3UNGC 3OTOC 3ISNC 1VQNS 1N5VA 3L7OA 2P2QA 1HNWC 2EFNA 1XR7A 4B08A 3OTCA 3F41A 3FGVA 4DV0F 2MGZB 3MEGA 4DFKA 4CCHA 4YEAA 1UKKA 2K7KA 4DL4A 1ZH5A 2NPFA 1FK9A 5CA5A 3M9OB 2PFFB 2AP6A 2C42A 3CDEA 1FVQA 4KHRA 1P27B 1YRTA 1M5SA 1K0TA 4IFVA 4YDDB 5J2QB 3CTRA 3BQ0A 1URNA 2R8HA 2BM1A 2B6AA 1LWEB 5U47A 2PMZD 5H1SV 3CULA 4B3OA 2M8HA 4F4KA 5BURA 3HP6A 3DLBA 2VD3A 3EXCX 5L9XA 4O4RA 4KKOB 1R6YA 5JVHQ 3H20A 4NLUA 1VBZA 4ZMMA 1KQGB 5C24B 5IQQA 3S7RA 1HR0F 1E6YB 3SDEB 2VPZB 1RT7B 2QA2A 4M94A 2Z8QA 3DHWC 3HVWA 2RF2B 3LPYA 3SCLE 3OV7A 3FVYA 2PA3A 2I38A 4RLEA 3KLVA 4KFBB 5M2PA 1S0MA 4EO8A 3I82A 1VQOS 3MHYA 4PG5A 2K8GA 4LSNB 3OHAA 4ZA1A 1S9EB 4C2MA 2D1QA 1O0PA 2HGLA 3BZQA 2KVIA 3FDSA 1U45A 1C2PA 1RTDB 2E1MC 3UDLA 2KG0A 1OIAA 2KH9A 4EEYA 1KNZA 4QYZJ 2M7SA 3AQPA 4I0WA 2DGTA 2YH0A 3KK1B 1Y4ZB 4C0OC 4OX9C 2RDJA 2DGSA 2CPZA 5IM0B 2YNFA 3G6ES 2LQBA 4I7FA 2K1RB 1MXAA 3IO1A 3OXLA 1HI0P 4LQ9A 2JX2A 2DD8S 1TKTA 2RE1A 1XTZA 5J1EA 2FHJD 5K14B 5B0EA 2RQMA 4KBIA 3TRGA 2E7XA 4MMOA 4F25A 1RT2A 4BBYA 1U8SA 4PKDB 3KJVB 1JLCA 2W9AA 3HVRA 2CJKA 3I96A 3QGGA 1V3RA 2ATWA 1JJHA 2FIUA 4G3IA 4O23A 4IO1A 3CXCR 5KFHA 2LQ9A 1QM9A 4ECSA 1TV6B 1HBOA 5CYMB 3MM5B 2XY6A 4G6VB 4ES3A 2BQRA 4LVOP 5D4PA 2N7CA 2QA4G 2GJIA 2FVCA 4CZCA 5DV9A 5EX0A 1V3SA 4D57A 1FKPA 3CJ3A 1CQNA 1RYSA 3G4SS 1Y5LB 3G6VA 4X62C 3P3DA 1UMJA 3HHDA 2OMOA 3ZZUA 3K5OA 4RW8B 2YNGB 1KLMB 4O4GA 1B0TA 2EK1A 3KK2A 4OI2A 1I6JA 2DNMA 4WV3A 4X4UA 3CCMS 1Q86T 2L48A 1FRIA 4XPEA 2BOPA 5F8HA 2XWYA 1ULTA 4DV3C 4DN0A 1U2RA 3Q8RB 4DR4F 5EWEA 2ZH8A 2J7UA 3D1QA 4NRUA 5KFJA 4XO0A 4QIEA 3BO4A 1HNVB 5LXYA 2DRAA 2EFQA 4TY9A 1ZAXA 2O3DA 3DOLA 3HK2A 4EATA 4LJMA 1ZPVA 3M2UB 3ITHA 1FDAA 1R7IA 1QLNA 2FGCA 4LSLB 2HG4A 4LF9C 4GS5A 1QE1A 3QLHA 3OR2B 2LA4A 3ZZOA 2FB0A 4OZJA 2KT2A 3M1VA 4NA3A 1GX5A 4TKTA 4KR0B 3HO1A 2Y4NA 4HTIA 5F8GA 5GVQA 2MZQA 4AYBD 2CPYA 2XSJA 4GMKA 2FY1A 3UDCA 1F5CA 1SKRA 4F3QA 1VQMS 1VRUB 3FEZA 3LANA 3WBZA 4C8KA 2PROA 3NP5A 6FD1A 1F5BA 5GAEI 4RW4A 5FIIA 4CH7A 5F8MA 2VBXA 3MECB 5M2UA 5HP1A 1S10A 4B3OB 4IO9Q 4RW6A 5C24A 2BR0A 3ISND 1G3OA 4P2SA 2PMHA 4C11B 4Q43A 4QIVA 3CMAS 2KB2A 5D4NA 5A0YA 1HI8A 1DHMA 4E98A 1KFSA 3KLGA 4RBVA 2ADBA 2CRLA 3MZIA 4OI6A 4NLSA 1SKWA 3PW7A 2FGOA 2MZ1A 4Q0BB 1CSJA 4ECVA 2YKNA 3H59A 1XBWA 4H4MB 2UVWA 3H8YA 3JYTB 1USPB 1VK3A 2CFXA 2PSZA 4C8YA 4DCVA 1L3VA 1U1KA 2HHHC 1O93A 5B09A 2LEBA 2GHWA 1I94C 3BO3A 3FSYA 2ATLA 2EBEA 4ZP7A 1TQLA 2D7VA 4FUQA 2G1DA 5CZVA 4OZLA 2AYGA 3T9ZA 1DTQB 2GV1A 2XZWA 1WI6A 2VFUA 3CCQS 4PHTA 2W4CA 1D9AA 1S1VA 4H4OB 3HHNB 4RW7B 1CEZA 2DIVA 2CQIA 4PZPA 2RF2A 4NXNC 1HNZC 5DM7Q 3BR9A 4F3OA 2M3DA 2D7SA 4WFYA 4EUVA 3CW8X 4BC9A 4TPSB 3KMQA 3MM6B 5D3GA 4NZ0A 2R2RA 1WF1A 1G2EA 1HNWF 3FNNA 3TAPA 5E3CA 1KONA 2Z4PA 4QWDA 5CYQB 4B3TF 2XG8A 3IWNC 3HFKA 4ZP9A 2JEGA 1GXTA 2XI2A