3LAXA

The crystal structure of a domain of phenylacetate-coenzyme a ligase from bacteroides vulgatus atcc 8482
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
106
Chain Sequence
SNADDMIILKGVNIFPIQIETILLQFKELGSDYLITLETAESNDEMTVEVELSQLFTDDYGRLQALTREITRQLKDEILVTPRVKLVPKGALPKSAVRVKDLRKTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a domain of phenylacetate-coenzyme A ligase from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus
molecule tags Ligase
molecule keywords Phenylacetate-coenzyme A ligase
total genus 28
structure length 106
sequence length 109
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3laxA00
2P20A 3VNSA 1BA3A 3G7SA 2QVZX 4WV3A 5DV9A 4GXRA 4D57A 5BSVA 4RM2A 3IPLA 3EQ6A 4U5YD 4RLQA 4D56A 4DG9A 3B7WA 5KEIA 2D1SA 1MDBA 1PG4A 4D4IA 1LCIA 2Y4OA 2VSQA 3FCCA 3C5EA 1ULTA 2D1QA 2P2MA 4IR7A 5K85A 4D4GA 4R0MA 3LNVA 2Y27A 3CW8X 3LGXA 4DG8A 3NI2A 3VNQA 3RG2A 4OYCA 3DLPX 4R1LA 4ZJZA 1PG3A 3DHVA 2P2BA 2P2JA 4RVNA 3PBKA 3E7WA 5BURA 4RM3A 2VZEA 5KYVA 5BSWA 5BUSA 5BSMA 2P2QA 3DAYA 3KXWA 2QW0X 3NYRA 3GPCA 1MDFA 3ETCA 4PZPA 4FUTA 1MD9A 4G37A 1T5HX 4IZ6A 5KYTA 1T5DX 1RY2A 3VNRA 2QVXX 4GXQA 2QVYX 4EATA 2V7BA 3NYQA 5BSTA 4GS5A 5JRHA 4FUQA 2Y4NA 5E7QA 4RMNA 3A9UA 4RLFA 2D1TA 3R44A 5GTDA 5BSUA 5BSRA 4R1MA 4G36A 2WD9A 5BUQA 1YJ7A 3CW9A 3A9VA 3L8CA 5K8FA 4ISBA 3E7XA 3LAXA 2P2FA 1AMUA 5IFIA 3FCEA 4OXIA 2D1RA 4RVOA
chains in the Genus database with same CATH superfamily
2DHMA 5H9UA 4DUYC 1J5EC 2MMAB 3A25A 2BH1X 5FLXD 2E5LC 5BSVA 3IPLA 4DCTA 3CQ2A 1UWDA 1LQLA 4JI1C 4DG9A 2ASBA 4LFAC 2D1SA 1HR0C 1O93A 4D4IA 4I9FA 1LCIA 1USPA 5LMNC 3C5EA 1ULTA 2ZZMA 2D1QA 3UOWA 4AQYC 4D4GA 2KZ0A 3LNVA 2Y27A 3LUSA 3CW8X 3LGXA 4YHHC 4DV2C 3AF6A 2UU9C 2KDNA 4B3RC 1MXBA 3PESA 1NYEA 4GKKC 2OO4A 5BR8C 1MKYA 1PG3A 2P2BA 4JV5C 3T1HC 2QL8A 2F4VC 4LF6C 1IB8A 2DYJA 4RVNA 3EERA 3CJEA 3RV2A 5KYVA 2EGTA 1HNXC 5BUSA 5BSMA 1VLAA 1N2FA 1O90A 4TPSB 1MD9A 5CZVA 4IZ6A 1T5DX 5LCIA 4BC9A 1XNQC 2V7BA 2XR1A 2DPLA 4ZLPA 5JRHA 4FUQA 3A9UA 2D1TA 2NCLA 4G36A 1L2FA 3GR1A 3LAXA 2YCBA 3R9XA 4JI3C 2UXCC 2M5HA 3N2QA 2P20A 1HNWC 4BBYA 1M6XC 4PUHA 2YWBA 4JYAC 3JAMD 3EQ6A 3UEBA 4MTNA 3J81D 2UUCC 1GPMA 2ATWA 3T1YC 1MDBA 1USPB 2ZZNA 1P7LA 1V60A 3FCCA 2PROA 4ODJA 5K85A 1XRCA 3NI2A 3VNQA 2OPLA 4G1IA 4NXNC 4DV0C 2ZM6C 4JM1A 4JI4C 1XRBA 3E7WA 2HHHC 4RM3A 1JOSA 1IBMC 2VZEA 3J80D 4X66C 2YX1A 5BSWA 3DAYA 2D28C 1M6XA 4DR2C 4DV5C 1MDFA 4DUZC 4HPVA 5CZXA 4FUTA 5T8TA 4B3MC 1FLOA 4DV6C 2MM9A 1EGAA 1RY2A 1FJGC 3VNRA 2E8CA 4GXQA 3L95X 3NYQA 5BSTA 3NPDA 4DV7C 2Y4NA 4RMNA 4RLFA 1O9TA 1MXCA 3IMLA 4DCUA 4X62C 5GTDA 4R1MA 4OX9C 3LNOA 2WD9A 1IBLC 4DR5C 3L8CA 4X65C 1V25A 4ISBA 4PHTA 4LF9C 3IEUA 5IFIA 4OXIA 4DR7C 4NXMC 1WCJA 3VNSA 4LF4C 1BA3A 2PN2A 1ZB9A 5DV9A 3OTOC 2E7GA 4D57A 3AY0A 1PA4A 3GR0A 4DCVA 4BCAA 4LE5A 3R9WA 4D56A 1QWIA 4K0KC 3B7WA 5KEIA 3A4IA 3AF5A 2VQEC 2D27A 2VSQA 4DR4C 2P2MA 4IR7A 4DV4C 4BC7A 4LF5C 3ETOA 4R0MA 5LMUC 4DG8A 1IBKC 3K6RA 1VEHA 3PROC 1HNZC 3RG2A 3I08A 1WH9A 4DV1C 4YY3C 3DLPX 5A1IA 2UXBC 2OBVA 4MH4A 4JI0C 1N32C 3PBKA 4PROC 4KTTA 5BURA 1XHJA 1XRAA 1N33C 2P2QA 1K0RA 3KXWA 1O92A 2QW0X 3NYRA 1XS3A 5AE1A 1UKKA 3ETCA 4JI8C 4G37A 5KYTA 2ONFA 3TDEA 2WP0C 1N36C 5ADZA 2QVXX 2CXCA 4DV3C 2M5OA 4EATA 5A1GA 4LFBC 1QM4A 4DR1C 4KTVA 5A19A 3SO4A 3GKUA 4GS5A 5E7QA 2KZFA 5IT9D 4DR6C 2YWCA 5BSUA 2Z51A 5BSRA 3UX3A 1I94C 2PT7G 4LF7C 4BSZA 2D7VA 2P2FA 1AMUA 2P02A 4JI6C 1P4EA 5A2QD 1XNRC 3A26A 5IWAC 1HH2P 3G7SA 4XX2A 2HJGA 2QVZX 4WV3A 4GXRA 2CU6A 1KKGA 4RM2A 2MCQA 4JI2C 4PUIA 4X64C 4U5YD 4RLQA 5T8SA 1FUGA 1PG4A 4I9GA 2Y4OA 1N34C 3CQ1A 1V26A 3UZ0A 1XMOC 1XMQC 4DR3C 4NDNA 4LF8C 3TUFA 1ZB8A 1P4EC 4JI5C 4OYCA 5AE3A 3TR3A 4R1LA 1PU1A 4ZJZA 3DHVA 4DCSA 4GKJC 2P2JA 4L2ZA 4NOZA 2E0GA 2CY1A 4WS9A 3N54B 2E8EA 2BJOA 1ML8A 5AE2A 3GPCA 4L4QA 3TQIA 2JMPA 4PZPA 3H2TA 4L7IA 1T5HX 2D1RA 4K0BA 3I07A 3IEVA 2QVYX 2JNVA 2UUBC 4B3SC 3S82A 1WF3A 4B3TC 4JI7C 3R44A 3UX2A 1MXAA 1NY8A 5BUQA 1YJ7A 2AYAA 3CW9A 4KHPC 4FTFA 3A9VA 3O2EA 5K8FA 2VQFC 2UUAC 3E7XA 2UXDC 1TH5A 4PUGA 2OPLB 4LFCC 3FCEA 1RG9A 2E8FA 3CQ3A 4RVOA
chains in the Genus database with same CATH topology
5H9UA 4DUYC 1J5EC 2BH1X 5FLXD 2E5LC 5BSVA 3IPLA 4DCTA 1LQLA 4JI1C 4DG9A 2ASBA 4LFAC 1HR0C 2D1SA 1O93A 4D4IA 4I9FA 1LCIA 1USPA 5LMNC 3C5EA 1ULTA 2D1QA 3UOWA 4AQYC 4D4GA 3LNVA 2Y27A 3LUSA 3CW8X 3LGXA 4YHHC 4DV2C 3AF6A 2UU9C 4B3RC 1MXBA 3PESA 1NYEA 4GKKC 2OO4A 5BR8C 1MKYA 1PG3A 2P2BA 4JV5C 3T1HC 2QL8A 2F4VC 4LF6C 2DYJA 4RVNA 3EERA 3CJEA 3RV2A 5KYVA 2EGTA 1HNXC 5BUSA 5BSMA 1VLAA 1N2FA 1O90A 4TPSB 1MD9A 5CZVA 4IZ6A 1T5DX 4BC9A 1XNQC 2V7BA 2XR1A 2DPLA 4ZLPA 5JRHA 4FUQA 3A9UA 2D1TA 4G36A 1L2FA 3GR1A 3LAXA 2YCBA 3R9XA 4JI3C 2UXCC 3N2QA 2P20A 1HNWC 4BBYA 2YWBA 4JYAC 3JAMD 3EQ6A 4MTNA 3J81D 2UUCC 1GPMA 2ATWA 3T1YC 1MDBA 1USPB 1P7LA 3FCCA 2PROA 4ODJA 5K85A 1XRCA 3NI2A 3VNQA 2OPLA 4G1IA 4NXNC 4DV0C 2ZM6C 4JM1A 4JI4C 1XRBA 3E7WA 2HHHC 4RM3A 1JOSA 1IBMC 2VZEA 3J80D 4X66C 5BSWA 3DAYA 2D28C 4DR2C 4DV5C 1MDFA 4DUZC 4HPVA 5CZXA 4FUTA 5T8TA 4B3MC 4DV6C 1EGAA 1RY2A 1FJGC 3VNRA 2E8CA 4GXQA 3L95X 3NYQA 5BSTA 3NPDA 4DV7C 2Y4NA 4RMNA 4RLFA 1O9TA 1MXCA 3IMLA 4DCUA 4X62C 5GTDA 4R1MA 4OX9C 2WD9A 1IBLC 4DR5C 3L8CA 1V25A 4X65C 4ISBA 4PHTA 4LF9C 3IEUA 5IFIA 4OXIA 4DR7C 4NXMC 3VNSA 4LF4C 1BA3A 2PN2A 1ZB9A 5DV9A 3OTOC 2E7GA 4D57A 1PA4A 3GR0A 4DCVA 4BCAA 4LE5A 3R9WA 4D56A 1QWIA 4K0KC 3B7WA 5KEIA 3A4IA 3AF5A 2VQEC 2D27A 2VSQA 4DR4C 2P2MA 4IR7A 4DV4C 4BC7A 4LF5C 3ETOA 4R0MA 5LMUC 4DG8A 1IBKC 3PROC 1HNZC 3RG2A 3I08A 1WH9A 4DV1C 4YY3C 3DLPX 5A1IA 2UXBC 2OBVA 4MH4A 4JI0C 1N32C 3PBKA 4PROC 4KTTA 5BURA 1XRAA 1N33C 2P2QA 1K0RA 3KXWA 1O92A 2QW0X 3NYRA 5AE1A 1UKKA 3ETCA 4JI8C 4G37A 5KYTA 2ONFA 3TDEA 2WP0C 1N36C 5ADZA 2QVXX 2CXCA 4DV3C 4EATA 5A1GA 4LFBC 1QM4A 4DR1C 4KTVA 5A19A 3SO4A 3GKUA 4GS5A 5E7QA 2KZFA 5IT9D 4DR6C 2YWCA 5BSUA 5BSRA 1I94C 2PT7G 4LF7C 4BSZA 2D7VA 2P2FA 1AMUA 2P02A 4JI6C 5A2QD 1XNRC 5IWAC 1HH2P 3G7SA 4XX2A 2HJGA 2QVZX 4WV3A 4GXRA 1KKGA 4RM2A 4JI2C 4X64C 4U5YD 4RLQA 5T8SA 1FUGA 1PG4A 4I9GA 2Y4OA 1N34C 1V26A 3UZ0A 1XMOC 1XMQC 4DR3C 4NDNA 4LF8C 3TUFA 1ZB8A 4JI5C 4OYCA 5AE3A 4R1LA 4ZJZA 3DHVA 4DCSA 4GKJC 2P2JA 4L2ZA 4NOZA 2E0GA 2CY1A 4WS9A 3N54B 2E8EA 2BJOA 1ML8A 5AE2A 3GPCA 4L4QA 3TQIA 2JMPA 4PZPA 3H2TA 4L7IA 1T5HX 4K0BA 3I07A 3IEVA 2QVYX 2UUBC 4B3SC 3S82A 1WF3A 4B3TC 4JI7C 3R44A 1MXAA 5BUQA 1YJ7A 2AYAA 3CW9A 4KHPC 4FTFA 3A9VA 5K8FA 2VQFC 2UUAC 3E7XA 2UXDC 2OPLB 4LFCC 3FCEA 1RG9A 2E8FA 2D1RA 4RVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P20 A;  3VNS A;  1BA3 A;  3G7S A;  2QVZ X;  4WV3 A;  5DV9 A;  4GXR A;  4D57 A;  5BSV A;  4RM2 A;  3IPL A;  3EQ6 A;  4U5Y D;  4RLQ A;  4D56 A;  4DG9 A;  3B7W A;  5KEI A;  2D1S A;  1MDB A;  1PG4 A;  4D4I A;  1LCI A;  2Y4O A;  2VSQ A;  3FCC A;  3C5E A;  1ULT A;  2D1Q A;  2P2M A;  4IR7 A;  5K85 A;  4D4G A;  4R0M A;  3LNV A;  2Y27 A;  3CW8 X;  3LGX A;  4DG8 A;  3NI2 A;  3VNQ A;  3RG2 A;  4OYC A;  3DLP X;  4R1L A;  4ZJZ A;  1PG3 A;  3DHV A;  2P2B A;  2P2J A;  4RVN A;  3PBK A;  3E7W A;  5BUR A;  4RM3 A;  2VZE A;  5KYV A;  5BSW A;  5BUS A;  5BSM A;  2P2Q A;  3DAY A;  3KXW A;  2QW0 X;  3NYR A;  3GPC A;  1MDF A;  3ETC A;  4PZP A;  4FUT A;  1MD9 A;  4G37 A;  1T5H X;  4IZ6 A;  5KYT A;  1T5D X;  1RY2 A;  3VNR A;  2QVX X;  4GXQ A;  2QVY X;  4EAT A;  2V7B A;  3NYQ A;  5BST A;  4GS5 A;  5JRH A;  4FUQ A;  2Y4N A;  5E7Q A;  4RMN A;  3A9U A;  4RLF A;  2D1T A;  3R44 A;  5GTD A;  5BSU A;  5BSR A;  4R1M A;  4G36 A;  2WD9 A;  5BUQ A;  1YJ7 A;  3CW9 A;  3A9V A;  3L8C A;  5K8F A;  4ISB A;  3E7X A;  3LAX A;  2P2F A;  1AMU A;  5IFI A;  3FCE A;  4OXI A;  2D1R A;  4RVO A; 
#chains in the Genus database with same CATH topology
 2DHM A;  5H9U A;  4DUY C;  1J5E C;  2MMA B;  3A25 A;  2BH1 X;  5FLX D;  2E5L C;  5BSV A;  3IPL A;  4DCT A;  3CQ2 A;  1UWD A;  1LQL A;  4JI1 C;  4DG9 A;  2ASB A;  4LFA C;  2D1S A;  1HR0 C;  1O93 A;  4D4I A;  4I9F A;  1LCI A;  1USP A;  5LMN C;  3C5E A;  1ULT A;  2ZZM A;  2D1Q A;  3UOW A;  4AQY C;  4D4G A;  2KZ0 A;  3LNV A;  2Y27 A;  3LUS A;  3CW8 X;  3LGX A;  4YHH C;  4DV2 C;  3AF6 A;  2UU9 C;  2KDN A;  4B3R C;  1MXB A;  3PES A;  1NYE A;  4GKK C;  2OO4 A;  5BR8 C;  1MKY A;  1PG3 A;  2P2B A;  4JV5 C;  3T1H C;  2QL8 A;  2F4V C;  4LF6 C;  1IB8 A;  2DYJ A;  4RVN A;  3EER A;  3CJE A;  3RV2 A;  5KYV A;  2EGT A;  1HNX C;  5BUS A;  5BSM A;  1VLA A;  1N2F A;  1O90 A;  4TPS B;  1MD9 A;  5CZV A;  4IZ6 A;  1T5D X;  5LCI A;  4BC9 A;  1XNQ C;  2V7B A;  2XR1 A;  2DPL A;  4ZLP A;  5JRH A;  4FUQ A;  3A9U A;  2D1T A;  2NCL A;  4G36 A;  1L2F A;  3GR1 A;  3LAX A;  2YCB A;  3R9X A;  4JI3 C;  2UXC C;  2M5H A;  3N2Q A;  2P20 A;  1HNW C;  4BBY A;  1M6X C;  4PUH A;  2YWB A;  4JYA C;  3JAM D;  3EQ6 A;  3UEB A;  4MTN A;  3J81 D;  2UUC C;  1GPM A;  2ATW A;  3T1Y C;  1MDB A;  1USP B;  2ZZN A;  1P7L A;  1V60 A;  3FCC A;  2PRO A;  4ODJ A;  5K85 A;  1XRC A;  3NI2 A;  3VNQ A;  2OPL A;  4G1I A;  4NXN C;  4DV0 C;  2ZM6 C;  4JM1 A;  4JI4 C;  1XRB A;  3E7W A;  2HHH C;  4RM3 A;  1JOS A;  1IBM C;  2VZE A;  3J80 D;  4X66 C;  2YX1 A;  5BSW A;  3DAY A;  2D28 C;  1M6X A;  4DR2 C;  4DV5 C;  1MDF A;  4DUZ C;  4HPV A;  5CZX A;  4FUT A;  5T8T A;  4B3M C;  1FLO A;  4DV6 C;  2MM9 A;  1EGA A;  1RY2 A;  1FJG C;  3VNR A;  2E8C A;  4GXQ A;  3L95 X;  3NYQ A;  5BST A;  3NPD A;  4DV7 C;  2Y4N A;  4RMN A;  4RLF A;  1O9T A;  1MXC A;  3IML A;  4DCU A;  4X62 C;  5GTD A;  4R1M A;  4OX9 C;  3LNO A;  2WD9 A;  1IBL C;  4DR5 C;  3L8C A;  4X65 C;  1V25 A;  4ISB A;  4PHT A;  4LF9 C;  3IEU A;  5IFI A;  4OXI A;  4DR7 C;  4NXM C;  1WCJ A;  3VNS A;  4LF4 C;  1BA3 A;  2PN2 A;  1ZB9 A;  5DV9 A;  3OTO C;  2E7G A;  4D57 A;  3AY0 A;  1PA4 A;  3GR0 A;  4DCV A;  4BCA A;  4LE5 A;  3R9W A;  4D56 A;  1QWI A;  4K0K C;  3B7W A;  5KEI A;  3A4I A;  3AF5 A;  2VQE C;  2D27 A;  2VSQ A;  4DR4 C;  2P2M A;  4IR7 A;  4DV4 C;  4BC7 A;  4LF5 C;  3ETO A;  4R0M A;  5LMU C;  4DG8 A;  1IBK C;  3K6R A;  1VEH A;  3PRO C;  1HNZ C;  3RG2 A;  3I08 A;  1WH9 A;  4DV1 C;  4YY3 C;  3DLP X;  5A1I A;  2UXB C;  2OBV A;  4MH4 A;  4JI0 C;  1N32 C;  3PBK A;  4PRO C;  4KTT A;  5BUR A;  1XHJ A;  1XRA A;  1N33 C;  2P2Q A;  1K0R A;  3KXW A;  1O92 A;  2QW0 X;  3NYR A;  1XS3 A;  5AE1 A;  1UKK A;  3ETC A;  4JI8 C;  4G37 A;  5KYT A;  2ONF A;  3TDE A;  2WP0 C;  1N36 C;  5ADZ A;  2QVX X;  2CXC A;  4DV3 C;  2M5O A;  4EAT A;  5A1G A;  4LFB C;  1QM4 A;  4DR1 C;  4KTV A;  5A19 A;  3SO4 A;  3GKU A;  4GS5 A;  5E7Q A;  2KZF A;  5IT9 D;  4DR6 C;  2YWC A;  5BSU A;  2Z51 A;  5BSR A;  3UX3 A;  1I94 C;  2PT7 G;  4LF7 C;  4BSZ A;  2D7V A;  2P2F A;  1AMU A;  2P02 A;  4JI6 C;  1P4E A;  5A2Q D;  1XNR C;  3A26 A;  5IWA C;  1HH2 P;  3G7S A;  4XX2 A;  2HJG A;  2QVZ X;  4WV3 A;  4GXR A;  2CU6 A;  1KKG A;  4RM2 A;  2MCQ A;  4JI2 C;  4PUI A;  4X64 C;  4U5Y D;  4RLQ A;  5T8S A;  1FUG A;  1PG4 A;  4I9G A;  2Y4O A;  1N34 C;  3CQ1 A;  1V26 A;  3UZ0 A;  1XMO C;  1XMQ C;  4DR3 C;  4NDN A;  4LF8 C;  3TUF A;  1ZB8 A;  1P4E C;  4JI5 C;  4OYC A;  5AE3 A;  3TR3 A;  4R1L A;  1PU1 A;  4ZJZ A;  3DHV A;  4DCS A;  4GKJ C;  2P2J A;  4L2Z A;  4NOZ A;  2E0G A;  2CY1 A;  4WS9 A;  3N54 B;  2E8E A;  2BJO A;  1ML8 A;  5AE2 A;  3GPC A;  4L4Q A;  3TQI A;  2JMP A;  4PZP A;  3H2T A;  4L7I A;  1T5H X;  2D1R A;  4K0B A;  3I07 A;  3IEV A;  2QVY X;  2JNV A;  2UUB C;  4B3S C;  3S82 A;  1WF3 A;  4B3T C;  4JI7 C;  3R44 A;  3UX2 A;  1MXA A;  1NY8 A;  5BUQ A;  1YJ7 A;  2AYA A;  3CW9 A;  4KHP C;  4FTF A;  3A9V A;  3O2E A;  5K8F A;  2VQF C;  2UUA C;  3E7X A;  2UXD C;  1TH5 A;  4PUG A;  2OPL B;  4LFC C;  3FCE A;  1RG9 A;  2E8F A;  3CQ3 A;  4RVO A; 
#chains in the Genus database with same CATH homology
 5H9U A;  4DUY C;  1J5E C;  2BH1 X;  5FLX D;  2E5L C;  5BSV A;  3IPL A;  4DCT A;  1LQL A;  4JI1 C;  4DG9 A;  2ASB A;  4LFA C;  1HR0 C;  2D1S A;  1O93 A;  4D4I A;  4I9F A;  1LCI A;  1USP A;  5LMN C;  3C5E A;  1ULT A;  2D1Q A;  3UOW A;  4AQY C;  4D4G A;  3LNV A;  2Y27 A;  3LUS A;  3CW8 X;  3LGX A;  4YHH C;  4DV2 C;  3AF6 A;  2UU9 C;  4B3R C;  1MXB A;  3PES A;  1NYE A;  4GKK C;  2OO4 A;  5BR8 C;  1MKY A;  1PG3 A;  2P2B A;  4JV5 C;  3T1H C;  2QL8 A;  2F4V C;  4LF6 C;  2DYJ A;  4RVN A;  3EER A;  3CJE A;  3RV2 A;  5KYV A;  2EGT A;  1HNX C;  5BUS A;  5BSM A;  1VLA A;  1N2F A;  1O90 A;  4TPS B;  1MD9 A;  5CZV A;  4IZ6 A;  1T5D X;  4BC9 A;  1XNQ C;  2V7B A;  2XR1 A;  2DPL A;  4ZLP A;  5JRH A;  4FUQ A;  3A9U A;  2D1T A;  4G36 A;  1L2F A;  3GR1 A;  3LAX A;  2YCB A;  3R9X A;  4JI3 C;  2UXC C;  3N2Q A;  2P20 A;  1HNW C;  4BBY A;  2YWB A;  4JYA C;  3JAM D;  3EQ6 A;  4MTN A;  3J81 D;  2UUC C;  1GPM A;  2ATW A;  3T1Y C;  1MDB A;  1USP B;  1P7L A;  3FCC A;  2PRO A;  4ODJ A;  5K85 A;  1XRC A;  3NI2 A;  3VNQ A;  2OPL A;  4G1I A;  4NXN C;  4DV0 C;  2ZM6 C;  4JM1 A;  4JI4 C;  1XRB A;  3E7W A;  2HHH C;  4RM3 A;  1JOS A;  1IBM C;  2VZE A;  3J80 D;  4X66 C;  5BSW A;  3DAY A;  2D28 C;  4DR2 C;  4DV5 C;  1MDF A;  4DUZ C;  4HPV A;  5CZX A;  4FUT A;  5T8T A;  4B3M C;  4DV6 C;  1EGA A;  1RY2 A;  1FJG C;  3VNR A;  2E8C A;  4GXQ A;  3L95 X;  3NYQ A;  5BST A;  3NPD A;  4DV7 C;  2Y4N A;  4RMN A;  4RLF A;  1O9T A;  1MXC A;  3IML A;  4DCU A;  4X62 C;  5GTD A;  4R1M A;  4OX9 C;  2WD9 A;  1IBL C;  4DR5 C;  3L8C A;  1V25 A;  4X65 C;  4ISB A;  4PHT A;  4LF9 C;  3IEU A;  5IFI A;  4OXI A;  4DR7 C;  4NXM C;  3VNS A;  4LF4 C;  1BA3 A;  2PN2 A;  1ZB9 A;  5DV9 A;  3OTO C;  2E7G A;  4D57 A;  1PA4 A;  3GR0 A;  4DCV A;  4BCA A;  4LE5 A;  3R9W A;  4D56 A;  1QWI A;  4K0K C;  3B7W A;  5KEI A;  3A4I A;  3AF5 A;  2VQE C;  2D27 A;  2VSQ A;  4DR4 C;  2P2M A;  4IR7 A;  4DV4 C;  4BC7 A;  4LF5 C;  3ETO A;  4R0M A;  5LMU C;  4DG8 A;  1IBK C;  3PRO C;  1HNZ C;  3RG2 A;  3I08 A;  1WH9 A;  4DV1 C;  4YY3 C;  3DLP X;  5A1I A;  2UXB C;  2OBV A;  4MH4 A;  4JI0 C;  1N32 C;  3PBK A;  4PRO C;  4KTT A;  5BUR A;  1XRA A;  1N33 C;  2P2Q A;  1K0R A;  3KXW A;  1O92 A;  2QW0 X;  3NYR A;  5AE1 A;  1UKK A;  3ETC A;  4JI8 C;  4G37 A;  5KYT A;  2ONF A;  3TDE A;  2WP0 C;  1N36 C;  5ADZ A;  2QVX X;  2CXC A;  4DV3 C;  4EAT A;  5A1G A;  4LFB C;  1QM4 A;  4DR1 C;  4KTV A;  5A19 A;  3SO4 A;  3GKU A;  4GS5 A;  5E7Q A;  2KZF A;  5IT9 D;  4DR6 C;  2YWC A;  5BSU A;  5BSR A;  1I94 C;  2PT7 G;  4LF7 C;  4BSZ A;  2D7V A;  2P2F A;  1AMU A;  2P02 A;  4JI6 C;  5A2Q D;  1XNR C;  5IWA C;  1HH2 P;  3G7S A;  4XX2 A;  2HJG A;  2QVZ X;  4WV3 A;  4GXR A;  1KKG A;  4RM2 A;  4JI2 C;  4X64 C;  4U5Y D;  4RLQ A;  5T8S A;  1FUG A;  1PG4 A;  4I9G A;  2Y4O A;  1N34 C;  1V26 A;  3UZ0 A;  1XMO C;  1XMQ C;  4DR3 C;  4NDN A;  4LF8 C;  3TUF A;  1ZB8 A;  4JI5 C;  4OYC A;  5AE3 A;  4R1L A;  4ZJZ A;  3DHV A;  4DCS A;  4GKJ C;  2P2J A;  4L2Z A;  4NOZ A;  2E0G A;  2CY1 A;  4WS9 A;  3N54 B;  2E8E A;  2BJO A;  1ML8 A;  5AE2 A;  3GPC A;  4L4Q A;  3TQI A;  2JMP A;  4PZP A;  3H2T A;  4L7I A;  1T5H X;  4K0B A;  3I07 A;  3IEV A;  2QVY X;  2UUB C;  4B3S C;  3S82 A;  1WF3 A;  4B3T C;  4JI7 C;  3R44 A;  1MXA A;  5BUQ A;  1YJ7 A;  2AYA A;  3CW9 A;  4KHP C;  4FTF A;  3A9V A;  5K8F A;  2VQF C;  2UUA C;  3E7X A;  2UXD C;  2OPL B;  4LFC C;  3FCE A;  1RG9 A;  2E8F A;  2D1R A;  4RVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...