2MCQA

Nmr structure of a bola-like hypothetical protein rp812 from rickettsia prowazekii, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
MAISAEELEKILKKSFPSSVIKITDLVGDQDHYALEISDAQFNGLSLINQHKLVKNALSEILNKKLHSISIKTISIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Uncharacterized protein RP812
publication title NMR structure of a BolA-like hypothetical protein RP812 from Rickettsia prowazekii, Seattle structural genomics center for infectious disease (SSGCID)
rcsb
source organism Rickettsia prowazekii
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mcqA01
2KZ0A 3O2EA 2DHMA 2MMAB 1NY8A 2KDNA 4PUHA 5LCIA 2MCQA 3TR3A 2MM9A 4PUGA 2NCLA 1XS3A 1V60A 4PUIA
chains in the Genus database with same CATH superfamily
4DV0C 3GR0A 2QVYX 2OO4A 3NYQA 1MDBA 1HNWC 1M6XC 2P02A 5BSMA 4LFBC 4DUZC 2P20A 4YHHC 5IT9D 3R9WA 1MXAA 4AQYC 3R9XA 4NDNA 5KEIA 3NI2A 1QWIA 1J5EC 5AE3A 1PU1A 2QW0X 2NCLA 4I9GA 5K85A 4BCAA 1O90A 3UX2A 1WCJA 1HNXC 1PG3A 3SO4A 2ZM6C 4OXIA 1VEHA 3KXWA 3PBKA 1RY2A 2AYAA 4LF8C 1XNQC 4JI6C 5IFIA 4WV3A 3J81D 2OBVA 3CJEA 4RMNA 1ZB9A 3UZ0A 3A4IA 3IPLA 4JI0C 4D4IA 3AY0A 5JRHA 3DAYA 4DR4C 2D1RA 4PUIA 4DV1C 3PROC 3CW9A 3A26A 4DG9A 4PROC 2D7VA 4LFAC 4DR5C 5BSTA 5GTDA 3IEVA 4G1IA 4K0BA 4JM1A 3N2QA 2MM9A 1M6XA 4DR6C 4LF4C 1XHJA 4DR1C 3EERA 2CXCA 2QL8A 5K8FA 4X65C 2UXCC 3RG2A 3T1HC 3IEUA 4DUYC 3TR3A 4JI1C 1WF3A 3L95X 4RLFA 1O9TA 1I94C 3L8CA 2Z51A 1IBKC 4RM3A 5E7QA 4PZPA 5AE2A 5KYTA 3CW8X 1NY8A 1MKYA 4RLQA 1VLAA 1UKKA 4X64C 2D27A 4I9FA 4U5YD 2ZZNA 3B7WA 4JYAC 2QVZX 1PA4A 2V7BA 4B3SC 4X62C 1IB8A 2M5HA 4MH4A 4FUQA 2PROA 3GKUA 3VNRA 4DV2C 1XNRC 4JV5C 5BURA 5CZVA 4GKJC 1PG4A 4D57A 3J80D 1XRCA 3JAMD 4BC9A 3LNOA 2ATWA 5BSWA 1MD9A 4FUTA 2YWCA 3GPCA 1KKGA 1JOSA 4OX9C 1O93A 3NPDA 4RVNA 2YCBA 2VZEA 4LF9C 4DR3C 4JI2C 2E7GA 5A19A 1USPA 2UUAC 4BBYA 1TH5A 4LF6C 4ODJA 5IWAC 2KDNA 5LMNC 3DLPX 5LCIA 1ML8A 5BSRA 4DCVA 3AF5A 4GKKC 4BSZA 1YJ7A 4KTTA 1EGAA 4DV3C 1N34C 1LQLA 2KZFA 3LGXA 2P2MA 4D56A 4KTVA 4LE5A 1L2FA 5BSUA 1P4EC 2MMAB 3E7XA 3IMLA 4X66C 4DV6C 4JI5C 4K0KC 2JNVA 4LFCC 3UEBA 2E8CA 1IBLC 5ADZA 4R1MA 4GS5A 1V60A 4YY3C 4DV7C 4NXMC 2OPLB 1N36C 3CQ1A 1FJGC 2WP0C 1LCIA 4ZJZA 3I07A 2UUCC 2XR1A 4RM2A 2P2BA 2PN2A 2P2JA 3CQ2A 1MXBA 2CU6A 4GXRA 1XRBA 4DCUA 1MXCA 4FTFA 4JI7C 3H2TA 2HHHC 3VNQA 3I08A 2EGTA 4PUHA 4NOZA 5A1IA 2VQEC 1XRAA 2UXDC 1USPB 4ISBA 4WS9A 4IZ6A 4DV4C 2D28C 3UX3A 4ZLPA 4RVOA 3PESA 2E0GA 4DG8A 5BUQA 4IR7A 1K0RA 2YX1A 5LMUC 1ULTA 2WD9A 4DV5C 3N54B 2UXBC 2BJOA 4NXNC 2PT7G 3G7SA 4TPSB 5CZXA 3ETCA 4G37A 2YWBA 1AMUA 4GXQA 2F4VC 2UU9C 3FCCA 2DYJA 4B3TC 3RV2A 1IBMC 4L7IA 1WH9A 3TUFA 5H9UA 5T8SA 2KZ0A 4R0MA 4XX2A 4JI3C 1QM4A 1UWDA 2Y4OA 3TDEA 1FUGA 4LF5C 1NYEA 3A9VA 2E8EA 3AF6A 4G36A 2Y27A 5KYVA 2M5OA 1XMOC 2MCQA 2ONFA 3FCEA 4LF7C 2VSQA 4B3RC 2D1TA 3E7WA 3TQIA 4R1LA 4JI4C 5A2QD 3GR1A 3O2EA 4PUGA 5T8TA 4MTNA 3A9UA 5BUSA 4DCSA 4HPVA 1GPMA 1N32C 4L2ZA 3VNSA 5AE1A 1HH2P 2ZZMA 3EQ6A 3C5EA 2P2QA 1RG9A 2DPLA 3UOWA 4OYCA 1MDFA 4KHPC 3T1YC 1V26A 5DV9A 3LAXA 4EATA 4D4GA 5FLXD 1N2FA 4DR7C 1XS3A 1FLOA 1HNZC 5BSVA 4JI8C 3K6RA 3LNVA 4L4QA 2CY1A 2UUBC 1O92A 2Y4NA 2D1QA 1T5DX 2HJGA 4DR2C 5A1GA 1V25A 3DHVA 3OTOC 3A25A 1XMQC 3LUSA 4DCTA 3NYRA 4B3MC 2E5LC 1ZB8A 3CQ3A 2D1SA 1T5HX 2E8FA 2ASBA 2QVXX 1P4EA 2JMPA 2DHMA 4PHTA 4BC7A 2VQFC 2OPLA 3ETOA 2P2FA 1HR0C 1N33C 1P7LA 2BH1X 5BR8C 1BA3A 3S82A 3R44A
chains in the Genus database with same CATH topology
2KZ0A 3O2EA 2DHMA 2MMAB 1NY8A 2KDNA 4PUHA 5LCIA 2MCQA 3TR3A 2MM9A 4PUGA 2NCLA 1XS3A 1V60A 4PUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZ0 A;  3O2E A;  2DHM A;  2MMA B;  1NY8 A;  2KDN A;  4PUH A;  5LCI A;  2MCQ A;  3TR3 A;  2MM9 A;  4PUG A;  2NCL A;  1XS3 A;  1V60 A;  4PUI A; 
#chains in the Genus database with same CATH topology
 4DV0 C;  3GR0 A;  2QVY X;  2OO4 A;  3NYQ A;  1MDB A;  1HNW C;  1M6X C;  2P02 A;  5BSM A;  4LFB C;  4DUZ C;  2P20 A;  4YHH C;  5IT9 D;  3R9W A;  1MXA A;  4AQY C;  3R9X A;  4NDN A;  5KEI A;  3NI2 A;  1QWI A;  1J5E C;  5AE3 A;  1PU1 A;  2QW0 X;  2NCL A;  4I9G A;  5K85 A;  4BCA A;  1O90 A;  3UX2 A;  1WCJ A;  1HNX C;  1PG3 A;  3SO4 A;  2ZM6 C;  4OXI A;  1VEH A;  3KXW A;  3PBK A;  1RY2 A;  2AYA A;  4LF8 C;  1XNQ C;  4JI6 C;  5IFI A;  4WV3 A;  3J81 D;  2OBV A;  3CJE A;  4RMN A;  1ZB9 A;  3UZ0 A;  3A4I A;  3IPL A;  4JI0 C;  4D4I A;  3AY0 A;  5JRH A;  3DAY A;  4DR4 C;  2D1R A;  4PUI A;  4DV1 C;  3PRO C;  3CW9 A;  3A26 A;  4DG9 A;  4PRO C;  2D7V A;  4LFA C;  4DR5 C;  5BST A;  5GTD A;  3IEV A;  4G1I A;  4K0B A;  4JM1 A;  3N2Q A;  2MM9 A;  1M6X A;  4DR6 C;  4LF4 C;  1XHJ A;  4DR1 C;  3EER A;  2CXC A;  2QL8 A;  5K8F A;  4X65 C;  2UXC C;  3RG2 A;  3T1H C;  3IEU A;  4DUY C;  3TR3 A;  4JI1 C;  1WF3 A;  3L95 X;  4RLF A;  1O9T A;  1I94 C;  3L8C A;  2Z51 A;  1IBK C;  4RM3 A;  5E7Q A;  4PZP A;  5AE2 A;  5KYT A;  3CW8 X;  1NY8 A;  1MKY A;  4RLQ A;  1VLA A;  1UKK A;  4X64 C;  2D27 A;  4I9F A;  4U5Y D;  2ZZN A;  3B7W A;  4JYA C;  2QVZ X;  1PA4 A;  2V7B A;  4B3S C;  4X62 C;  1IB8 A;  2M5H A;  4MH4 A;  4FUQ A;  2PRO A;  3GKU A;  3VNR A;  4DV2 C;  1XNR C;  4JV5 C;  5BUR A;  5CZV A;  4GKJ C;  1PG4 A;  4D57 A;  3J80 D;  1XRC A;  3JAM D;  4BC9 A;  3LNO A;  2ATW A;  5BSW A;  1MD9 A;  4FUT A;  2YWC A;  3GPC A;  1KKG A;  1JOS A;  4OX9 C;  1O93 A;  3NPD A;  4RVN A;  2YCB A;  2VZE A;  4LF9 C;  4DR3 C;  4JI2 C;  2E7G A;  5A19 A;  1USP A;  2UUA C;  4BBY A;  1TH5 A;  4LF6 C;  4ODJ A;  5IWA C;  2KDN A;  5LMN C;  3DLP X;  5LCI A;  1ML8 A;  5BSR A;  4DCV A;  3AF5 A;  4GKK C;  4BSZ A;  1YJ7 A;  4KTT A;  1EGA A;  4DV3 C;  1N34 C;  1LQL A;  2KZF A;  3LGX A;  2P2M A;  4D56 A;  4KTV A;  4LE5 A;  1L2F A;  5BSU A;  1P4E C;  2MMA B;  3E7X A;  3IML A;  4X66 C;  4DV6 C;  4JI5 C;  4K0K C;  2JNV A;  4LFC C;  3UEB A;  2E8C A;  1IBL C;  5ADZ A;  4R1M A;  4GS5 A;  1V60 A;  4YY3 C;  4DV7 C;  4NXM C;  2OPL B;  1N36 C;  3CQ1 A;  1FJG C;  2WP0 C;  1LCI A;  4ZJZ A;  3I07 A;  2UUC C;  2XR1 A;  4RM2 A;  2P2B A;  2PN2 A;  2P2J A;  3CQ2 A;  1MXB A;  2CU6 A;  4GXR A;  1XRB A;  4DCU A;  1MXC A;  4FTF A;  4JI7 C;  3H2T A;  2HHH C;  3VNQ A;  3I08 A;  2EGT A;  4PUH A;  4NOZ A;  5A1I A;  2VQE C;  1XRA A;  2UXD C;  1USP B;  4ISB A;  4WS9 A;  4IZ6 A;  4DV4 C;  2D28 C;  3UX3 A;  4ZLP A;  4RVO A;  3PES A;  2E0G A;  4DG8 A;  5BUQ A;  4IR7 A;  1K0R A;  2YX1 A;  5LMU C;  1ULT A;  2WD9 A;  4DV5 C;  3N54 B;  2UXB C;  2BJO A;  4NXN C;  2PT7 G;  3G7S A;  4TPS B;  5CZX A;  3ETC A;  4G37 A;  2YWB A;  1AMU A;  4GXQ A;  2F4V C;  2UU9 C;  3FCC A;  2DYJ A;  4B3T C;  3RV2 A;  1IBM C;  4L7I A;  1WH9 A;  3TUF A;  5H9U A;  5T8S A;  2KZ0 A;  4R0M A;  4XX2 A;  4JI3 C;  1QM4 A;  1UWD A;  2Y4O A;  3TDE A;  1FUG A;  4LF5 C;  1NYE A;  3A9V A;  2E8E A;  3AF6 A;  4G36 A;  2Y27 A;  5KYV A;  2M5O A;  1XMO C;  2MCQ A;  2ONF A;  3FCE A;  4LF7 C;  2VSQ A;  4B3R C;  2D1T A;  3E7W A;  3TQI A;  4R1L A;  4JI4 C;  5A2Q D;  3GR1 A;  3O2E A;  4PUG A;  5T8T A;  4MTN A;  3A9U A;  5BUS A;  4DCS A;  4HPV A;  1GPM A;  1N32 C;  4L2Z A;  3VNS A;  5AE1 A;  1HH2 P;  2ZZM A;  3EQ6 A;  3C5E A;  2P2Q A;  1RG9 A;  2DPL A;  3UOW A;  4OYC A;  1MDF A;  4KHP C;  3T1Y C;  1V26 A;  5DV9 A;  3LAX A;  4EAT A;  4D4G A;  5FLX D;  1N2F A;  4DR7 C;  1XS3 A;  1FLO A;  1HNZ C;  5BSV A;  4JI8 C;  3K6R A;  3LNV A;  4L4Q A;  2CY1 A;  2UUB C;  1O92 A;  2Y4N A;  2D1Q A;  1T5D X;  2HJG A;  4DR2 C;  5A1G A;  1V25 A;  3DHV A;  3OTO C;  3A25 A;  1XMQ C;  3LUS A;  4DCT A;  3NYR A;  4B3M C;  2E5L C;  1ZB8 A;  3CQ3 A;  2D1S A;  1T5H X;  2E8F A;  2ASB A;  2QVX X;  1P4E A;  2JMP A;  2DHM A;  4PHT A;  4BC7 A;  2VQF C;  2OPL A;  3ETO A;  2P2F A;  1HR0 C;  1N33 C;  1P7L A;  2BH1 X;  5BR8 C;  1BA3 A;  3S82 A;  3R44 A; 
#chains in the Genus database with same CATH homology
 2KZ0 A;  3O2E A;  2DHM A;  2MMA B;  1NY8 A;  2KDN A;  4PUH A;  5LCI A;  2MCQ A;  3TR3 A;  2MM9 A;  4PUG A;  2NCL A;  1XS3 A;  1V60 A;  4PUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...