3L95X

Crystal structure of the human notch1 negative regulatory region (nrr) bound to the fab fragment of an antagonist antibody
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
233
structure length
230
Chain Sequence
GSACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYFSDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLDCAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYGDVRGSIVYLEIDNRQCVSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Therapeutic antibody targeting of individual Notch receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords anti-NRR1 fab fragment light chain
total genus 67
structure length 230
sequence length 233
chains with identical sequence Y
ec nomenclature
pdb deposition date 2010-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00066 Notch LNR domain
X PF06816 NOD NOTCH protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3310 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l95X02
3.30.300.320 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3l95X01
5CZVA 2OO4A 3L95X 4ZLPA 5CZXA 3ETOA
chains in the Genus database with same CATH superfamily
3DI6B 4YQWA 3D3CJ 5DDQC 1R0AA 1Q5VA 1WI8A 3ZTQA 4Q8EA 4O3PA 1CULB 2P5VA 1HMVA 2LQJA 3M6WA 1VC0A 1TL7A 3UCGA 1U25A 2QV6A 3IAM9 1CC8A 1ROFA 1RB0A 1RTHA 1YKWA 1FCAA 1S1UB 1V5IB 1Z2ZA 3DDIA 3GG0A 3BYPA 5KG0A 5EDWA 3B7WA 5LXYA 3DNCA 3IEVA 2N3OA 1RBOB 2B9EA 2AJFE 2JLFA 4F4AA 4LF6F 2XS5A 1XTZA 2H5IB 3S8SA 1X4CA 1UVKA 2FB0A 2XMMA 4OZ5A 3SYZA 1DARA 4NCGB 4RUCA 4IRKA 4EATA 5IT9D 2LVWA 1RWUA 5HLFB 2FHOB 1Q7YT 2KKHA 5HBMA 2JMPA 1AB8A 3BZQA 1R8AA 2D74B 5CYMA 2IHR1 2OPRA 3AA9A 3AH6A 2CZ9A 3NGKA 3GJQB 2GHVC 2V2VA 1PBUA 2W2OP 4WFYA 3J81Y 3CCQS 3TAPA 2ZE2B 4ITSA 4HLBA 1RTDA 2E9RX 1GXUA 4ZVTB 2UUAC 4GKJF 3MECB 3UN3A 1TL1B 1QJHA 3FMBA 4DV2F 2C1EB 2FC8A 2FHJD 1ZM2A 3HI9A 1ZAXA 1KQKA 4CLWA 1HIYA 4CLYA 1CG2A 5I3UB 4GXQA 2H4YB 4CLZA 1WF2A 1NDLA 3KUGA 3OQ2A 2YWHA 4BWMA 3CQ1A 3GPCA 3FGVA 5HLFA 3U1LA 3T6BA 2XGPA 3OLBA 1EARA 1S0MA 4TU8A 2C3OA 1RGVA 3MHYA 4IOAQ 1IJFB 4ZPAA 2ZH7A 3N6MA 4JI1J 2ZWPA 1FJGC 1H2UX 1FD8A 4LBHA 3DU5A 5HSPA 4CO4A 4R8UB 4XO0A 2HWIA 2MZ1A 3MMJA 3OHBA 4L75A 4ZVFA 3KJQB 3MFHA 4OJGA 5KFCA 3D5MA 1MD9A 4DR5J 1MWZA 2HNZA 5DDRC 1MNEA 5HQMA 1N6QB 2HNDA 1A0OB 2HNZB 1SV5B 2MYFA 4IFYA 2E1PA 3PRVA 2HFUA 3ULHA 4ES3A 4ECYA 3NMAA 1TVRB 4NMLA 4ZVHA 2UUCJ 5L1IA 2F1FA 2DY9A 4ED2A 2UUAF 4ED8A 1XQIA 2E8FA 1LWEA 1XJWB 2P9CA 3PEJA 2HVZA 3JYTB 1WG5A 5AXLA 3R27A 1PO6A 2APOA 2Z2MA 3NY0A 4KY3A 2ZJRQ 3NG8A 4ED0A 3AOAA 1KC8T 1AMUA 5ETLA 4L76A 2C2EA 2Z58B 3LAKA 3WQPA 3FK4A 4USIA 3TJ9A 1QD1A 4IRCA 2K06A 2VG5A 2D1QA 3PACA 4GS5A 4I7FB 5KFZA 4CTAB 5HO4A 1FRJA 3KMSA 4RX6A 3MUTP 1LXNA 1O8BA 2IFXA 3ETOA 1U4BA 4DV0J 1HNIA 3DRPA 1IBKF 4XDDA 3QZ8A 5I3UA 1X8DA 3CD5A 4Q45A 4RW8A 1L3SA 1S0NA 1UFLA 2DEJA 2NPIA 3QFWA 3OXFA 5KAKA 2QGFB 3OL7A 1CJTB 1JKHB 3FKBA 2OPRB 3MCOA 3PJWA 4B3MC 1ULRA 4C3KA 2UUWA 2M52A 1RTDB 2RNEA 4X66C 3OXGA 2WB4A 3T1HC 2GGPA 2XC9A 3V4IA 2OPSA 5B0FA 2XLKA 4GXRA 4PQUB 3NBPA 3C6TA 2A3JA 3V2UC 4X65C 2XNRA 1N34F 2ZH6A 3QWUA 4B3RC 1S97A 1EKRA 2FYXA 4DL3A 3AQPA 3W9IA 2ZH8A 4M5MA 1V3SA 3CJ5A 2UUTA 2VG7B 2A18A 4ZVSB 2LECA 2E8CA 3ETCA 1HQEB 3DLKA 2AX1A 2QIFA 5D4PA 5KFRA 3G9CA 1UWDA 5FLXD 1RTHB 2ZBIA 3TW0A 1OIAA 1FEEA 3H7HB 2XQCA 3CE8A 5IT0A 4ISBA 1W7WA 1LXJA 5IS2A 2KHCA 2DNPA 1K1QA 4DR5F 2HNYA 2WVDA 3CUNA 5IQ6A 2XYPB 4WP3A 4ZVQB 2VQFF 4K50A 1FJGF 2CPIA 2Z30B 3D2WA 3MTKA 1NKCA 1RHQB 1U0HB 2MZRA 2KDNA 1SC6A 2CXEA 2UUCF 4BDPA 1CC7A 4NDNA 3TUJC 2QA2A 1NK4A 1SJQA 3ISZA 4USUA 3RBDA 2M5YA 5KFMA 2BE2A 2UP1A 4QPXA 2CDRB 3G6XA 1HH2P 1UW4A 4JOUA 1N5SA 4F25A 4B3SJ 4KIAA 3V5RA 1B0TA 4KJIA 4YR0A 3FRYA 4QR1A 4QWCA 4V19J 3S82A 4D56A 4FPRA 3FBEA 2HK2A 2ATCB 1HNWF 4HHJA 3OSNA 3OSPA 4ERDA 1CJVB 2G2ZA 3TAMB 2WVEA 4F8RA 4N77A 5B7WA 5KYTA 4UY85 5KFJA 3W62A 3SQGB 1FXDA 3MZIA 4QU7A 1RWWB 2KU7A 4NA1A 3JTNA 2XULA 1UA1A 2ZOMA 5EX3A 4X62F 1SI9A 2CPZA 2OUGA 3GE9A 4FBUA 5BSTA 3UEBA 1WOOA 3HDSA 4HR2A 3QRQA 4USKA 1J5EC 3NGSA 4LIWA 4JI6C 4FXDA 2NUHA 1S7IA 1TKTA 2C2ZB 3BSOA 3Q8QB 1CJUB 2GVZB 1YRTA 2G2YA 3BM7A 4DXLA 7FD1A 5SUHA 3UVJB 2QVYX 2UZAA 3IFEA 3VNQA 2E5GA 2ZFHA 3F41A 3QAUA 4FXVA 3BQ1A 3KHRA 1PU1A 1IKVB 4LFCJ 4F4XA 4LUBA 4G1PA 4KH0B 1TTHB 2BE9B 2RT3A 5C5JA 3RBEA 3EGVA 3I07A 1RTJB 2P2JA 2JFKA 3MD3A 3TYTA 2L08A 4DOZA 3OTBA 1HI1A 2X1AA 3NI2A 4RM2A 2BEFA 1KTQA 4Y2KA 1RT7A 5E3QA 3UDLA 2B7BB 5A0YB 1NSKL 2BVZA 1OO0B 4IFYB 3D3BJ 1H38A 1HD1A 2W2NP 2WW8A 4FNHA 4DCOB 4JP8A 2UXDJ 5F8GA 3IPLA 3H59A 3QGIA 3ZZTA 3NCRA 1IJEB 2DNGA 4KFBB 2BX6A 2JZ5A 2LYVA 2HQCA 1S1TA 3I9ZA 1UEUA 1YJ7A 1KQFB 3SCIE 5A8WA 4F50A 2MMAB 2RHSB 5GADI 4OQJA 2HEKA 3Q2SC 4I69A 3V4MA 2ASJA 3QT5A 4XPCA 1P1LA 4J91A 1FDNA 2QRRA 1N33C 4NXMC 2K7KA 5M2PA 4Z2XA 3J7Z5 2NZ4A 4ZPVR 1DQ9A 1S4EA 3BKTA 4ZVOB 2R8HA 2MB0B 4X2BA 2EFOA 3BH7B 3CJEA 1TL1A 1CULA 2LQ9A 1BD6A 2YH0A 5DLFA 1XR5A 3BPSP 3H8YA 1UJ6A 4P52A 2DXEA 1HFEL 3MEEA 4A8WA 3ZZ0A 3AB4B 2VBWA 4H54A 1UWBA 1ZM3A 2EG2A 3IMQJ 4HTIA 1SH3A 2EC0A 1NO8A 3AOCA 1D0EA 1JOSA 3N4WA 1RZMA 1P8GA 3OUYB 1PG5B 3W9JA 4QWEA 1KSPA 4JYAJ 1V3ZA 5A8RB 4GKKF 5ETPA 5CCMA 4PXCA 2G2OA 2N82B 3R7BB 3WZ0A 4U7UK 1OS5A 1LW2A 3D0HE 1RWXB 3DLBA 2A10A 3D68A 2OI2A 2W8LA 2QEXS 3KOAA 2Y4OA 3FRZA 3UWTA 3CCRS 3MMCA 1DRZA 3L7PA 2HVHA 1QE1A 4D4GA 1DLOB 1FJEB 2ZM6J 3M9MB 5DO2A 4RW8B 4D4IA 1W26A 2XMUA 4DU7A 2CQ1A 2XSJA 2FVSA 2Z2YB 4DLEA 1RAIB 5D3GA 3CW8X 1LKZA 3VNSA 2MKSA 2IM0A 3E2EA 1P6TA 4YB1P 2CNKB 1TKXB 3NGTA 2E66A 4RW4A 3RB4A 3US5A 1FX4A 3JSMA 4O44A 1F9FA 3G82B 5IWAC 3QRRA 2CPDA 2MY7A 4PWDA 3VNRA 1Y9OA 3OL6A 3NYRA 4ETXA 1SKWA 5ETKA 1BLUA 2BJ1A 1GX6A 1JK9B 2HRUA 3GSIA 2J9CA 2EPIA 3IS9B 3I0RB 2NQPA 4AFFA 1TV6B 1XMOF 2DKOB 4YR2A 4UF4A 3QT7A 3DOMB 2IC3B 5E33A 4DHVA 5AJ3J 1S0OA 2MLYA 3EVMA 3A26A 1SV5A 1BQMA 2QSFA 4DV5F 3FCWA 4LF5J 1N6QA 2XEXA 1SCJB 2ACYA 2EK1A 2WSEC 2B4UA 2WONA 2PA8D 1WSRA 1GFWB 1KWMA 3C8YA 4HPVA 1RT3A 4FS1A 2OEJA 3KG1A 2R2TA 2R8IA 5F41A 1UEKA 1G4CA 1W2BR 1B4SA 2WRMA 2D28C 2XSJB 2PSZA 2HFNA 1JIHA 2HZCA 4O23A 5HMXA 1VQLS 4NLXA 1S6PB 1HD0A 1LW2B 3O6QA 4JI0C 1S1XB 4PUOA 5DV9A 4DR3C 2W1BA 4WK3A 3RG2A 4RM3A 2P2FA 2P6SA 1JLCA 5LSOA 3OTOJ 2UVWA 4Z37A 4NYPA 3TX8A 3QBCA 1M1HA 1RADB 5HBMB 4M94A 4A8KA 4RMNA 2QLJB 4JYAF 2LKZA 4AQYJ 3CGIA 1FTCA 5A8RA 2CQ2A 4FXWA 5A8KB 3BN7A 3I55S 5DS7A 5T41A 2YKNB 3PYFA 4NXNF 1I5OB 3GYGA 4PG8A 4B9LA 1K0VA 1DHMA 2HFVA 3AXMA 4QYRA 5GTDA 5AT1B 5ETNA 4Y2IA 1DTTB 1XR7A 2HQIA 3C16A 4ZJQA 1WWHA 6FD1A 2QT7A 4A8QA 1VBYA 1QVFR 1REGX 2B0GA 3C16B 4WIQA 4N8NA 3PHTA 3SSRA 5MAOA 4WZMA 3TJAA 2H51B 3AQOA 2QMXA 3R6GB 4I6AA 1WKLA 9ATCB 2AU0A 1MSWD 3LNOA 4PROC 1IXKA 4ED3A 3J7YI 4DCJB 1RAHB 2RJZA 3DOMA 4ZITA 3CD7A 3CJQA 3PDNA 2GNKA 3Q23A 2KXFA 2NUUG 2ZOFA 3FNNA 5K14B 4B02A 5L1JA 1TL3B 4G3IA 1FFGB 4DS5A 5KFKA 1XR6A 2NXNA 3PROC 2YWCA 1HR0F 3FQKA 1JJ2R 2JH3A 4RBVA 1HNVB 2ZNYA 4UZBA 3K7RA 1IWAA 1S5ZA 2R7OA 3CQ3A 1GMWD 5F8MA 5AE2A 3IMLA 4DG8A 3HD2A 2UXBC 3I0SA 2KJVA 5E3AA 1JKHA 4LF9F 3MM9A 3RV2A 1RSCA 5IM0B 1XRAA 2BUNA 2AIRB 3O2IA 1Q8KA 5BYSA 2E1CA 1FEHA 2MEWA 5HVGA 4X4SA 3OL8A 1T7PA 1F5AA 5FLXY 2JFDA 3DRYA 4BC7A 1JLEB 3BN4A 3GIMA 4AL7A 4IQMA 4USHA 2QA4G 1MROA 3RTVA 3MM7B 1RWOB 3EICA 4MKVA 1RISA 1KFDA 4KSEB 1VQKS 3DLHA 4DZ6A 3MM7A 3TVKA 2XB2D 4RVOA 4A8SA 2RDDA 4KB7A 2CQHA 3A3OB 3PVXA 3BGRB 1U2CA 4M5DB 1D8YA 2IVFB 1LFPA 1WF0A 3HHNB 3NMRA 1S9EB 4ZKAA 2GO9A 2PN2A 1YBAA 4BSZA 1KP6A 2NREA 2ZITA 5IM0A 2ZH5A 1USPA 4CDIA 2KO1A 4K0KF 1TVRA 2X51A 4RW4B 1C0UB 1PKUA 2JSXA 1AROP 3NS5A 3R6LB 4OLOA 5BR8J 4G36A 1N5YB 3QO9A 3VAKA 3A13A 1ICEB 3GIRA 2VFVA 4JB8B 1AW0A 3LPYA 2P2QA 2VV5A 4HEA9 1NK6A 4JI7J 1WOSA 1Y3JA 2AYEA 3UX3A 3KJFB 3S1TA 3P5TL 3OJUA 3JSRA 2EVZA 3HHLD 3TWZA 1F6TA 1SC3B 2F8MA 3DYAA 4LRAA 4NCGA 3UN2A 1NH7A 4PZPA 2YKQA 5LMUJ 1R27B 1WC0A 3CMES 2V8HA 3TEHB 4DCSA 2FGOA 4HKQA 3M32A 3W64A 1NLKL 2AZ3A 4QJVA 2ZHAA 2M0GB 4RLEA 3M2UA 4QIFA 5EX0A 4OV6A 1N5TA 2DRDA 1HNZJ 4F26A 1DTTA 3RUBL 2VQEC 1F9HA 1YWXA 2QL9B 4LRDA 2RUGA 1GQEA 4IRDA 4ID5A 2QVXX 4ECZA 4X4VA 2NXEA 1SUQA 2NPFA 1LOUA 1S9GA 4PG4A 4LQ3A 2XY6A 1X4HA 4ECXA 5ITHA 3O2EA 4C0BA 2G4BA 3BQ0A 1FHTA 2HW3A 3PTWA 2B4VA 2WSCC 3F0NA 3I96A 2R4FA 3R2DJ 2VDHA 5BJRA 5CZXA 2J7UA 1L3TA 5D0HA 2JJ4D 3CVKA 4K4TA 4CH0S 2DR7A 1RWVB 3BYRA 3M8WA 5FIIA 3H2LA 3N9UC 3ILJA 3W2WA 3CMAS 4UT4A 2YNHB 4RKUC 5E5NA 1LWFB 1ZYQA 1IKYB 4PUIA 4KHPF 3H5YA 2Q79A 1QY7A 2O3DA 4DR6F 3V6DA 3M8PB 2J9DA 2XTJP 4DR2F 2D3O1 2ZBCA 1WCJA 2ZC3A 3ENVA 1GPMA 1IBKC 5DG8A 2VBXA 3R8YA 4OI3A 3VGVA 4H4MA 3UPFA 4ECVA 2F4VF 1FRXA 1WTBA 1F9EB 1VS3A 3EUNA 4OJHA 1FKAF 4B3MF 1KN6A 2B43A 2CPEA 4EO8A 4W90B 1IKXB 4RNHA 2NR0A 3C66A 5H1SV 2LU1A 2RU9A 2AP6A 2XY7A 3CIZA 2KFZA 3N28A 5J1EA 3SCKE 4JI7F 1HBOB 3ZZYA 2VBYA 2B4OA 2CQ3A 3AF6A 3T1HF 3DN9A 3MM8A 3LPEA 2B5JB 2ZHBA 3CO0P 4KGKA 2E7VA 4ZLNA 1YRXA 5KT6A 4K5SA 4L73A 3ET6A 2BE7D 3JYTA 4UOCA 3Q8SB 3PJ9A 4R0MA 2GO8A 2IRUA 3CJKB 2XSFA 5B0BA 4ZK7M 9RUBA 3G96A 1P4EC 2ACMA 4DUZJ 2B8QA 3DKDA 1BC6A 2RILA 1WKJA 3I5CA 1WEXA 4JV2A 1SQFA 4WP9A 2HVIA 1SXLA 2DHXA 1UW9A 2AGQA 3A3NB 3D4JA 2YNFB 3RJMB 4J9MA 1U1NA 2OBVA 3GFHA 3V6DB 3CMQA 5G0RB 4C11B 1T05A 3PM9A 3MEKA 5DRKA 3FSXA 3UCUP 3BGFA 3T9NA 2Y3YA 3ZTSA 3DOKB 1S1WB 4DPUA 1Q78A 1BA3A 2RSQA 4K0BA 3W1YC 3MMAA 1YJWS 3CNQP 1QAXA 2W25A 4DJBA 2OSQA 2MGZA 4QBUA 2FQQB 2YNIA 4CRJA 3AODA 4P2FA 7FDRA 3TZZA 1HI0P 4ED6A 1IR1A 2V0NA 2C3PA 2GS8A 1REVB 1Y00A 3UE2A 4I68A 4QIEA 3DRSB 1UVLA 4PCQA 2VQFC 3TOQA 4ID5B 1QM4A 2VQEF 2MJNA 4UUWA 1S9GB 1X5SA 4OYCA 4LIRA 1M6XC 2J0XA 1B64A 3B54A 1N36J 2PDAA 5K8OA 2J7KA 1J5EJ 3W63A 4IG3A 1YITS 3KXWA 2HLTA 5L8RC 4FYDA 5HMZA 3J80Y 3OFFA 2BZ2A 5FD1A 1QAYA 1VGYA 2V34A 4C7QA 4KGXB 3Q8VA 4F36A 3M32B 4Y2CA 2PMZD 4BLGA 4WKYA 3L9ZA 5B0DA 3V6JA 5KG7A 4EWTA 4ECWA 2AV5A 4KBIA 1HPZB 3MR6A 4N41A 4OX9J 4ZP7A 3IEUA 2JNVA 2CPXA 2OSRA 2YVSA 1WSVA 4NASA 1JLGB 1RT2B 2CNLB 1FRMA 5C7PA 3UR0A 4KTTA 1C0TB 3GU0A 1YG0A 1GTEA 4QR0A 4U6PA 1QTNB 3HZGA 3CCVS 2KTQA 1CEZA 4URQU 2BJ3A 4P2MA 4DPTA 1LWCA 2MLXA 2YY3A 4OYPA 3BO2A 2N3LA 4ELUA 4USWA 1Q53A 2MJUA 1WC5A 4GVLA 4Q5VA 2ATLA 2V2QA 4CWBA 4USMA 3UW1A 2XMKA 2MZQA 3DI6A 4M5GA 4DUTA 3VAMA 4K4ZA 2OGUA 3MAAB 1D9FA 1HBMA 5C24B 4FVMA 2FJDB 1FKOA 1ZAWA 4QR2A 3KLHB 3DHWC 4IH5A 2C2RA 3NOCA 1N0VC 1S9EA 3UVJA 4ED5A 1T9TA 2O66A 3CDWA 5F9LA 4JI4J 4LFBF 4C4WA 2MTLA 2BW2A 1SJFA 4NXMJ 1WHXA 2NS1B 2OPQA 1U02A 1S1WA 2V8VA 2K8GA 2YX1A 3CJTA 2ZKUA 3IWXA 3ZO7A 1SH0A 1ZZFA 4AT1B 4EGLA 1N33F 2V7BA 2W9CA 2AD9A 4N47A 2ASBA 2K3IA 1HA1A 4G6VB 5DM7Q 4JI5J 5G0RA 2DTJA 2VFSA 4C11A 4DR1F 2IYIA 3DRXA 1MN9A 1VIXA 3MM9B 3EPGA 3ZNUA 4B3TJ 3FQLA 4K59A 1ZZNA 3H4DA 3TI0A 1VRUA 3ENAA 5CD4H 4IO1A 4LF7C 4NPOA 2ZJPQ 1UMJA 4WFZA 4LFAC 2VQEJ 4DV6F 1VQPS 1MMDA 4RUAA 1H72C 2OPPB 2WAQD 4QPTA 1LWCB 3DCAA 2KT2A 3L7OA 4YDDB 3KG0A 2FJEB 3MR5A 2MMYA 3VGTA 4P7VA 4HVZA 4IQXA 3UOWA 2B56A 1IN0A 4KE5A 2OTJS 5K14A 1JLGA 1RKIA 1RT2A 2YPZA 4KYZA 3V6HA 4JI2C 4GKKC 2A1BA 4MKBA 2N7YA 4N5SA 1ZB9A 1F3FA 5ADZA 3NP5A 2AF6A 3FBFA 1M5OC 4YMEA 4LFBC 2N4DA 3L95X 1YZ7A 4JI3F 1H6KX 4D3GA 3BPDA 5HP1B 2CJQA 3DOLB 3HSGA 5IV4A 3Q8PB 3EGZA 2PROA 3BGUA 4F3QA 5GAEI 4RUHA 4JI8J 4NCBA 2D1TA 4F2RA 3JTOA 4FZVA 1NK5A 3NXZA 3R9WA 3SO4A 5LMUC 2W2QP 4B9SA 5ETVA 2X1GA 3DLKB 2QLXA 2CA9A 3JSYA 3O8WA 4YUDA 2HBZB 2OP5A 1X0PA 3MCMA 3ILOA 4LBIA 5E0OA 4LFAF 2E1RA 5SZTA 1PGZA 2YWBA 1RBAA 1T3NA 4WFXA 2FJVA 3Q24A 2VUGA 3A4TA 1L3UA 2V6AA 1VHFA 5CA5A 1VI7A 3EDRB 2VBZA 3E7WA 4ZVPB 5DDOC 3KK3A 4JI2F 5KT5A 2IVMA 2CJ9A 1SC1B 2P2CB 4R0JA 4JI4F 3E01B 3I87A 4JI8C 4PQUA 4X4PA 2DGXA 3IRXB 1GEHA 3LALA 4RVNA 3IR5B 2XS7A 3AFGA 4DQIA 2XI2A 1RCXB 4LF8J 4LF4C 1V5VA 2RVJA 3IG1B 4J9SA 1KQSR 1NJXA 4MKYA 2E1AA 2KRBA 4DPYA 1N2FA 1CJTA 2H4WB 3P5BP 1CJKB 3FFIB 2J6UA 3KJNB 3CD6S 5I42A 3PJXA 2VG6A 2PC6A 1XRCA 5HQ8A 1JLQB 2KT3A 5KFPA 2W9BA 2W7OA 3FDSA 1R6YA 4I4BA 1K73T 2XBPA 4BBYA 1TV6A 4DWIA 4FYWB 3LUSA 5LJ5Y 4J9UE 3I08A 1M0SA 1J5OA 5FJ4A 6FDRA 1PJ5A 1S6UA 2K1RB 4PG7A 3FCCA 3AY0A 1HARA 2ILYA 3BSCA 2DHMA 4O4GA 2XG8A 1LWEB 4I2PA 3MM6A 5HL7Q 2HG4A 4JI8F 5LXRA 2XO6A 2C2MB 3PBKA 3GG1A 3KK3B 2AT1B 2G13A 1N5YA 2NCLA 4X4NA 4F0KA 3AD9C 4YY3J 1KOOA 1RTZA 2CNOB 3HCXA 2BJ9A 4LF4F 2D9PA 2ZHOA 4L2ZA 4B3SC 3BB5A 1KFSA 2P2MA 3W60A 4C8ZA 4ZCLA 4WXOA 1OYEA 2EFGA 5D78A 1QSYA 1HWJA 1WDTA 2JNJA 2FC9A 2C3UA 2H5EA 2PN6A 2ZBRA 5F3ZA 1BXNA 3CJ0A 4ZCMA 2EK6A 1QSSA 1N88A 4C8LA 1CSJA 1Y5NB 2JL9A 3HSDA 1RXOB 1FKPA 1TMJA 1X4DA 3HHDA 2EFVA 5MLCV 2R7XA 4LFAJ 5IWAJ 2ATWA 1OY9A 3CW2C 3SQOP 1EHWA 1Q7LB 3W2WB 4Y0FA 3R5AA 4TQRA 1U0SA 3PCOB 3Q83A 1KONA 2EFNA 1RYRA 2QLWA 1FJGJ 4PUHA 1FRHA 1Y7PA 3FEZA 3OR2B 5J1PA 4YP3A 3A1YG 1UVMA 1WI6A 3LAMA 5T7LA 4Y2MA 4GC7A 2YQ1A 2UXBF 4LR9A 2BJDA 3MEEB 5DQIA 3UD4P 2IRYA 2MKYA 5E7QA 3UZ0A 4QYZK 3L09A 4NYOA 2OAUA 4HHHA 2KH9A 2WSFC 4HH0A 4ZPDA 1QUPA 1TUGB 2CJXB 2LXUA 3TA2A 5KFBA 3W5XA 1NK0A 1RAGB 3FVYA 4LF6J 1IB8A 2BANA 1AA1B 4Q44A 3PY8A 1JJHA 2VKRA 1GXTA 2OMLA 2YCBA 1TL3A 3M8RA 1HBNA 2CDQA 4RW6B 4WU2A 2M70A 3M1VA 4JI0J 2E8EA 2D9OA 3MAQA 1WF1A 3IGVA 3TZYA 4DR7J 2XMTA 8RUCA 1S1UA 5LOQA 5L1KA 5KT3A 1XIQA 4JV1A 2DXDA 2IJFA 4O3SA 3PX0A 1WH9A 3AF5A 1IBMC 5M2RA 1NJIT 1HR0C 2L9NA 4EFAC 4MJKA 2X3DA 3S6EA 1XS3A 4L3KA 4ETZA 2PT7G 3LA0A 2YKMB 2HQDA 1KBRA 2W24A 2DT9A 3BGLA 3M2RB 2BW7A 3MWBA 4DPXA 1X5TA 3W3SA 2DY1A 4FF3A 4K0KC 2P20A 4GKJJ 1XBWA 3QO9B 1SL1A 5EHHA 1O92A 2CVEA 4C8KA 3H5UA 1XMQC 1FE4A 4LF4J 1S76D 2XM3A 3CD0A 3I56S 1UKKA 1D9AA 4M5HA 4URSA 4WWSA 1ZB8A 2CZ4A 1DY3A 2W9AA 1NB2A 3MI7X 2AW0A 2UXCF 4X64C 1HQUA 1JLFB 2YKOA 1NM2A 3BKFA 3GLJA 3LOUA 4WE1A 3LH2S 3O5TB 3T5KA 2HVEA 2WK4A 2J0WA 3B8HA 3BREA 2DNHA 5AXNA 2KFYA 3P96A 3G6YA 5IT9U 2GQ2A 3IGNA 5KFDA 4RW7B 5L1LA 2UU9J 1KQGB 3QPIA 4QW8A 2VD3A 2HURA 4CT8A 2YNGB 2VB6A 3M6VA 2DYJA 2FUG9 4ZDNA 3SIPB 3W5ZA 4CP5A 2GQQA 4DL2A 1IBMF 2BRLA 1M5PC 1YHQS 4DR4C 3IC1A 4ECRA 4P71A 2R2SA 1KD1T 4J9KA 2R7RA 1SPBP 2ZH1A 4DSFA 2ZD1B 3J81U 4EBDA 3V6KA 5LT5A 4LE5A 4DN0A 1SJ1A 2H65B 1R0CB 4X65J 3TANA 4DPWA 2RUSA 2UXBJ 1WORA 3RW7A 2KZ0A 4QWAA 4DV1F 5F9NA 2NZCA 3M30A 4ZVEA 2DNZA 2XCAA 1FK9B 5H9FJ 3T5LA 5LSLA 1EQ0A 4RLQA 1UVJA 4Q0BA 1QDUB 3NCQA 4FKYA 2YQ3A 3K6RA 5E7OB 3PFEA 4NLUA 1F60B 2MQ8A 4KHRA 1VQSA 3DRSA 5F8NA 6AT1B 4PEOA 1U8SA 2ZJQQ 4PR6A 5IOLA 5KFHA 3SDEA 3RR8A 4AUKA 4YR3A 4OI6A 4KHPC 1U0HA 1Y10A 1ZS6A 2XZWA 3A3PB 3CCJS 2HSEB 4H4KA 4DV0F 3NNCA 4GKKJ 2XO7A 4MFBB 1D3WA 2C2KB 4H4MB 4OZ0A 5KFGA 4AE5A 3QZ7A 2UUAJ 2GC8A 2HRYA 3MPVA 4DR4F 3DOKA 3HT3A 4EYIB 4A8YA 4R8UA 2VSQA 2QLBB 2RDIA 4TLQA 4USTA 5CHCB 3MD1A 1C1CB 4TY8A 4F67A 2R3VA 3ILIA 3OVBA 4B9NA 2YNHA 4XDCA 4CQ1A 2FLOA 4KAIA 2KVQE 4DUYF 4DQPA 1KHWA 2EI5A 1S72S 2YWGA 3PW4A 2P8IA 2IAJA 1Q81T 2VODA 4A8MP 5LCIA 2FPHX 3GCWP 2IM3A 3CO9A 4MH8A 2CU6A 4DV4C 1C1BA 3IBCB 4N8OA 3Q0AA 3GTYX 2DNNA 2RH3A 3LO3A 4FBTA 2E0GA 3Q8UA 1EETB 2DGSA 2F8EX 1JLCB 2ROGA 3PYDA 4ZPWR 2HHWA 2OPSB 4J9QA 4DUZC 2MQPA 3F44A 4FYYB 3OL9A 1PG4A 1FFSB 2MY8A 3JXOA 3SSSA 3HHLB 5C25B 4B17A 5HI7A 4C2MA 3G6ES 2HPUA 4RU2A 2HGLA 3J81j 1FX2A 1C2PA 1NMEB 4WV3A 2FVCA 3HHLC 5L9NA 2MXYA 5K9FA 3GONA 4NYZA 1T95A 4U8YA 3CCUS 3GV5B 3E3XA 4IR7A 4EZ9A 2CADA 3HKWA 3JTPA 4NA2A 2FLNA 4DL5A 3RRHA 1X31C 5KFYA 3KLFA 4DV5J 3THVA 2Z51A 2HIYA 3CDEA 3MR2A 4ZN3A 2IJNA 2EC2A 3P45B 1B99A 2W7AA 3M9NB 1OPIA 3FJ2A 3MPDA 1HWLA 1NZAA 1VLYA 3ZZPA 2QL7B 1SKSA 3QT8A 3FCEA 4EK2A 2OD6A 4P10A 2LA4A 2Q6CA 3IG1A 2HQGA 4KFBA 3HHLA 3WDOA 4RWXA 2XS2A 3QFHA 1M5SA 1NHVA 1YRUA 2EBEA 3THPA 2CG4A 1S6OA 4Y00A 2X1BA 2VPYB 1OPZA 1TQLA 4J7CA 2PFFB 3K0JA 2JVOA 3GILA 5B0CA 2VQFJ 4NLOA 1FUGA 4O3QA 2QL8A 4CLKA 3T5HA 2DNKA 2L9WA 3DGPB 2V50A 1NPPA 2V4JA 2CQ0A 5EUHA 2OJ3A 4CLSA 1TFWA 5I3QA 1ITPA 1S9FA 2AEMA 1USPB 3EERA 2FLLA 5GAGI 3B4DA 2LLZA 5KG2A 2A0FB 3DDKA 3Q8YA 1PYSB 3CJ3A 2RKIA 3EZ5A 4DR4J 1IKWA 1RHUB 3AJ1A 2BJEA 5D15A 2PI5A 2CPJA 5B0GA 1RJJA 4KV8B 1Q16B 3OHAA 1FNXH 1RP5A 1VOMA 3GSDA 5D77A 3D28A 2B6AB 3UQSA 1B0VA 1SKUB 4NLWA 3UD5A 1M5HA 4B9UA 3GR0A 4FF2A 2G0IA 4BWJA 3RYLA 1KLMB 4ES1A 4J9LA 4HT5A 4HI2A 2CWXA 3ITHB 2CNNB 2CQBA 2M8HA 2KB2A 2I9SA 5L39A 3HVTA 7AT1B 1NKEA 2V8DA 1IM4A 4NZ6A 5H9EK 1YLXA 2AJ4A 3HVAA 1RKJA 5BSWA 4EEYA 3A4IA 2ZC4A 2F5GA 1R8HA 2DR5A 3U7JA 2ABYA 2Y8YA 3RBXA 4RNNA 2XLJA 4NLVA 3NNAA 1U24A 3KLGA 4CI0B 4Q0BB 3PW0A 1N5QA 5EN1A 2I1RA 1H0HB 4JV5J 2Z0GA 3IR6B 3PKYA 4LMZA 2DK2A 1Y4ZB 2AHOB 2NXJA 1XMBA 1H3DA 1OYDA 1TL4A 4U96A 5CH7B 5JVHQ 5JMNA 5J2NB 2FJXA 4LFCF 4OI0A 3P8BB 1U2RA 1BHNA 3SMZA 4QWBA 3NRBA 4L6V3 2KZZA 4WFBQ 3DLEB 2ZM6C 4RWWA 3NWGA 4OI1A 2W7PA 2R8GA 2Y1RI 1XNQC 3J7A1 3SFGA 2CVIA 3MEDB 1Y5LB 2LQBA 1WC4A 2QW0X 4LF1A 4MH4A 3Q86A 4ODJA 5HMWA 4LVOP 1E6VB 5U47A 3C15A 4M5KA 1EAYC 1RT5A 4DCPB 1F0XA 4X4OA 2QVZX 4I2QA 3TR5A 2HHPA 4B3OB 5HAOA 4B08A 2RKIB 3TA1A 3PZPA 1ACMB 1G7CB 3HF5A 1NRKA 3K8VA 4NL5A 4W4MA 1XC9A 4CCHA 1VK8A 4U5YD 3KLHA 3IR7B 1F3VA 4LSZB 1X4BA 4C8YA 3EZOA 3NNHA 4PHTA 2JX2A 3HD1A 3EX7B 4OHZA 1N0UA 3SI8A 2AWZA 1OQ3A 2POKA 3K59A 4ZIWA 2KRRA 4IZ6A 2ASDA 4K0KJ 1PSDA 3MMBA 5IC4B 3N5BA 4C97A 4CH7A 2F3JA 2F65A 2BDPA 1O9TA 1RT5B 5HROA 1SB6A 4C9DA 4PAAA 1IWGA 3KKFA 2M2BA 3NAIA 2E7GA 1TKTB 2P6TA 3DLJA 1AUSL 4OX7A 3HXMA 2W8KA 3SEOA 2LFVA 4RNMA 1UFKA 4ANCA 2ADCA 1LW0A 4G1IA 1FVSA 3ISND 1U1PA 1WC1A 2XWXA 1KVKA 1UPMB 3PNIA 5C42A 4DQQA 1LK7A 1RT4B 3KUEA 4ZHRB 3TVZA 3LP1B 2LCWA 3SCLE 2WONB 3FBBA 5DETA 5CYJA 2PI4A 1RG9A 4V1Ak 2BANB 3OTOC 4EMDA 2VC0A 3MOZA 3BBFA 1XRBA 3D67A 1AZSA 1HHQA 3H4BA 2GQCA 2JWNA 2P9EA 2HMIA 3JAMD 3PEHA 5F0WA 2BQRA 3H20A 3IM9A 4ICLA 4NLYA 3GV7B 2B5JA 4P6QA 1B0PA 3TR3A 2OHDA 3C5EA 4OL8A 1S48A 4GMKA 5B0EA 3OLAA 3T3FA 1ZTTA 4ILRA 2IJRA 2WD9A 1X9SA 4DX6A 5AJ3F 3OR2A 3P3DA 4MT1A 5C25A 1F1BB 3C14B 3BO4A 1YZ6A 2G0CA 2J9DE 2VASA 3QSYB 4PWDB 3MTJA 3NEKA 4LSLB 3M8ZA 3R44A 1OMSA 2HAFA 1Y3KA 2NYIA 3DMJB 3MPUB 4ZVGA 2MKKA 2MZTA 1N8RT 2R7SA 1WACA 2HIQA 2HQ3A 1Q8LA 1LWXA 2COLA 3M8YA 4OZ2A 5LMUF 2ZZMA 4DPOA 5A2QD 5LM7E 2MQLA 2MSTA 2W2MP 2QSWA 2BOAA 2FJBB 3MGJA 3C6UB 4ZP8A 4E2FB 1P27B 3OFGA 2HK3A 1IKWB 4B3TC 4X62C 2AEJA 2CUYA 3C6UA 2QYCA 1XMOJ 2OTLS 1MU2A 2VL1A 2PO4A 1A6LA 1WG1A 3L7UA 4DN9A 3OVAA 2UVUA 3OTOF 2X1FA 2CRLA 3E8OA 3R5JB 3S7RA 5K5MA 5E3PA 2YWWA 2E5HA 3HZEA 4R5PA 1H73A 1VQNS 1GXLA 3SDEB 3GFXA 2HRTA 5HVHA 3MURP 3DLGB 3P6YC 2YTCA 3GJSB 3KLIB 1RTIA 4X66F 3MM6B 5DQGA 1YJNS 4NXNJ 1FJ7A 2PMHA 4NLTA 3POTB 3CC4S 2IIHA 3LGMA 2UV8A 4PKDB 3N6LA 5KT4A 2J0SD 4RLFA 3I0RA 3IS9A 1N34C 3H2VE 3MDFA 4X4UA 2P2BA 2QYGA 2HMIB 1RYSA 2FVRA 2H5JB 2PGCA 4LT6A 1OQ6A 4ICLB 1TK8A 2V9WA 1FK9A 4Y3CA 3VVUA 2W9BB 3QGGA 3M30B 2FHKA 4G1QB 4L3NA 2GFFA 3EXYA 5IC6B 1N4LA 5A19A 1RA7A 3ZNJ1 1SJ4P 1F2GA 1HNXC 5ETSA 2C22A 3NL0A 4CO3A 2DHHA 3KJVB 4K2JA 1FNOA 1RQ0A 3RBZA 2VPXB 1SC4B 4EU0A 1YIJS 4UQGA 2YNGA 4ED1A 3QMQA 4TNOA 3GYXB 4ZLJA 3BR9A 5T14A 3FZBA 1JX4A 2F8HA 2WTFA 3KK1B 5BR8C 1R89A 2R7TA 4O3NA 4B9MA 4WPAA 2EBGA 1LQLA 2DO4A 3JAMY 1NUEA 1DQ8A 1RWNB 1Q5YA 2Z4PA 4ZLPA 2AYAA 1D1UA 1G6BA 3CDBA 2VZ9A 4PPDA 3OXLA 4KGZB 3M05A 3ZTOA 3LTOA 5KFFA 4OZLA 3CCSS 1IR2A 1TR0A 2FVQA 3D1HA 2GVDB 1D9DA 2H48B 4RR5A 4CLUA 1KHVA 1SUQB 1HR0J 1NJWA 2IMWP 4YDXA 1T3OA 2W4CA 3R5CA 1VQ7S 2QO3A 3TA0A 3HM9A 3UNYA 4S0MA 4DR7C 4DV7J 1D09B 2DYAA 5GAHI 4FDFA 1DTQA 1EQMA 2YKMA 3M2RA 1FD2A 3U27A 5DG7A 1HWIA 1QTMA 1OY6A 3RR7A 1T0TV 4W98A 3AD8C 1J5EF 1T94A 3HT0A 2BBEA 2RS2A 4R5PB 4L4QA 1XEZA 2VONA 3UFCX 3RAMA 1HNXJ 1SIWB 4TN2A 2UV8G 4FPIA 5EWGA 4HYKA 2Z56B 4BHQA 2DGUA 1WD6A 2EW9A 2KL8A 5GAHU 2ZH3A 5J2NA 2JRSA 1B3TA 2RHQB 1I3OB 1VDHA 3HO1A 4MYUA 2VFTA 2ROPA 3TQEA 3W7BA 4WTOB 1FT8A 4MAKA 3VZHA 3P49B 4I64A 1O90A 4YY3C 3ELHA 1EP4B 4HDGA 4AYBD 3TARA 1ZETA 1VQ8S 4YB7A 2V94A 1PC4A 3PYEA 2DRAA 4ECQA 2LQ8A 2DIUA 5LMNF 1VRTA 1B7FA 2MQNA 2WB1D 3W65A 4L7IA 2OEKA 3ZFVA 3CCLS 4GRSA 5D4NA 2JEIA 2SXLA 2KJWA 5CXTA 5L46A 1RT1A 4ECSA 1S4FA 5KFIA 2BR0A 2G0JA 8AT1B 1HWUA 4OHWA 3TO8A 4QOTA 1NDCA 4I0WA 3PR4A 2FVPA 1KKGA 5I4MA 1SBRA 3JQJA 3K5NA 1MKYA 3D6FB 4YEAA 1NK9A 1Q79A 2DGVA 3M2VA 1UEVA 2XZDB 2R7UA 1N52B 4DV1C 3KNGA 3H0PA 3BH6B 3VWSA 1U48A 4K7QA 5CYQA 1RU2A 4H4OB 5F3TA 4DR1J 5J2QB 1QLNA 3MXHP 3BBCA 3R5DA 1R3NA 2C2NA 5CZVA 1M5VC 4FP9A 1ZPVA 2G1HA 1H98A 3QNWB 3W5YA 1HNZF 1P4EA 3GJTB 5LMNC 3V4IB 3A12A 1I94F 4KHPJ 3DHVA 3BSAA 4DV7F 1VBZA 4CYUB 1J27A 1FFWB 1TMMA 2Q1LA 2DNOA 4C6AA 1VK3A 1HPZA 2F7VA 2V69A 5K20B 1XHJA 4O3OA 3MEGA 5KEIA 2MZJA 5D0RA 2BM1A 1ZTWA 1UFWA 4ECTA 2A2DA 4DX8H 2WW4A 2DPLA 4RL1A 4JI3J 4NRTA 3G2XA 2DNYA 2GMLA 2PE8A 1CJKA 2DGTA 4MYTA 4DU8A 1K0TA 5KFEA 4K4WA 3NYQA 2K2PA 2RRNA 4OHXA 1DBDA 2ZBQA 4OHVA 5LL6d 4P74A 2R7VA 4P72A 4DV4F 3LNVA 1H2VZ 5T7LB 1HI8A 3QGHA 4NLPA 1T02A 1L5UA 1A9NB 3PRBA 5KT7A 4F4ZA 4F3MA 1KOHA 2VF3A 3G4SS 3GZ7A 2ZKTA 4DUZF 4A8FA 5KG6A 5IV3A 2HNDB 1MXBA 1F5CA 4HACB 1NB7A 2GA7A 2E9ZA 3GR1A 5GADU 2N4CA 2Y9HA 4LF9C 4C3MA 5DLGA 1S0VA 4A47A 1JNRB 3H98A 4OYXA 4YB6A 2CG8A 3UN5A 3ADAC 3CPWR 1C1CA 2J76E 4K4XA 1QWIA 4I9FA 1NYEA 4DV5C 2EGTA 2HBQB 4CLTA 2J5AA 2F9DA 1QE1B 1YJRA 3MAHA 2JEFA 3DRRB 1PC5A 4M63A 1FWKA 3PXGa 4OI2A 1XK8A 4D3HA 1LCIA 2E5JA 2B4PA 1T03A 2E5LF 4M5NA 2VOPA 3HVTB 5C2GA 1K0RA 3JSBA 3M8QA 1ULTA 5IT9Y 4I7FA 1RT1B 1CVJA 4YOEA 3BGOP 3SFUA 4ANDA 1NU4A 3OW2R 1PG3A 1PJ6A 2GHWA 4J9RA 1U09A 1ZBTA 3ILLA 3MM8B 1MMLA 2DCLA 5B0AA 5KTQA 4DG9A 4JYAC 1N32C 3K58A 1BQNA 4ZVRB 4XPEA 3D9BA 4G65A 3MR7A 3UDVA 1U49A 1S59A 3PO4A 1BQXA 2QMUB 2Y8WA 3A25A 2LXIA 1BWVA 3B4MA 1YX2A 4HACA 4IKAA 4DSEA 3FC9A 1GNKA 3RW6A 4NXNC 3KHHA 4I67A 4O0IA 1O5JA 2X7IA 3R1HA 4MIBA 1YJUA 2ZUGA 1NAQA 1Y11A 3PG9A 4PG6A 3HULA 3FCVA 1M1KT 4MMOA 4DS4A 1SKRA 2JLGA 3PKMA 1K1SA 5IFIA 5E3CA 4RNFA 2GX8A 1T9WA 1UAWA 2DR6A 3MEGB 1TKDA 1L3VA 5KFLA 2E5LC 3LWMA 3J7AN 1RWMB 4LF6C 2DPIA 4Y2AA 8ATCB 3CCZA 3HX9A 2HS3A 3TEGA 4DV4J 3H5XA 2DJWA 4ED7A 1HMVB 3F73A 1YDLA 2W01A 1NDKA 3GV8B 1V3RA 2DH7A 4F4YA 5J2PA 1N48A 3KWMA 4Q7AA 1SVDA 4W92B 2MQOA 2IYGA 2GVDA 2Y0SD 2EFQA 2C3MA 4G1QA 4OYWA 3VV2B 4EZ6A 4R1MA 3X3UA 2JHEA 4FN5A 4XTTA 5KOWA 2R2UA 4MIAA 5FDLB 2KG0A 1RABB 1VQ6S 4FUQA 5BSVA 2CJYB 5HATA 2HFSA 3H40A 4LFBJ 2BABA 1AUDA 4GKJC 2AJ2A 2EG1A 2R42A 3AA8A 2CJKA 3K5PA 2GMJA 5B09A 2X3GA 4DFMA 2DIVA 3LP0B 5BYQA 5CABA 4NA3A 4YS2A 3K2YA 2IPOB 4ANEA 3IA0A 4DBQA 1PAEX 1X0FA 1U1RA 4KC5A 4ZLLA 5IFMA 3C15B 2QE5A 3ZZUA 2D3UA 3UD3P 4D57A 2EXUA 3CXCR 3GIIA 3ZTRA 2ALZA 4A48A 4DDFA 1MXAA 2ILZA 4KTVA 4DV3J 1T11A 4HH1A 3PW5A 1V60A 1WHVA 3M2VB 3PW7A 5IT4A 1SQEA 4LF2A 5DM6Q 3MCNA 1B70B 2JDJA 1N32F 4ZCKA 2F4VC 2RDJA 1UVIA 1VRTB 3I32A 3N6NA 5DJBA 3VAHA 4F3OA 2J7WA 4J9OA 2FLPA 1TKZA 2I5JB 1QVGR 4IDKB 4ZCIA 5HVFA 4IR9A 1MWYA 2V68A 4CZCA 2V4RA 1ZPWX 5D0GA 1HL6A 4JI5F 1P7LA 2AX0A 1Q8IA 2MDAA 2VDIA 1RHJB 1S7HA 2CKWA 3D0GE 4GO5X 4LSLA 1ZAVA 3POTA 4NWBA 2HHSA 3TNVA 4R0EA 4YHHJ 1U6FA 5J2MB 4RU9A 2Y0BB 4DFKA 2HHQA 2GJ2A 1JLBB 1FA0A 2ALYB 4LRCA 4P7TA 1NKBA 3NPDA 1X4FA 1S77D 4HDHA 3OR1A 3MMAB 3BGRA 4M5DA 1TFYA 2Y1JA 2KFNA 2OPQB 3A8KA 4CM2A 4PPZA 4MK9A 2H9ZA 3V81B 1JXLA 3CDAA 2GV1A 4OYIA 4X4TA 1RDRA 2QL5B 2B9YA 4DF8A 2WP0C 3VAJA 3FEXB 2YPYA 1DQAA 1URRA 1SJ3P 1QM9A 2Y1LB 3EGNA 4JI6F 3QAEA 1JXEA 1RT3B 3HKZD 4DZDA 4KGVB 3BR8A 2YQ0A 1FXRA 2M5OA 1FJCA 2WBMA 3RG6A 2QZ8A 1KDNA 2J8SA 1HW8A 2YNFA 1SL2A 2RQCA 2DO0A 1VISA 3DMJA 2VFUA 4ZP9A 2LP4A 2IC3A 2CPYA 3EZUA 5CAAA 2R9LA 2BOPA 4CO2A 1M5KC 4X65F 4JI5C 4RZRA 2Z2ZA 4MTPA 4DV1J 2D1CA 4A8XA 1BE4A 3RAXA 5A6WA 1ELOA 5F8IA 1JLFA 1RWKB 4BS2A 1FTRA 2BKOA 2GW8A 2LDYA 3AB2B 1MN7A 4Y65A 2R7WA 2HHXA 4H4OA 5HJXA 4M8LA 3NKYA 4O44B 4Y6IA 3OPKA 3WC0A 1S49A 4MK8A 4DX7A 1LFWA 1TL5A 2BACA 4DR6C 3OD2A 2BYCA 2I2YA 3AT1B 5T8SA 2HHUA 4OLPA 3SBMA 5D3GB 1RT4A 5JRHA 1VMBA 4A8OA 1TH5A 4H4KC 4DR5C 5IXUA 1OSDA 2HAIA 5F8HA 2P02A 1E6VA 3Q89A 1U47A 2EKYA 2YBVA 5KFNA 2UUCC 2I38A 4OYOA 1HQEA 2GAGC 3PR5B 3S01A 2OO4A 5BUSA 1WF3A 4RW6A 1BGXT 4CO5A 1C1BB 2OKQA 1VJWA 4ZN1A 2KM8C 1H7XA 3ICLA 2V63A 4DUYJ 4IR1A 1P9YA 1ZM9A 3IP0A 3QJPA 2M9KA 2YNIB 2ZNZA 1DAXA 1FXLA 1S57A 4TY9A 3R7SB 3LUYA 3W8GA 4DCTA 4X4RA 1DZ5A 3I9V9 2LXFA 4JUZA 2I5JA 4U67Q 2KVIA 1UKUA 3H5SA 4K2XA 1MMNA 2RE1A 3GIJA 3NGDA 3DLLQ 2F40A 1UTAA 3RRKA 3M7VA 4FVCA 4UOFA 4DF4A 2ERRA 1HNXF 1PBAA 3RB0A 4CH1A 3KUHA 1RE1B 3HSZA 5ETRA 1R8CA 1RTIB 4E0DA 1T5HX 5BUQA 1RACB 3DLGA 3VF0B 4C98A 4PABA 5ETQA 4DV7C 4ZPBA 4OX6A 1JLBA 2O67A 2VG5B 1LEOA 2IA6A 2QX0A 2Y4NA 3DC2A 1RLCL 1X7VA 4ID8A 2ZBPA 1FWPA 4BCAA 4F4KA 1URNA 4QIGA 3DLEA 2DHSA 2HGNA 3BBBA 3DGVA 3DFEA 3EVWA 4Q2MA 5GMKa 1MW7A 2LEAA 3I82A 1LNQA 1FERA 3CJ2A 5L38A 4TU7A 3Q8RB 1TK0A 3H2TA 2MSSA 1R7IA 4FYXB 4J90A 3UDEA 1DURA 5IWAF 1IVZA 3G82A 2L48A 3Q2TC 2QJ3A 3DGPA 3TQ1A 3QT6A 2RQKA 2D7SA 2DGQA 2KHDA 4HHUA 1V26A 3Q22A 5K8NA 2YH1A 2AGPA 4NEYA 5CCLA 2FZGB 3UCZP 4EBCA 1AT1B 1XMOC 2CPHA 3N5FA 1IBKJ 4KH1B 4URGA 3HFKA 4DR7F 2QTWA 3CB4A 4I6WA 1V25A 4R1LA 2GIQA 2HS4A 1SH2A 2FGCA 1UETA 4CIOA 1UZDA 2WBRA 1TELA 2AJ1A 2K1RA 4NI2B 2BMBA 4IFVA 3BSNA 3K89A 1VBXA 2MHNA 2CAJA 1HBUB 5AXMA 1WELA 2CYYA 2LDIA 3O44A 3VR1A 2D1RA 2VFRA 2J6SA 2ZOGA 4RNOA 3VAGA 3T1AA 2FY1A 1KS2A 4LR7A 2FY8A 1MWQA 2KN4A 3B6BA 2NCKL 2XMVA 3C19A 3ZC4A 2YWKA 2RRBA 4JI0F 3J7YU 1XWLA 1P9QC 3GKUA 5ETMA 2UXCJ 3LF0A 2ZVIA 4Q43A 1X60A 3HLUA 2K7JA 3EMTA 1FNMA 3UNGC 1M1GA 4NOZA 5HROB 2CIMA 1HWKA 2AMCB 1WHYA 2M3DA 4IOBA 4F04B 1DFDA 3KK1A 3EWGA 1RHKB 1T8EA 4NLQA 3C2PA 5K8FA 3GPAA 1RT6A 4P2SA 3IBWA 4J5OA 1K9MT 1L2FA 2JVRA 4ZP6A 2VA2A 2LQ5A 4U7UD 4KO0A 3L3CA 2M5HA 3G87A 2KT5A 2ZZTA 2DXFA 1J5OB 2ASYA 1CS4B 2MM9A 2HS0A 2LU2A 1VEHA 3UDCA 1RA6A 3AJ2A 5CYQB 3VQSA 3UX2A 3LGNA 2HHTA 3DRRA 1MXCA 3VALA 2Q66A 4ELVA 4K8RA 2KG1A 4QW9A 2VICA 1WEYA 2BM0A 1A7GE 2IDEA 1X5OA 2LMIA 3JS9A 3R5GA 5KFOA 3I4PA 4EUVA 4YB5A 3KLEB 3D6TB 2RRAA 4DR1C 2UU9F 1N5VA 1PJ7A 1ZOTA 3HVWA 4LVNP 4MFBA 1WNEA 3DXBA 3R7NB 4Z7CA 4NMXA 4WTYA 5EWEA 2CQ4A 3KHLA 4NI2A 2VHGA 1IBLJ 2L41A 4LF7F 1SQGA 1YSJA 3L4BC 2NYHA 3OR1B 4E8UA 2DHAA 1IBMJ 2RB7A 2VG7A 4WIIA 1N54B 5D0EA 3D54A 3AXKA 3CDUA 2CY1A 1HNZC 5KG1A 2VZEA 1RTJA 2XR1A 2E1MC 1EB0A 1PILA 2IBOA 2DNLA 1UJ4A 2GIRA 3CJ8A 3RGIA 4WZQA 3KHGA 2BJ7A 2XMWA 3NGRA 4DFPA 1FKPB 1QSLA 4M5LA 2JLEA 1TKZB 1WDDA 3KLEA 3G8QA 4BC9A 2ZH2A 1AZSB 4B3SF 1EP4A 3OFEA 1MU2B 3BDPA 1S1XA 4PUOB 4JM1A 3CEDA 3QYYA 4M95A 2DB1A 1PYTA 3R97A 1VRUB 4C8OA 1HNWJ 5DDPC 5H9FK 4G37A 2HHHC 1G1XA 4ZJZA 2EWHA 2QA1A 3H42A 1K8AT 3LAXA 1O6XA 2PIIA 4N56A 1HQ2A 3ITHA 3VGSA 3I4HX 3VAIA 2JEGA 2ASLA 2CXCA 3T9ZA 1BQMB 2DNQA 4X62J 4V19X 4CYUA 1MDFA 4OZ3A 4DR3F 2U2FA 2B7CB 3QWPA 3HVRA 2RQ4A 5KFTA 3GCXP 5KFVA 3KG4A 1KR4A 2HGMA 2ZUAA 2O5DA 1HKAA 2G9OA 3TP2A 1YI2S 4HI1A 1NK7A 4E98A 1QAIA 4DV2J 1VCTA 3HFZB 3ZZRA 4CLFA 1JJ4A 1X9WA 4OX8A 4JI4C 2DCUB 3MAAA 1VLAA 2DHGA 4J9VA 4F0MA 4I9GA 3JSMB 3CJSA 1TKXA 4U95A 1Q82T 2DGWA 5G4DA 2XNQA 1S6QA 1FWLA 1SL0A 1AFIA 4WYLA 4P75A 1L3KA 4DL0C 3ZZZA 5A2QY 4IFVB 2DRBA 4AL6A 3CJRA 2BJOA 3TRGA 1H2TZ 5E2QA 3KK2A 1FRLA 1HBUA 1Z2LA 3FFIA 1J2VA 3HK2A 2WVCA 3CTRA 3VQTA 3A8JA 1NK8A 1Y5IB 3CW9A 4DCVA 4LF7J 3M8PA 3NCPA 5GAEU 2Y1IA 1V6HA 1DLOA 3AAWB 3TVYA 3CCWA 4DEZA 3BS9A 5KFSA 3M9OB 1GTHA 3EYZA 4M5JA 1NHUA 2Q43A 1RY2A 1HBNB 5KOXA 1NPKA 1PIEA 1M6XA 3ZXWA 1RBLA 2PFDA 3JB9k 2DPJA 3MUMP 1XERA 4PWUA 5DGAA 3VHQA 3CF5Q 3PHEA 3QJLA 3BO3A 5KG4A 2QN6B 3PX6A 2PD1A 2C3YA 3MECA 4K4SA 3ENWA 4PXBA 1YBTA 2RIJA 4I1TA 4DMZA 1Z1ZA 3TUZC 5GMEA 3KLGB 2OEMA 4LJMA 4USVA 2K3KA 4NCAA 5JJBA 4WF9Q 5K85A 4RUBA 4B3OA 1FVQA 4O4RA 5KG3A 3G6VA 1FESA 4GVBB 2AYBA 2CQGA 3TQIA 2DGOA 3E51A 4TU9A 4OZJA 4R25A 4CTAA 1IR0A 1MLAA 3BEGB 3RZAA 1YTYA 3FSIA 1VFJA 4DSLA 4DR2C 1T03B 4DR3J 4OYMA 5HQLA 3CWJA 1X4EA 2CZVC 1FDBA 3BDEA 3I6PA 2W4DA 3IRWP 4DI6A 3T1YJ 1K47A 4KHMA 2E7WA 4A46A 3HHEA 4OYZA 2DBBA 4AQYC 3VAFA 2A2CA 4ATNA 4DL7A 2HJGA 5DZ6A 2D41A 1TUVA 2MZSA 3PV8A 1EGAA 2YXLA 1X4GA 2HFZA 3DAYA 1RT7B 5AE3A 2HQFA 4LF8C 4OXIA 1JMTA 2MQQA 1WEZA 3R9LA 3C14A 2AJQA 2ZH4A 2ROEA 1REVA 3QGPA 1N34J 1KVIA 4LQ9A 5GVQA 1IKVA 3BQ2A 2OFHX 4Q2LA 3IWLA 2O01C 1U2FA 1VRQC 1WTFA 2RF2B 4FNIA 1GH8A 3G7SA 4MIWA 4JV5F 1DTQB 1F5BA 1VC5A 1I6JA 3CULA 5A1GA 2E7XA 3KDOA 4RW7A 4IDKA 2KYXA 3M6UA 4WU3A 5A2QU 3X1LB 1JLQA 5BSMA 2B51A 2PEBA 1HBMB 1T9YA 3OUYA 4XX2A 1T9XA 3NOGA 3U1NA 4CLLA 3CCMS 2KZMA 2VKZG 3D0IE 4AQYF 3RRGA 3LP1A 2GIFA 3MPYA 1EKSA 1VQ4S 4UOHA 2BQUA 2MKIA 5C42B 4P73A 1UVNA 2P9GA 3N0VA 1QUVA 5D4LA 3T6JA 3ENQA 1NH8A 3ZZOA 4Y34A 4J9NA 1OSCA 4QU6A 1SJRA 4ENOA 1C0TA 2KXHA 5EGYA 4I2PB 4PRFA 3B82A 2VOOA 4IH7A 3DXSX 1BUXA 3QJJA 1HQUB 4KGMA 2LEBA 2AYGA 3BF4A 3G71S 1T5DX 4QIWD 3HP6A 2UXCC 4P9SA 4OIXA 4Z7YA 4C8NA 4UTGA 1RAJA 4DQRA 1APSA 5KFUA 2VJUA 3H90A 4USJC 1JLAA 2CJBA 3DM2B 1RAFB 5LMNJ 2J0QD 3GB0A 1MG7A 1N36C 3ZTPA 3W2VA 2I0XA 2FIUA 3DU6A 1IKXA 2V67A 2HNYB 2R8KA 1TP7A 4XK8C 5I42B 3FMWA 2VIHA 2WVFA 1YK9A 1VQ9S 2OLWA 2FTRA 1EIYB 1FI4A 3D1OA 5D8HB 5BURA 5BXIA 1VQOS 4RPFA 2FDNA 4WYWA 1ML8A 3CSKA 5IQQA 4CNZA 2E29A 3LP2A 4Y28C 1XNQJ 4AXJA 1R8PA 1E6YB 2DH9A 3M6XA 1VR6A 2YX4A 3IAS9 2F9JA 1CPZA 2FHMA 2UVRA 5HP1A 2OELA 1JJCB 3IRXA 2F4FA 2V8GA 4QYZJ 3T1YC 4JI7C 4JV0A 4IYQA 3NWRA 2AJ0A 1JB0C 5ETOA 2NLWA 2DEIA 5J2QA 5B08A 2UXDF 3NS6A 4K5RA 4KPCA 3MF5A 1IBLC 5GMDA 1NPRA 4UQTA 4M1KA 2YKAA 3EPIA 2XZTB 3NLCA 1ZA2B 4OYAA 4DL4A 2CQIA 1BY9A 2PT0A 2DVIA 2BKPA 4FF1A 2J8AA 2XGQA 2D7VA 1S6PA 2XMJA 4LRFA 4F7VA 2N7CA 2ZD1A 2ZVSA 2JC1A 3M4XA 3GQCA 4LF9J 4KT0C 4C48A 1FLOA 5BSRA 1IQZA 2J6TA 4UY8T 1KTVA 4DFJA 2OMOA 2HLUA 4O0NA 5KYVA 1U6BA 5KFAA 4QWDA 2NXUA 3AJDA 4KO0B 3I31A 4KPYA 3ET6B 1LQ9A 3D6HB 4L72B 3OV7A 4FKXA 4DUYC 3D1QA 4KV8A 1VHIA 1WJ9A 5RUBA 5F8LA 4F02A 4K4VA 3GFYA 2XHWA 4PZVA 4KR0B 3HHKA 2V2ZA 1CBKA 4WE1B 4CNYA 3OTEA 2WZ1A 2BE2B 2GJFA 3K5OA 4NLGA 1YJ9S 4LSNB 4TKTA 1H7WA 1KLNA 3KDNA 3J80D 1UL3A 1HHTP 2F63A 4C0HA 2UUBJ 1XNRJ 5FDLA 3HPOA 2V5HG 1GX5A 2B9WA 3BV8A 4HT7A 1NSPA 2V8PA 3NAHA 3VCDA 4F2SA 2GHPA 2HHVA 4X66J 2YWFA 3TUPA 4ZHRA 4ZOSA 1TUWA 4RBUA 4I2QB 3QIPB 5E41A 2C2DA 4DV2C 4OHYA 2QMWA 4ZJOA 2FJWA 2XWYA 4JBCA 5ETTA 4OJ1A 2ZM6F 1XNQF 2Z8QA 3L8CA 1IKYA 1GMVA 1X9MA 2Q6BA 2RD5C 2VPZB 4YN3B 5AXKA 3QATA 4XIUA 5L9XA 3MMCB 2HVDA 3CT9A 1GT8A 2QC3A 2XI3A 3M1VB 3KJVA 1FRKA 2A6OA 1UZHA 4ZVUB 1IBCB 3R3TA 4OMFG 4X84A 3RU0A 3WHIA 2E5LJ 3C3LA 3GWCA 4KKOB 3LANA 1S6QB 4NOHA 2I6WA 1U1MA 1CLFA 4IG0A 2BRKA 3K17A 3OT9A 4IG3B 1GK8A 3MR3A 4N76A 2XY5A 1O51A 5FLXU 1UJ5A 3KYLA 3FEYB 3SV4A 4OI4A 4N7TA 2V4QA 4GC6A 3EJMA 2CJAA 1KVJA 5HMYA 2GAHC 2DD8S 4FUTA 1V9OA 3GJRB 3CJ4A 3I0SB 4WBFA 3LGHA 5CYMB 2C28A 4DR6J 1EX8A 3C46A 4EBEA 4LF5F 3DRPB 1IUJA 3KXDA 4PWWA 2RMLA 4YHHC 4TYBA 3DLPX 1UA0A 4ED4A 3KNAA 4ZPTR 1WUUA 2B8PA 1OJ4A 4KKOA 1FDAA 2YWEA 1RWPB 3PYGA 3GMGA 3M2UB 2JOQA 3FZ2A 2FD2A 1VQ5S 4PUGA 1NCLA 2IVYA 4OJ3A 2IAJB 2VPWB 4ZA1A 3WBZA 1LK5A 3KMQA 2C42A 2OFGX 4NZ0A 3R1LA 4ZIVA 5D6GA 1KNZA 4WK1A 3E7XA 1RAEB 3ISNC 2A6MA 1Y0HA 1WG4A 2HWHA 2KXNB 2JEJA 5A1IA 4QZVB 2H54B 3LW5C 1U1LA 3LQVA 2MKCA 2ZEJA 1VJQA 1VBKA 1I51B 3T1HJ 1I1GA 3FUYA 3R2CJ 1OY8A 2EKNA 2FJAB 1VLOA 2IM2A 2XYHB 3HSJA 4LREA 4TXSA 1TK5A 2V4JB 3TUFA 1GMUA 2UUBF 1R0AB 1XNRF 4KQZA 5EWFA 3VVTA 3KLVA 4DSJA 4DV6C 3NS7B 2CPFA 2VU5A 3JAMU 2QLFB 2L3MA 1JXVA 4XAKA 1PYOB 1TU0B 3GFZA 3PIPQ 3MUVP 2VC1A 4B3MJ 3JQMA 1VQYA 3FBCA 4CO1A 1O93A 3RB6A 3PESA 3MCSA 4NZ7A 3OBIA 3VTIA 4O4GB 3OJSA 3MFIA 4OFZA 3IWNC 4LF5C 2RQMA 4QIVA 4LFCC 4ZPCA 3SZ2A 1FRIA 2AKWB 2D3ZA 3OTDA 1M90T 2RAQA 2R8JA 2V9KA 1YJVA 1XMQJ 1W25A 3JQKA 1CJUA 2GVZA 2BH1X 4JI3C 3MPWA 5JXSA 2B6AA 1S1VB 2D1SA 2HZAA 1IQTA 1R31A 4OZNA 4JI2J 4DG1B 4OX9C 1HLWA 4X64J 3J80U 2VG6B 2KI2A 3T19A 5BYRA 1RK8A 3D6MB 1FKOB 2HFOA 2U1AA 5C24A 2VJVA 4UUXA 2UU9C 3AOBA 4NE9C 2H1YA 1Q95G 4LR8A 1CJVA 2KDOA 3T41A 4WCEQ 1S12A 1TAQA 2KYZA 3TAQA 2RS8A 1D8ZA 1U7LA 4CO0A 2UUBC 1MDBA 3UR3C 1XNRC 4A4JA 5KFQA 1RT6B 2IBKA 1HNVA 2WHOA 3OFHA 3CJKA 4B3RF 3M8SA 3TDEA 2MLZA 2E9TA 1WC3A 2E5IA 4PYAA 4WP8A 3SV3A 2R7QA 4TLRA 5DG9A 3U02A 2CQCA 5H9UA 1RI7A 1U26A 2R2RA 1VYAA 5LSRA 1B7YB 4GO7X 2IDLA 1IM6A 1S99A 4EYHB 2M4MA 2YX7A 1S10A 1N56A 4WFAQ 5J1NA 1C4CA 1EZZB 2G1DA 1GAOA 3A9UA 2HBYB 3HJVA 2NSCA 1OWXA 4WXWA 5HANA 2VH7A 2Z2LA 2ZZNA 1HNWC 4NRUA 1PCAA 1FF2A 3SXLA 1T9VA 2MQMA 4OX9F 1E6YA 4CT9A 1AYEA 3FSYA 4DX5A 5J2PB 5DQHA 3K57A 1I94J 1AFJA 4KTQA 3MM5B 4J9PA 2HHHF 4FTFA 4WS9A 2CWKA 4M5IA 1K44A 5A76A 4OV1A 4DQSA 3V81A 2UVVA 5A6PA 3WC2A 4IUFA 2JC0A 2GJIA 2WVBA 1N36F 2RF2A 1U1KA 3PX4A 1ZM4A 3W66A 3WX4A 2ZWOA 5GAGU 5A8KA 1LWFA 2MKHA 1EJ7L 3W2VB 4TQSA 3RB3A 3ETMA 2YKNA 4IO9Q 1UWAA 1QAJA 1NHKL 4WJBA 5BR8F 3T5JA 1S1TB 5A8WB 1U8WA 3C6TB 3NBPB 2AGOA 2PEHA 1BWEA 1GMWA 2NSBA 1XMQF 2HZVA 4QQBA 3RAQA 4X4QA 4ILLA 2DH8A 2GZOA 1YGYA 1UWBB 4NX9A 1NJYA 1NJZA 4ELTA 1RCOB 1UPPA 3TX0A 1HYSA 4LRBA 1G3OA 2BQ3A 3FCHA 2J9EA 2LA6A 3ONQA 2AEFA 4X64F 4KRWA 2I8EA 4CLPA 1JNZB 1HNIB 3VZIA 4FS2A 3EE3A 4ES2A 4NLRA 2OD4A 4RW9A 1XN9A 2WCXA 3THTA 3PW2A 2AQ4A 3WX8A 1NBEB 3EQ6A 4PQAA 2BXJA 4B3TF 2QFIA 2MHEA 2MGZB 1W2IA 2W9CB 4P2XA 4UOGA 1Q1KA 3DOLA 4DCUA 3KTQA 1ZA1B 1NZ8A 3N79A 4NEZA 5HN0A 5DGBA 4DV6J 2ZDOA 3EGWB 2O1PA 2LEPA 4B3RJ 2OIHA 3WIVA 3A8EA 4ER8A 5K8MA 3W8PA 2RU3A 3CC2S 3LP0A 5BSUA 4CM0A 2QG9B 3DYAB 4NXMF 2HBRB 2WOMB 3QSIA 2AZ1A 3W9HA 2NXCA 1Q86T 2KM8B 5THWA 3WIUA 1VC6A 3QRPA 2W4PA 4O3RA 3SSQA 1N33J 1YJTA 2XCPA 3QIPA 3OVSA 3IO1A 2DR9A 2KZFA 2IMOA 4PG5A 4EO6A 1O0PA 3DHXA 5LJ3Y 2DITA 1RLDA 1WHWA 2DNMA 3F56A 3PIOQ 3N2QA 4ZJLA 1Q8BA 4TVAB 1U1QA 5D4OA 2BJ8A 1JQGA 3EDQB 2MKJA 3J7ZT 2HWTA 4Q8FA 1G2EA 3QLHA 2HHHJ 3CCES 3IBFB 3SCJE 4DR2J 2ADBA 4TYAA 1S79A 2DNRA 4WKRA 1WKKA 4DV0C 3IXQA 4ZS6A 5KFWA 3MOJB 4HTJA 2F4VJ 3AD7C 4QCLA 2CQDA 5AE1A 1RAOA 3OTCA 3BJYA 2D3OR 3TJ8A 1NSAA 3UO0A 2ZH9A 3G86A 5IZHA 3D66A 2QFJA 1F2HA 2M7SA 1R8BA 2VA3A 3KLFB 3K5MA 4DL6A 4DLGA 4ECUA 5KG5A 2H3EB 4GVBA 1UCNA 1C4AA 4WFNQ 4EI2A 1R43A 3VGUA 1KEKA 2B9XA 2Y27A 3UI3A 3K8WA 5HJYA 1R0BG 1U45A 4FF4A 1BQNB 2XMAA 1NXIA 1Q4RA 4RJVA 1DJ0A 1KRPA 5JUMA 4LF8F 1HYSB 2ZE2A 2MCQA 3EVOA 3H25A 2D27A 1PA4A 3KLIA 2CFXA 4AD6A 2YKPA 3TZXA 3W61A 5JVGQ 1I94C 4OYBA 1EETA 1X5PA 4IG0B 1FO1A 1RU1A 3KFWX 3MMBB 1YQHA 2EEYA 4F0HA 3CC7S 3N54B 3GP9A 3IM8A 3AHPA 2M8DB 3D7SB 3GYNA 3M8QB 1Q0NA 2DR8A 4JV5C 4U7CA 2GGPB 1HW9A 1Z4UA 3K5LA 4HL9A 3A9VA 3O3LA 4B9VA 4FYVB 1ZH5A 3G8SA 3O1LA 3H2UB 3GIKA 1WC6A 3IN5A 2C2OB 1FDDA 5M2UA 3LP2B 4TY8B 1TL7B 2W2PP 1T05B 1NEEA 2IRXA 3A8IA 3MM5A 3KK2B 1NDPA 3QLHB 5I3PA 3J81D 5H9EJ 5HK4A 1PAUB 2QA4S 2GCFA 3PRDA 4NLDA 1T9UA 2HKEA 2FZCB 5C2CA 4DSIA 2IY5B 2FHJA 5A0YA 2HYIB 4DSKA 5KFXA 2XLIA 4PXEA 3N01A 4UW2A 4U9RA 4AL5A 3MEDA 2IA0A 4MK7A 1C0UA 4YY3F 4DV3F 4JI1C 4I6YA 4K4UA 4F4WA 1JLAB 1R6VA 1YVFA 2D69A 2PMWA 3DM2A 4U8VA 2V2KA 1RHRB 1RHMB 3P4UB 3EM1A 1N32J 4C0OC 3BKUA 1VIOA 1P1TA 4LSNA 4ZMMA 5CD4A 2FZKB 2WOMA 4ALZA 1BMQB 1CQMA 5K8PA 1HBOA 3HFVA 3R9XA 2Q3PA 4RO0A 3R5BA 4PXDA 2Z57B 3PO5A 3TUIC 3LGXA 4MTNA 1RAAB 1SIZA 2EFPA 3I5AA 2OPLA 1JWWA 2DISA 2B3TB 2BV3A 3DDNA 2BKNA 4JI6J 5CQGA 2OPPA 4C8MA 4AXIA 1LV5A 1U6ZA 2BA9A 2CQPA 4UZCA 1UP1A 3TZWA 3LWLA 2IM1A 1JLEA 4L74A 3HMJG 2OH2A 3PFOA 4YHHF 4OZ1A 1LW0B 4RW9B 4TPSB 1CS4A 2L9DA 2XYGB 4RBTA 4LBPA 3TAMA 1U1OA 2ZDPA 1H74A 3SQGA 5DZ7A 2ONFA 1KKHA 5F8JA 3G8TA 1KLMA 3NGUA 1S1VA 4J37A 2E44A 4NLSA 5F0UA 1VQMS 4B9TA 1TAUA 1AXQA 3CIMA 3E01A 4I56A 4DG1A 3T1YF 2MPUA 4JI1F 5T8TA 1MROB 2GMHA 2OPLB 4DV3C 3QIDA 1HHSA 1NSQA 4K4YA 1RUSA 1TZ0A 4YFUA 2UXDC 1YBUA 2AYMA 5E3RA 3QQCD 3I5BA 4C3LA 1IBLF 1CQNA 5J1EB 5KT2A 4IOCQ 5J2MA 1FE0A 1X4AA 4MKAA 2M88A 1NY8A 4PYDA 3CCTA 1WOPA 3U1MA 1NNDA 2PA3A 3HJFA 3B78A 4ILMA 4IH6A 2XHCA 3CQ2A 3EXCX
chains in the Genus database with same CATH topology
3DI6B 4YQWA 5DDQC 1R0AA 1WI8A 4Q8EA 4O3PA 2P5VA 1HMVA 2LQJA 3M6WA 1VC0A 3UCGA 1U25A 2QV6A 3IAM9 1CC8A 1ROFA 1RTHA 1Z2ZA 4TLRA 1FCAA 1S1UB 5KG0A 3GG0A 5EDWA 3B7WA 5LXYA 3DNCA 3IEVA 2N3OA 4LF6F 2JLFA 2AJFE 2XS5A 1XTZA 3S8SA 1X4CA 1UVKA 2FB0A 2XMMA 4OZ5A 3SYZA 1DARA 4NCGB 4RUCA 4IRKA 4EATA 5IT9D 2LVWA 1RWUA 5HLFB 2FHOB 1Q7YT 2KKHA 5HBMA 2JMPA 3BZQA 1R8AA 2D74B 5CYMA 2IHR1 2OPRA 3AA9A 3AH6A 3NGKA 2GHVC 3J81Y 3CCQS 4WFYA 3TAPA 1RTDA 2E9RX 2ZE2B 4ITSA 4HLBA 1GXUA 2UUAC 4GKJF 3MECB 1TL1B 1QJHA 3FMBA 4DV2F 2FHJD 2FC8A 1ZM2A 3HI9A 1ZAXA 1KQKA 4GXQA 1CG2A 5I3UB 1WF2A 3OQ2A 2YWHA 4BWMA 3GPCA 3FGVA 5HLFA 3U1LA 3T6BA 2XGPA 3OLBA 1S0MA 4TU8A 2C3OA 1RGVA 3MHYA 4IOAQ 1IJFB 4ZPAA 2ZH7A 3N6MA 1H2UX 1FD8A 3DU5A 4CO4A 4R8UB 4XO0A 2HWIA 2MZ1A 3MMJA 3OHBA 4ZVFA 3MFHA 4OJGA 5KFCA 3D5MA 1MD9A 1MWZA 2HNZA 5DDRC 1MNEA 1N6QB 2HNDA 2MYFA 2HNZB 1SV5B 4ECYA 4IFYA 3ULHA 4ES3A 3NMAA 1TVRB 4NMLA 4ZVHA 5L1IA 2F1FA 4ED2A 2UUAF 4ED8A 2E8FA 1LWEA 2P9CA 3PEJA 2HVZA 3JYTB 1WG5A 5AXLA 3R27A 1PO6A 2APOA 2Z2MA 2ZJRQ 3NG8A 4ED0A 1KC8T 1AMUA 2C2EA 3LAKA 2D1QA 4USIA 4IRCA 4GS5A 2VG5A 3PACA 4I7FB 5KFZA 4CTAB 5HO4A 1FRJA 3KMSA 4RX6A 3MUTP 1LXNA 1O8BA 2IFXA 3ETOA 1U4BA 1IBKF 1HNIA 3DRPA 4XDDA 3QZ8A 5I3UA 1X8DA 3CD5A 4Q45A 4RW8A 1L3SA 1S0NA 1UFLA 5KAKA 2NPIA 1JJ4A 3OXFA 3HPOA 3OL7A 2VQFC 4B3MC 1JKHB 3PJWA 2OPRB 1ULRA 4C3KA 2UUWA 2M52A 1RTDB 2RNEA 4X66C 3OXGA 2WB4A 2GGPA 2XC9A 3V4IA 2OPSA 5B0FA 2XLKA 4GXRA 4PQUB 3NBPA 3C6TA 2A3JA 3V2UC 4X65C 2XNRA 1N34F 2ZH6A 3QWUA 1S97A 4DL3A 3AQPA 2ZH8A 1V3SA 3CJ5A 2UUTA 2VG7B 2A18A 2LECA 2E8CA 3ETCA 1HQEB 3DLKA 2AX1A 2QIFA 5D4PA 5KFRA 3G9CA 5FLXD 1RTHB 2ZBIA 3TW0A 1OIAA 1FEEA 3CE8A 5IT0A 4ISBA 1LXJA 5IS2A 2KHCA 2DNPA 1K1QA 4DR5F 2HNYA 3CUNA 5IQ6A 4K50A 2VQFF 1FJGF 2CPIA 3D2WA 1NKCA 3MTKA 2MZRA 1SC6A 4BDPA 2UUCF 4NDNA 1CC7A 3TUJC 2QA2A 1NK4A 1SJQA 3ISZA 3RBDA 2M5YA 5KFMA 2BE2A 2UP1A 4QPXA 3G6XA 1HH2P 1UW4A 4JOUA 1N5SA 4F25A 4KIAA 3V5RA 1B0TA 4KJIA 4YR0A 3FRYA 4QR1A 4QWCA 4V19J 3S82A 4D56A 4FPRA 1HNWF 4HHJA 3OSNA 3OSPA 4ERDA 4F8RA 3TAMB 5KYTA 2VQEC 4N77A 5B7WA 4UY85 5KFJA 3SQGB 1FXDA 3MZIA 4QU7A 4NA1A 2KU7A 3JTNA 2XULA 1UA1A 2ZOMA 5EX3A 4X62F 1SI9A 2CPZA 4FBUA 3GE9A 5BSTA 3HDSA 1J5EC 4JI6C 4LIWA 4FXDA 2NUHA 1TKTA 3BSOA 3Q8QB 7FD1A 2QVYX 1YRTA 4D57A 3BM7A 1FJGC 5SUHA 3VNQA 2UZAA 3IFEA 2E5GA 2ZFHA 3F41A 3QAUA 4FXVA 3BQ1A 3KHRA 1IKVB 4F4XA 4LUBA 4G1PA 5C5JA 3RBEA 3RV2A 2RT3A 3I07A 1RTJB 2P2JA 2JFKA 3MD3A 3TYTA 2L08A 4DOZA 3OTBA 1HI1A 2X1AA 3NI2A 1KTQA 4Y2KA 1RT7A 5E3QA 3UDLA 2B7BB 5A0YB 2BVZA 4IFYB 1OO0B 1H38A 1HD1A 2WW8A 4FNHA 3IPLA 5F8GA 3H59A 3QGIA 3ZZTA 3NCRA 1IJEB 2DNGA 4KFBB 2JZ5A 2LYVA 3I9ZA 1S1TA 1KQFB 1UEUA 3SCIE 5A8WA 4F50A 1YJ7A 5GADI 4OQJA 3Q2SC 4I69A 3V4MA 2ASJA 4XPCA 1P1LA 1FDNA 2QRRA 1N33C 4NXMC 2K7KA 5M2PA 4Z2XA 3J7Z5 2NZ4A 4ZPVR 1DQ9A 3CJEA 2R8HA 2MB0B 4X2BA 2EFOA 1TL1A 5DLFA 2LQ9A 1BD6A 2YH0A 1XR5A 3H8YA 1UJ6A 1HFEL 3MEEA 4A8WA 3ZZ0A 3AB4B 2VBWA 4H54A 1UWBA 1ZM3A 2EG2A 4HTIA 2EC0A 1SH3A 1JOSA 1NO8A 1D0EA 3N4WA 1P8GA 3OUYB 4QWEA 1KSPA 1V3ZA 5A8RB 4GKKF 5CCMA 4PXCA 2N82B 3WZ0A 4U7UK 1OS5A 1LW2A 3D0HE 3DLBA 2Y4OA 2A10A 4PROC 3KOAA 2W8LA 2QEXS 3FRZA 3UWTA 3CCRS 3MMCA 1DRZA 3L7PA 2HVHA 1QE1A 4D4GA 1DLOB 1FJEB 3M9MB 5DO2A 4RW8B 4D4IA 2XMUA 2FVSA 2CQ1A 2XSJA 4DLEA 5D3GA 3CW8X 1LKZA 3VNSA 2MKSA 2IM0A 3E2EA 1P6TA 4YB1P 1TKXB 3RB4A 2E66A 4RW4A 3US5A 3JSMA 4O44A 1F9FA 5IWAC 2CPDA 2MY7A 4PWDA 3VNRA 1Y9OA 3OL6A 3NYRA 4ETXA 1SKWA 1BLUA 1GX6A 1JK9B 2HRUA 2J9CA 2EPIA 3IS9B 3I0RB 2NQPA 4AFFA 1TV6B 1XMOF 4YR2A 2IC3B 5E33A 4DHVA 1S0OA 1SV5A 1BQMA 2QSFA 4DV5F 1N6QA 2XEXA 2EK1A 2ACYA 2WSEC 2B4UA 2WONA 2PA8D 3C8YA 4HPVA 1RT3A 4FS1A 3KG1A 2R2TA 2R8IA 5F41A 1W2BR 2WRMA 2D28C 2XSJB 2PSZA 2HFNA 1JIHA 2HZCA 4O23A 5HMXA 1VQLS 4NLXA 1S6PB 1HD0A 1LW2B 3O6QA 4JI0C 1S1XB 4PUOA 5DV9A 4DR3C 4WK3A 3RG2A 4RM3A 2P6SA 1JLCA 5LSOA 2UVWA 4Z37A 4NYPA 3TX8A 4RMNA 5HBMB 4M94A 4A8KA 4JYAF 2LKZA 3CGIA 1FTCA 5A8RA 2CQ2A 4FXWA 5A8KB 3BN7A 3I55S 5DS7A 5T41A 2YKNB 4NXNF 4PG8A 4B9LA 1K0VA 1DHMA 4QYRA 5GTDA 4Y2IA 1DTTB 1XR7A 2HQIA 6FD1A 1TKDA 1WWHA 1QVFR 2QT7A 4A8QA 1VBYA 2B0GA 4N8NA 5MAOA 3SSRA 4WZMA 3AQOA 2QMXA 4I6AA 2AU0A 1MSWD 1IXKA 4ED3A 3J7YI 2FJWA 2RJZA 3DOMA 3CD7A 3PDNA 2GNKA 3Q23A 2ZOFA 2KXFA 2NUUG 3FNNA 5K14B 4B02A 5L1JA 1TL3B 4G3IA 4DS5A 5KFKA 1XR6A 3PROC 2YWCA 1HR0F 3FQKA 1JJ2R 2JH3A 4RBVA 1HNVB 2ZNYA 3K7RA 2R7OA 3IMLA 5F8MA 4DG8A 5AE2A 2UXBC 3I0SA 2KJVA 5E3AA 1JKHA 4LF9F 3MM9A 5IM0B 1XRAA 2BUNA 3O2IA 5BYSA 2E1CA 1FEHA 1T7PA 4X4SA 3OL8A 1F5AA 5FLXY 2JFDA 3DRYA 4BC7A 1JLEB 3BN4A 3GIMA 4AL7A 4IQMA 4USHA 2QA4G 1MROA 3RTVA 3MM7B 1RISA 1KFDA 4KSEB 1VQKS 3DLHA 4RVOA 3MM7A 3TVKA 2XB2D 4A8SA 4KB7A 2CQHA 3PVXA 3BGRB 4M5DB 1D8YA 2IVFB 1LFPA 1WF0A 3HHNB 3NMRA 1S9EB 4ZKAA 2GO9A 2PN2A 1YBAA 4BSZA 2NREA 1USPA 2ZITA 5IM0A 2ZH5A 2KO1A 4K0KF 1TVRA 2X51A 4RW4B 1C0UB 2JSXA 1AROP 3NS5A 4OLOA 4G36A 1N5YB 3QO9A 3VAKA 2VFVA 1AW0A 3LPYA 2P2QA 2VV5A 4HEA9 1NK6A 1Y3JA 2AYEA 3S1TA 3P5TL 3OJUA 3JSRA 2EVZA 3HHLD 2F8MA 3DYAA 4NCGA 4PZPA 1NH7A 2YKQA 1R27B 3CMES 2V8HA 4DCSA 2FGOA 4HKQA 3M32A 4QJVA 2ZHAA 2M0GB 4RLEA 3M2UA 4QIFA 5EX0A 1N5TA 4F26A 1DTTA 1YWXA 2RUGA 1GQEA 4IRDA 4ID5A 2QVXX 4ECZA 4X4VA 1SUQA 2NPFA 1LOUA 1S9GA 4PG4A 4LQ3A 2XY6A 1X4HA 4ECXA 5ITHA 4C0BA 2G4BA 3BQ0A 1FHTA 2HW3A 2B4VA 2WSCC 3I96A 2R4FA 5BJRA 5CZXA 2J7UA 1L3TA 2JJ4D 3CVKA 4K4TA 4CH0S 2DR7A 5FIIA 3H2LA 3N9UC 3W2WA 3CMAS 2YNHB 4RKUC 5E5NA 1LWFB 1ZYQA 1IKYB 4KHPF 3H5YA 2Q79A 1QY7A 2O3DA 4DR6F 3V6DA 3M8PB 2J9DA 4DR2F 2ZBCA 2ZC3A 3ENVA 1GPMA 1IBKC 5DG8A 2VBXA 4OI3A 4H4MA 3UPFA 4ECVA 2F4VF 1FRXA 1WTBA 3EUNA 1VS3A 4OJHA 1FKAF 4B3MF 1KN6A 2B43A 2CPEA 4EO8A 4W90B 1IKXB 4RNHA 2NR0A 3C66A 5H1SV 2LU1A 2RU9A 2AP6A 2XY7A 3CIZA 2KFZA 3N28A 5J1EA 3SCKE 4JI7F 1HBOB 3ZZYA 2VBYA 2B4OA 2CQ3A 3AF6A 3T1HF 3DN9A 3MM8A 2B5JB 2ZHBA 4KGKA 5KT6A 1YRXA 4K5SA 3JYTA 4UOCA 3Q8SB 4R0MA 2GO8A 2IRUA 3CJKB 2XSFA 5B0BA 4ZK7M 3G96A 1BC6A 2RILA 3I5CA 1WEXA 4JV2A 2HVIA 1SXLA 2DHXA 2AGQA 2YNFB 4J9MA 2OBVA 3GFHA 3V6DB 5G0RB 4C11B 1T05A 3PM9A 3MEKA 5DRKA 3FSXA 3UCUP 3BGFA 3T9NA 3DOKB 1S1WB 1Q78A 1BA3A 2RSQA 4K0BA 3MMAA 1YJWS 1QAXA 2W25A