2MCQA

Nmr structure of a bola-like hypothetical protein rp812 from rickettsia prowazekii, seattle structural genomics center for infectious disease (ssgcid)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
MAISAEELEKILKKSFPSSVIKITDLVGDQDHYALEISDAQFNGLSLINQHKLVKNALSEILNKKLHSISIKTISIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein RP812
publication title NMR structure of a BolA-like hypothetical protein RP812 from Rickettsia prowazekii, Seattle structural genomics center for infectious disease (SSGCID)
rcsb
source organism Rickettsia prowazekii
molecule tags Unknown function
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01722 BolA BolA-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.90 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 BolA-like 2mcqA01
3O2EA 1V60A 2MCQA 3TR3A 1XS3A 2MM9A 2NCLA 4PUIA 4PUGA 2KZ0A 4PUHA 1NY8A 2MMAB 2DHMA 5LCIA 2KDNA
chains in the Genus database with same CATH superfamily
2P2BA 3R44A 2XR1A 2MM9A 4LFBC 3ETOA 4JI1C 4DCSA 4LF8C 2NCLA 1BA3A 3IEVA 4JI3C 4X64C 5BR8C 1LCIA 4R1MA 2KDNA 2UUBC 1XNRC 3PESA 3FCEA 4LF7C 3KXWA 1MXCA 4DR5C 3A26A 1V60A 4JM1A 1HNWC 3CW8X 1XMOC 4JI4C 1N36C 4XX2A 4JI2C 5T8SA 4L7IA 5GTDA 2KZ0A 4JYAC 2Y4OA 5BSWA 3T1YC 1MKYA 4DV6C 3UOWA 1YJ7A 5A1GA 4JI6C 4DCVA 5T8TA 4IZ6A 3C5EA 4X66C 1ML8A 2UXCC 3DLPX 2WD9A 1V26A 2D27A 4RM2A 3CJEA 5KEIA 1PG4A 4DCUA 5FLXD 2JMPA 3CQ1A 1AMUA 3OTOC 2BH1X 4KTTA 1HH2P 4DCTA 4DV2C 4D56A 2UXBC 5BSVA 3EERA 2CY1A 1T5HX 4DR6C 1GPMA 4K0BA 3L8CA 3I08A 1M6XC 4ISBA 2VQEC 5BSUA 2D1SA 3S82A 5K85A 5AE2A 2QW0X 1N34C 1V25A 2Y27A 1ZB9A 4X62C 4DR4C 3PROC 1HNXC 2KZFA 1N2FA 4WS9A 5CZXA 3EQ6A 1MDBA 2OBVA 3SO4A 2OPLA 5AE1A 4OYCA 5LMUC 4RVNA 3J80D 4RM3A 3LNOA 5ADZA 2QVXX 4LF6C 4PUHA 5CZVA 2F4VC 4TPSB 3N54B 1IB8A 2YWBA 1M6XA 3J81D 3B7WA 4DV1C 3LGXA 1JOSA 3O2EA 3FCCA 1FUGA 2WP0C 4GS5A 1O92A 5LCIA 4X65C 2UUAC 5LMNC 2UUCC 2M5OA 2ZM6C 4D57A 1NY8A 4DR2C 3T1HC 4JI7C 4DR3C 4OX9C 4IR7A 4U5YD 5K8FA 4AQYC 4LF5C 3A4IA 4K0KC 2OO4A 4BCAA 4JI0C 5DV9A 4DV3C 1PA4A 3DAYA 2ONFA 4GKJC 2VSQA 1N33C 5BUSA 3VNSA 3H2TA 4DV7C 4EATA 4B3TC 4PZPA 2JNVA 4RMNA 3PBKA 4RLQA 4FTFA 3JAMD 4BBYA 5BURA 3NPDA 1UKKA 3R9WA 4ZLPA 4KTVA 2DYJA 5KYVA 1QWIA 3E7XA 4PUIA 1RY2A 4PROC 4NXNC 3CQ3A 3NI2A 4G36A 2QL8A 1USPA 1ZB8A 2DPLA 4LF9C 4YY3C 4NOZA 4I9FA 5JRHA 2VZEA 1WF3A 4L4QA 2ZZMA 1EGAA 2OPLB 2DHMA 4G37A 4R0MA 3VNQA 1XMQC 2BJOA 1TH5A 2D1TA 4GKKC 1QM4A 2P2QA 4G1IA 1O9TA 3CQ2A 5IT9D 3K6RA 3RG2A 1FJGC 3A25A 3AY0A 3TUFA 2E5LC 3LNVA 4NXMC 3UEBA 1L2FA 4RVOA 1KKGA 1RG9A 3AF5A 4BC9A 1WH9A 3GPCA 1IBKC 3VNRA 4YHHC 1O90A 4RLFA 1P7LA 3E7WA 4R1LA 1UWDA 3LUSA 3UZ0A 1FLOA 5AE3A 2D1QA 3L95X 2QVZX 4DUYC 1MXAA 3CW9A 4D4GA 1P4EA 3UX2A 3GR1A 5IFIA 1HR0C 2ZZNA 3TR3A 4DV5C 1PU1A 4JI5C 4GXQA 3I07A 5BSMA 1T5DX 1K0RA 2D1RA 4HPVA 4DV0C 1PG3A 4MH4A 4OXIA 4JV5C 4DUZC 3LAXA 3NYRA 2P20A 3GR0A 2P02A 1IBLC 2E7GA 3IPLA 4GXRA 1XRAA 3G7SA 1LQLA 2E8FA 3N2QA 2P2JA 5A1IA 1NYEA 5KYTA 2YCBA 2MMAB 1ULTA 1USPB 2E0GA 1HNZC 1XS3A 4DG9A 4D4IA 3R9XA 2P2FA 4I9GA 5E7QA 4B3RC 2QVYX 3DHVA 4MTNA 2AYAA 1WCJA 2CXCA 2YX1A 4LFCC 1XNQC 4BSZA 3UX3A 1VEHA 2UU9C 2P2MA 2D28C 2Y4NA 4B3SC 2PROA 2YWCA 4FUQA 5IWAC 1N32C 3A9VA 4LE5A 4DR1C 2E8CA 3ETCA 1O93A 2PN2A 2VQFC 4FUTA 1J5EC 3A9UA 2MCQA 5BSRA 5H9UA 2D7VA 3TDEA 5BUQA 4DR7C 2E8EA 4PHTA 1P4EC 4LFAC 4KHPC 3IMLA 2HJGA 4BC7A 3GKUA 4JI8C 4DV4C 5BSTA 2UXDC 4ODJA 3RV2A 4DG8A 2Z51A 3TQIA 2CU6A 5A19A 2PT7G 3IEUA 4ZJZA 2HHHC 1I94C 1IBMC 1XRCA 4NDNA 1MDFA 2ASBA 3AF6A 1MD9A 4WV3A 1XRBA 5A2QD 2V7BA 4L2ZA 4LF4C 4PUGA 2ATWA 4B3MC 3NYQA 1VLAA 2M5HA 1MXBA 1XHJA 2EGTA
chains in the Genus database with same CATH topology
3O2EA 1V60A 2MCQA 3TR3A 1XS3A 2MM9A 2NCLA 4PUIA 4PUGA 2KZ0A 4PUHA 1NY8A 2MMAB 2DHMA 5LCIA 2KDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O2E A;  1V60 A;  2MCQ A;  3TR3 A;  1XS3 A;  2MM9 A;  2NCL A;  4PUI A;  4PUG A;  2KZ0 A;  4PUH A;  1NY8 A;  2MMA B;  2DHM A;  5LCI A;  2KDN A; 
#chains in the Genus database with same CATH topology
 2P2B A;  3R44 A;  2XR1 A;  2MM9 A;  4LFB C;  3ETO A;  4JI1 C;  4DCS A;  4LF8 C;  2NCL A;  1BA3 A;  3IEV A;  4JI3 C;  4X64 C;  5BR8 C;  1LCI A;  4R1M A;  2KDN A;  2UUB C;  1XNR C;  3PES A;  3FCE A;  4LF7 C;  3KXW A;  1MXC A;  4DR5 C;  3A26 A;  1V60 A;  4JM1 A;  1HNW C;  3CW8 X;  1XMO C;  4JI4 C;  1N36 C;  4XX2 A;  4JI2 C;  5T8S A;  4L7I A;  5GTD A;  2KZ0 A;  4JYA C;  2Y4O A;  5BSW A;  3T1Y C;  1MKY A;  4DV6 C;  3UOW A;  1YJ7 A;  5A1G A;  4JI6 C;  4DCV A;  5T8T A;  4IZ6 A;  3C5E A;  4X66 C;  1ML8 A;  2UXC C;  3DLP X;  2WD9 A;  1V26 A;  2D27 A;  4RM2 A;  3CJE A;  5KEI A;  1PG4 A;  4DCU A;  5FLX D;  2JMP A;  3CQ1 A;  1AMU A;  3OTO C;  2BH1 X;  4KTT A;  1HH2 P;  4DCT A;  4DV2 C;  4D56 A;  2UXB C;  5BSV A;  3EER A;  2CY1 A;  1T5H X;  4DR6 C;  1GPM A;  4K0B A;  3L8C A;  3I08 A;  1M6X C;  4ISB A;  2VQE C;  5BSU A;  2D1S A;  3S82 A;  5K85 A;  5AE2 A;  2QW0 X;  1N34 C;  1V25 A;  2Y27 A;  1ZB9 A;  4X62 C;  4DR4 C;  3PRO C;  1HNX C;  2KZF A;  1N2F A;  4WS9 A;  5CZX A;  3EQ6 A;  1MDB A;  2OBV A;  3SO4 A;  2OPL A;  5AE1 A;  4OYC A;  5LMU C;  4RVN A;  3J80 D;  4RM3 A;  3LNO A;  5ADZ A;  2QVX X;  4LF6 C;  4PUH A;  5CZV A;  2F4V C;  4TPS B;  3N54 B;  1IB8 A;  2YWB A;  1M6X A;  3J81 D;  3B7W A;  4DV1 C;  3LGX A;  1JOS A;  3O2E A;  3FCC A;  1FUG A;  2WP0 C;  4GS5 A;  1O92 A;  5LCI A;  4X65 C;  2UUA C;  5LMN C;  2UUC C;  2M5O A;  2ZM6 C;  4D57 A;  1NY8 A;  4DR2 C;  3T1H C;  4JI7 C;  4DR3 C;  4OX9 C;  4IR7 A;  4U5Y D;  5K8F A;  4AQY C;  4LF5 C;  3A4I A;  4K0K C;  2OO4 A;  4BCA A;  4JI0 C;  5DV9 A;  4DV3 C;  1PA4 A;  3DAY A;  2ONF A;  4GKJ C;  2VSQ A;  1N33 C;  5BUS A;  3VNS A;  3H2T A;  4DV7 C;  4EAT A;  4B3T C;  4PZP A;  2JNV A;  4RMN A;  3PBK A;  4RLQ A;  4FTF A;  3JAM D;  4BBY A;  5BUR A;  3NPD A;  1UKK A;  3R9W A;  4ZLP A;  4KTV A;  2DYJ A;  5KYV A;  1QWI A;  3E7X A;  4PUI A;  1RY2 A;  4PRO C;  4NXN C;  3CQ3 A;  3NI2 A;  4G36 A;  2QL8 A;  1USP A;  1ZB8 A;  2DPL A;  4LF9 C;  4YY3 C;  4NOZ A;  4I9F A;  5JRH A;  2VZE A;  1WF3 A;  4L4Q A;  2ZZM A;  1EGA A;  2OPL B;  2DHM A;  4G37 A;  4R0M A;  3VNQ A;  1XMQ C;  2BJO A;  1TH5 A;  2D1T A;  4GKK C;  1QM4 A;  2P2Q A;  4G1I A;  1O9T A;  3CQ2 A;  5IT9 D;  3K6R A;  3RG2 A;  1FJG C;  3A25 A;  3AY0 A;  3TUF A;  2E5L C;  3LNV A;  4NXM C;  3UEB A;  1L2F A;  4RVO A;  1KKG A;  1RG9 A;  3AF5 A;  4BC9 A;  1WH9 A;  3GPC A;  1IBK C;  3VNR A;  4YHH C;  1O90 A;  4RLF A;  1P7L A;  3E7W A;  4R1L A;  1UWD A;  3LUS A;  3UZ0 A;  1FLO A;  5AE3 A;  2D1Q A;  3L95 X;  2QVZ X;  4DUY C;  1MXA A;  3CW9 A;  4D4G A;  1P4E A;  3UX2 A;  3GR1 A;  5IFI A;  1HR0 C;  2ZZN A;  3TR3 A;  4DV5 C;  1PU1 A;  4JI5 C;  4GXQ A;  3I07 A;  5BSM A;  1T5D X;  1K0R A;  2D1R A;  4HPV A;  4DV0 C;  1PG3 A;  4MH4 A;  4OXI A;  4JV5 C;  4DUZ C;  3LAX A;  3NYR A;  2P20 A;  3GR0 A;  2P02 A;  1IBL C;  2E7G A;  3IPL A;  4GXR A;  1XRA A;  3G7S A;  1LQL A;  2E8F A;  3N2Q A;  2P2J A;  5A1I A;  1NYE A;  5KYT A;  2YCB A;  2MMA B;  1ULT A;  1USP B;  2E0G A;  1HNZ C;  1XS3 A;  4DG9 A;  4D4I A;  3R9X A;  2P2F A;  4I9G A;  5E7Q A;  4B3R C;  2QVY X;  3DHV A;  4MTN A;  2AYA A;  1WCJ A;  2CXC A;  2YX1 A;  4LFC C;  1XNQ C;  4BSZ A;  3UX3 A;  1VEH A;  2UU9 C;  2P2M A;  2D28 C;  2Y4N A;  4B3S C;  2PRO A;  2YWC A;  4FUQ A;  5IWA C;  1N32 C;  3A9V A;  4LE5 A;  4DR1 C;  2E8C A;  3ETC A;  1O93 A;  2PN2 A;  2VQF C;  4FUT A;  1J5E C;  3A9U A;  2MCQ A;  5BSR A;  5H9U A;  2D7V A;  3TDE A;  5BUQ A;  4DR7 C;  2E8E A;  4PHT A;  1P4E C;  4LFA C;  4KHP C;  3IML A;  2HJG A;  4BC7 A;  3GKU A;  4JI8 C;  4DV4 C;  5BST A;  2UXD C;  4ODJ A;  3RV2 A;  4DG8 A;  2Z51 A;  3TQI A;  2CU6 A;  5A19 A;  2PT7 G;  3IEU A;  4ZJZ A;  2HHH C;  1I94 C;  1IBM C;  1XRC A;  4NDN A;  1MDF A;  2ASB A;  3AF6 A;  1MD9 A;  4WV3 A;  1XRB A;  5A2Q D;  2V7B A;  4L2Z A;  4LF4 C;  4PUG A;  2ATW A;  4B3M C;  3NYQ A;  1VLA A;  2M5H A;  1MXB A;  1XHJ A;  2EGT A; 
#chains in the Genus database with same CATH homology
 3O2E A;  1V60 A;  2MCQ A;  3TR3 A;  1XS3 A;  2MM9 A;  2NCL A;  4PUI A;  4PUG A;  2KZ0 A;  4PUH A;  1NY8 A;  2MMA B;  2DHM A;  5LCI A;  2KDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...