3LAXA

The crystal structure of a domain of phenylacetate-coenzyme a ligase from bacteroides vulgatus atcc 8482
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
106
Chain Sequence
SNADDMIILKGVNIFPIQIETILLQFKELGSDYLITLETAESNDEMTVEVELSQLFTDDYGRLQALTREITRQLKDEILVTPRVKLVPKGALPKSAVRVKDLRKTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of a domain of phenylacetate-coenzyme A ligase from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus
molecule tags Ligase
molecule keywords Phenylacetate-coenzyme A ligase
total genus 28
structure length 106
sequence length 109
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3laxA00
5BUSA 4R0MA 5DV9A 3DHVA 4EATA 2QVZX 1PG3A 2QVXX 2P2QA 2V7BA 2QW0X 3ETCA 3LGXA 4D4GA 4RLQA 3FCEA 1ULTA 1LCIA 2P2JA 5BSRA 4FUQA 3LNVA 5BSTA 4OXIA 3KXWA 4GXRA 4WV3A 4RVNA 4IZ6A 2P2BA 3FCCA 3GPCA 3DAYA 5E7QA 1AMUA 1T5DX 2D1RA 5BSWA 4OYCA 4DG9A 5BSMA 3E7XA 4RVOA 4FUTA 4RM2A 5IFIA 3C5EA 2VZEA 4GS5A 4DG8A 5BURA 3RG2A 1MDFA 4D57A 4D4IA 3B7WA 1YJ7A 4R1MA 2P20A 3VNQA 2Y4NA 2P2MA 3NYRA 4G37A 4PZPA 5BUQA 2D1SA 4RM3A 3L8CA 1T5HX 1RY2A 4ZJZA 5BSUA 4U5YD 3CW8X 3A9UA 3PBKA 3NYQA 4IR7A 2D1QA 3A9VA 3G7SA 1PG4A 3DLPX 4R1LA 4RLFA 2Y27A 5KYTA 2QVYX 3VNSA 4D56A 4RMNA 3E7WA 4GXQA 4G36A 2P2FA 2VSQA 5GTDA 2Y4OA 1BA3A 5K85A 1MDBA 3R44A 2WD9A 5KYVA 5KEIA 3CW9A 3IPLA 5K8FA 3NI2A 1MD9A 2D1TA 5BSVA 5JRHA 4ISBA 3VNRA 3EQ6A 3LAXA
chains in the Genus database with same CATH superfamily
2BJOA 1QWIA 4HPVA 3TQIA 4LE5A 4D4GA 4DCVA 4B3TC 4GKKC 2P2JA 2ATWA 5BSRA 5CZVA 2NCLA 4FUQA 5BSTA 4LF7C 4OXIA 4GXRA 2E7GA 1KKGA 4RVNA 4IZ6A 2UUAC 3GPCA 1QM4A 5IWAC 4K0BA 4MTNA 4OX9C 3EERA 5BSWA 4OYCA 2UXDC 1USPB 4FUTA 1XMOC 4DCSA 1XS3A 5T8SA 1O9TA 3UOWA 4DUYC 4PUIA 5LCIA 1HNXC 1XNQC 4YY3C 2YX1A 1N34C 4JI1C 1NYEA 4DR1C 5LMUC 2DYJA 4RM3A 1M6XC 1FJGC 1ML8A 5BSUA 3AY0A 4LFAC 1HH2P 3A9VA 2MM9A 1O90A 2QVYX 4PROC 4GXQA 2OBVA 3SO4A 2MMAB 1HNWC 4BC7A 1BA3A 1RG9A 3R44A 2WD9A 2HHHC 3CW9A 3IEVA 4PUHA 2QL8A 4X64C 3NI2A 4FTFA 4ODJA 4NOZA 4ISBA 3N54B 2E5LC 1V25A 5DV9A 3DHVA 2UU9C 3UZ0A 4DV3C 1PG3A 5IT9D 3LGXA 3PROC 1M6XA 1PU1A 1ULTA 3CQ1A 4WS9A 5LMNC 1XRBA 2YWBA 1MXBA 2WP0C 5FLXD 3ETOA 4G1IA 2ASBA 3K6RA 1N2FA 4WV3A 5A2QD 3PESA 1N33C 1UWDA 4JV5C 3I07A 1K0RA 3J80D 4DR2C 4DG9A 2PT7G 5IFIA 4JI6C 2VZEA 4BSZA 3CQ3A 3L95X 4BC9A 4DG8A 3LNOA 2M5HA 4LF6C 2KZ0A 2E8EA 4D57A 3CQ2A 4JI4C 3AF6A 4I9FA 4LF4C 1YJ7A 2Y4NA 1JOSA 2MCQA 2D1SA 2D27A 4NDNA 1XRAA 2D7VA 1T5HX 3L8CA 1P4EA 1UKKA 4DR3C 1J5EC 5CZXA 4X62C 3IMLA 2E8FA 1ZB8A 3A9UA 1O92A 2DPLA 1WF3A 4X65C 3NYQA 3UX3A 2JNVA 4KTTA 3H2TA 4RLFA 3OTOC 1WCJA 4DR4C 4KTVA 3RV2A 1IBMC 1MKYA 4D56A 3E7WA 4G36A 4KHPC 4XX2A 3UEBA 5K85A 1O93A 1HR0C 5K8FA 1TH5A 4AQYC 2ZZMA 5A19A 2D1TA 4I9GA 1EGAA 5BSVA 3VNRA 4JI5C 1N32C 4R0MA 5ADZA 4EATA 2QVZX 2V7BA 4DR5C 3ETCA 3GR0A 4RLQA 4DV5C 2CXCA 3GR1A 4DV6C 2BH1X 3AF5A 1ZB9A 5BR8C 3LNVA 4JI7C 3KXWA 2E8CA 3DAYA 1AMUA 4DCTA 2D1RA 1IBKC 5BSMA 3R9XA 4PUGA 1MXCA 1USPA 4RM2A 3C5EA 4DR6C 2CY1A 3A26A 3RG2A 1HNZC 4YHHC 4DUZC 1GPMA 4L2ZA 2PN2A 4D4IA 4R1MA 3TDEA 4BCAA 2P2MA 4PZPA 3T1YC 2DHMA 1RY2A 3O2EA 3IEUA 2M5OA 4LFCC 3CW8X 1N36C 2D1QA 3G7SA 1PG4A 4JI0C 4R1LA 1LQLA 1I94C 4DV4C 2UUBC 2Y27A 4X66C 2AYAA 4DV1C 3J81D 3VNSA 4RMNA 5A1GA 4GKJC 2P2FA 2VSQA 1XHJA 5GTDA 4ZLPA 2UUCC 3CJEA 2KZFA 1XRCA 5KEIA 3N2QA 4PHTA 4TPSB 3S82A 3GKUA 1MD9A 5JRHA 4LFBC 3EQ6A 2OPLB 1MXAA 5AE1A 5BUSA 3I08A 2EGTA 2QVXX 2P2QA 3UX2A 4DCUA 4JI8C 2ZZNA 2QW0X 4JI2C 3TUFA 3FCEA 1LCIA 1VLAA 1IB8A 1VEHA 4JYAC 2UXCC 4LF9C 2E0GA 5T8TA 3JAMD 4NXMC 4B3SC 1XMQC 1FLOA 2P02A 2P2BA 3FCCA 4DV2C 1P7LA 1V60A 3R9WA 5H9UA 1T5DX 4JI3C 2UXBC 1P4EC 4BBYA 3E7XA 4RVOA 4LF5C 4NXNC 2XR1A 4B3MC 1NY8A 1PA4A 4B3RC 4GS5A 2VQFC 4DR7C 5BURA 4DV7C 2HJGA 2KDNA 1MDFA 4MH4A 2Z51A 2JMPA 2OPLA 2CU6A 3A4IA 3A25A 3B7WA 2P20A 3VNQA 1V26A 3NYRA 4G37A 5BUQA 2F4VC 4ZJZA 2OO4A 1L2FA 4U5YD 4L4QA 5AE3A 4JM1A 3PBKA 4IR7A 3DLPX 4K0KC 2PROA 3LUSA 2ZM6C 3NPDA 4L7IA 1IBLC 2D28C 5KYTA 4DV0C 3TR3A 1FUGA 5A1IA 2YWCA 2Y4OA 2YCBA 3T1HC 1MDBA 5KYVA 1XNRC 3IPLA 1WH9A 4LF8C 2VQEC 2ONFA 5AE2A 5E7QA 3LAXA
chains in the Genus database with same CATH topology
2BJOA 1QWIA 4HPVA 3TQIA 4LE5A 4D4GA 4DCVA 4B3TC 4GKKC 2P2JA 2ATWA 5BSRA 5CZVA 4FUQA 5BSTA 4LF7C 4OXIA 4GXRA 2E7GA 1KKGA 2UUAC 4IZ6A 4RVNA 3GPCA 1QM4A 5IWAC 4K0BA 4MTNA 4OX9C 3EERA 5BSWA 4OYCA 2UXDC 1USPB 4FUTA 1XMOC 4DCSA 5T8SA 1O9TA 3UOWA 4DUYC 1HNXC 1XNQC 4YY3C 1N34C 4JI1C 1NYEA 4DR1C 5LMUC 2DYJA 4RM3A 1FJGC 1ML8A 5BSUA 4LFAC 1HH2P 3A9VA 1O90A 2QVYX 4PROC 4GXQA 2OBVA 3SO4A 1HNWC 4BC7A 1BA3A 1RG9A 3R44A 2WD9A 2HHHC 3CW9A 3IEVA 2QL8A 4X64C 3NI2A 4FTFA 4ODJA 4NOZA 4ISBA 3N54B 2E5LC 1V25A 5DV9A 3DHVA 2UU9C 3UZ0A 4DV3C 1PG3A 5IT9D 3LGXA 3PROC 1ULTA 4WS9A 5LMNC 1XRBA 2YWBA 1MXBA 2WP0C 5FLXD 3ETOA 4G1IA 2ASBA 1N2FA 4WV3A 5A2QD 3PESA 1N33C 4JV5C 3I07A 1K0RA 3J80D 4DR2C 4DG9A 2PT7G 5IFIA 4JI6C 2VZEA 4BSZA 4BC9A 3L95X 4DG8A 4LF6C 2E8EA 4D57A 4JI4C 3AF6A 4I9FA 4LF4C 1YJ7A 2Y4NA 1JOSA 2D1SA 2D27A 4NDNA 1XRAA 2D7VA 1T5HX 3L8CA 1UKKA 1J5EC 4DR3C 5CZXA 4X62C 3IMLA 2E8FA 1ZB8A 3A9UA 1O92A 2DPLA 1WF3A 4X65C 3NYQA 4KTTA 3H2TA 4RLFA 3OTOC 4DR4C 4KTVA 3RV2A 1IBMC 1MKYA 4D56A 3E7WA 4G36A 4KHPC 4XX2A 5K85A 1O93A 1HR0C 5K8FA 4AQYC 5A19A 2D1TA 4I9GA 1EGAA 5BSVA 3VNRA 4JI5C 1N32C 4R0MA 5ADZA 4EATA 2QVZX 2V7BA 4DR5C 3ETCA 3GR0A 4RLQA 4DV5C 2CXCA 3GR1A 4DV6C 2BH1X 3AF5A 1ZB9A 5BR8C 3LNVA 4JI7C 3KXWA 2E8CA 3DAYA 1AMUA 4DCTA 2D1RA 1IBKC 5BSMA 3R9XA 1MXCA 1USPA 4RM2A 3C5EA 4DR6C 2CY1A 3RG2A 1HNZC 4YHHC 4DUZC 1GPMA 4L2ZA 2PN2A 4D4IA 4R1MA 3TDEA 4BCAA 2P2MA 4PZPA 3T1YC 1RY2A 3IEUA 4LFCC 3CW8X 1N36C 2D1QA 3G7SA 1PG4A 4JI0C 4R1LA 1LQLA 1I94C 4DV4C 2UUBC 2Y27A 4X66C 2AYAA 4DV1C 3J81D 3VNSA 4RMNA 5A1GA 4GKJC 2P2FA 2VSQA 5GTDA 4ZLPA 2UUCC 3CJEA 2KZFA 1XRCA 5KEIA 3N2QA 4PHTA 4TPSB 3S82A 3GKUA 1MD9A 5JRHA 4LFBC 3EQ6A 2OPLB 1MXAA 5AE1A 5BUSA 3I08A 2EGTA 2QVXX 2P2QA 4DCUA 4JI8C 2QW0X 4JI2C 3TUFA 3FCEA 1LCIA 1VLAA 4JYAC 2UXCC 4LF9C 2E0GA 5T8TA 3JAMD 4NXMC 4B3SC 1XMQC 2P02A 2P2BA 3FCCA 4DV2C 1P7LA 3R9WA 5H9UA 1T5DX 4JI3C 2UXBC 4BBYA 3E7XA 4RVOA 4LF5C 4NXNC 2XR1A 4B3MC 1PA4A 4B3RC 4GS5A 2VQFC 4DR7C 5BURA 4DV7C 2HJGA 1MDFA 4MH4A 2JMPA 2OPLA 3A4IA 3B7WA 2P20A 3VNQA 1V26A 3NYRA 4G37A 5BUQA 2F4VC 4ZJZA 2OO4A 1L2FA 4U5YD 4L4QA 5AE3A 4JM1A 3PBKA 4IR7A 3DLPX 4K0KC 2PROA 3LUSA 2ZM6C 3NPDA 4L7IA 1IBLC 2D28C 5KYTA 4DV0C 1FUGA 5A1IA 2YWCA 2Y4OA 2YCBA 3T1HC 1MDBA 5KYVA 1XNRC 3IPLA 1WH9A 4LF8C 2VQEC 2ONFA 5AE2A 5E7QA 3LAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BUS A;  4R0M A;  5DV9 A;  3DHV A;  4EAT A;  2QVZ X;  1PG3 A;  2QVX X;  2P2Q A;  2V7B A;  2QW0 X;  3ETC A;  3LGX A;  4D4G A;  4RLQ A;  3FCE A;  1ULT A;  1LCI A;  2P2J A;  5BSR A;  4FUQ A;  3LNV A;  5BST A;  4OXI A;  3KXW A;  4GXR A;  4WV3 A;  4RVN A;  4IZ6 A;  2P2B A;  3FCC A;  3GPC A;  3DAY A;  5E7Q A;  1AMU A;  1T5D X;  2D1R A;  5BSW A;  4OYC A;  4DG9 A;  5BSM A;  3E7X A;  4RVO A;  4FUT A;  4RM2 A;  5IFI A;  3C5E A;  2VZE A;  4GS5 A;  4DG8 A;  5BUR A;  3RG2 A;  1MDF A;  4D57 A;  4D4I A;  3B7W A;  1YJ7 A;  4R1M A;  2P20 A;  3VNQ A;  2Y4N A;  2P2M A;  3NYR A;  4G37 A;  4PZP A;  5BUQ A;  2D1S A;  4RM3 A;  3L8C A;  1T5H X;  1RY2 A;  4ZJZ A;  5BSU A;  4U5Y D;  3CW8 X;  3A9U A;  3PBK A;  3NYQ A;  4IR7 A;  2D1Q A;  3A9V A;  3G7S A;  1PG4 A;  3DLP X;  4R1L A;  4RLF A;  2Y27 A;  5KYT A;  2QVY X;  3VNS A;  4D56 A;  4RMN A;  3E7W A;  4GXQ A;  4G36 A;  2P2F A;  2VSQ A;  5GTD A;  2Y4O A;  1BA3 A;  5K85 A;  1MDB A;  3R44 A;  2WD9 A;  5KYV A;  5KEI A;  3CW9 A;  3IPL A;  5K8F A;  3NI2 A;  1MD9 A;  2D1T A;  5BSV A;  5JRH A;  4ISB A;  3VNR A;  3EQ6 A;  3LAX A; 
#chains in the Genus database with same CATH topology
 2BJO A;  1QWI A;  4HPV A;  3TQI A;  4LE5 A;  4D4G A;  4DCV A;  4B3T C;  4GKK C;  2P2J A;  2ATW A;  5BSR A;  5CZV A;  2NCL A;  4FUQ A;  5BST A;  4LF7 C;  4OXI A;  4GXR A;  2E7G A;  1KKG A;  4RVN A;  4IZ6 A;  2UUA C;  3GPC A;  1QM4 A;  5IWA C;  4K0B A;  4MTN A;  4OX9 C;  3EER A;  5BSW A;  4OYC A;  2UXD C;  1USP B;  4FUT A;  1XMO C;  4DCS A;  1XS3 A;  5T8S A;  1O9T A;  3UOW A;  4DUY C;  4PUI A;  5LCI A;  1HNX C;  1XNQ C;  4YY3 C;  2YX1 A;  1N34 C;  4JI1 C;  1NYE A;  4DR1 C;  5LMU C;  2DYJ A;  4RM3 A;  1M6X C;  1FJG C;  1ML8 A;  5BSU A;  3AY0 A;  4LFA C;  1HH2 P;  3A9V A;  2MM9 A;  1O90 A;  2QVY X;  4PRO C;  4GXQ A;  2OBV A;  3SO4 A;  2MMA B;  1HNW C;  4BC7 A;  1BA3 A;  1RG9 A;  3R44 A;  2WD9 A;  2HHH C;  3CW9 A;  3IEV A;  4PUH A;  2QL8 A;  4X64 C;  3NI2 A;  4FTF A;  4ODJ A;  4NOZ A;  4ISB A;  3N54 B;  2E5L C;  1V25 A;  5DV9 A;  3DHV A;  2UU9 C;  3UZ0 A;  4DV3 C;  1PG3 A;  5IT9 D;  3LGX A;  3PRO C;  1M6X A;  1PU1 A;  1ULT A;  3CQ1 A;  4WS9 A;  5LMN C;  1XRB A;  2YWB A;  1MXB A;  2WP0 C;  5FLX D;  3ETO A;  4G1I A;  2ASB A;  3K6R A;  1N2F A;  4WV3 A;  5A2Q D;  3PES A;  1N33 C;  1UWD A;  4JV5 C;  3I07 A;  1K0R A;  3J80 D;  4DR2 C;  4DG9 A;  2PT7 G;  5IFI A;  4JI6 C;  2VZE A;  4BSZ A;  3CQ3 A;  3L95 X;  4BC9 A;  4DG8 A;  3LNO A;  2M5H A;  4LF6 C;  2KZ0 A;  2E8E A;  4D57 A;  3CQ2 A;  4JI4 C;  3AF6 A;  4I9F A;  4LF4 C;  1YJ7 A;  2Y4N A;  1JOS A;  2MCQ A;  2D1S A;  2D27 A;  4NDN A;  1XRA A;  2D7V A;  1T5H X;  3L8C A;  1P4E A;  1UKK A;  4DR3 C;  1J5E C;  5CZX A;  4X62 C;  3IML A;  2E8F A;  1ZB8 A;  3A9U A;  1O92 A;  2DPL A;  1WF3 A;  4X65 C;  3NYQ A;  3UX3 A;  2JNV A;  4KTT A;  3H2T A;  4RLF A;  3OTO C;  1WCJ A;  4DR4 C;  4KTV A;  3RV2 A;  1IBM C;  1MKY A;  4D56 A;  3E7W A;  4G36 A;  4KHP C;  4XX2 A;  3UEB A;  5K85 A;  1O93 A;  1HR0 C;  5K8F A;  1TH5 A;  4AQY C;  2ZZM A;  5A19 A;  2D1T A;  4I9G A;  1EGA A;  5BSV A;  3VNR A;  4JI5 C;  1N32 C;  4R0M A;  5ADZ A;  4EAT A;  2QVZ X;  2V7B A;  4DR5 C;  3ETC A;  3GR0 A;  4RLQ A;  4DV5 C;  2CXC A;  3GR1 A;  4DV6 C;  2BH1 X;  3AF5 A;  1ZB9 A;  5BR8 C;  3LNV A;  4JI7 C;  3KXW A;  2E8C A;  3DAY A;  1AMU A;  4DCT A;  2D1R A;  1IBK C;  5BSM A;  3R9X A;  4PUG A;  1MXC A;  1USP A;  4RM2 A;  3C5E A;  4DR6 C;  2CY1 A;  3A26 A;  3RG2 A;  1HNZ C;  4YHH C;  4DUZ C;  1GPM A;  4L2Z A;  2PN2 A;  4D4I A;  4R1M A;  3TDE A;  4BCA A;  2P2M A;  4PZP A;  3T1Y C;  2DHM A;  1RY2 A;  3O2E A;  3IEU A;  2M5O A;  4LFC C;  3CW8 X;  1N36 C;  2D1Q A;  3G7S A;  1PG4 A;  4JI0 C;  4R1L A;  1LQL A;  1I94 C;  4DV4 C;  2UUB C;  2Y27 A;  4X66 C;  2AYA A;  4DV1 C;  3J81 D;  3VNS A;  4RMN A;  5A1G A;  4GKJ C;  2P2F A;  2VSQ A;  1XHJ A;  5GTD A;  4ZLP A;  2UUC C;  3CJE A;  2KZF A;  1XRC A;  5KEI A;  3N2Q A;  4PHT A;  4TPS B;  3S82 A;  3GKU A;  1MD9 A;  5JRH A;  4LFB C;  3EQ6 A;  2OPL B;  1MXA A;  5AE1 A;  5BUS A;  3I08 A;  2EGT A;  2QVX X;  2P2Q A;  3UX2 A;  4DCU A;  4JI8 C;  2ZZN A;  2QW0 X;  4JI2 C;  3TUF A;  3FCE A;  1LCI A;  1VLA A;  1IB8 A;  1VEH A;  4JYA C;  2UXC C;  4LF9 C;  2E0G A;  5T8T A;  3JAM D;  4NXM C;  4B3S C;  1XMQ C;  1FLO A;  2P02 A;  2P2B A;  3FCC A;  4DV2 C;  1P7L A;  1V60 A;  3R9W A;  5H9U A;  1T5D X;  4JI3 C;  2UXB C;  1P4E C;  4BBY A;  3E7X A;  4RVO A;  4LF5 C;  4NXN C;  2XR1 A;  4B3M C;  1NY8 A;  1PA4 A;  4B3R C;  4GS5 A;  2VQF C;  4DR7 C;  5BUR A;  4DV7 C;  2HJG A;  2KDN A;  1MDF A;  4MH4 A;  2Z51 A;  2JMP A;  2OPL A;  2CU6 A;  3A4I A;  3A25 A;  3B7W A;  2P20 A;  3VNQ A;  1V26 A;  3NYR A;  4G37 A;  5BUQ A;  2F4V C;  4ZJZ A;  2OO4 A;  1L2F A;  4U5Y D;  4L4Q A;  5AE3 A;  4JM1 A;  3PBK A;  4IR7 A;  3DLP X;  4K0K C;  2PRO A;  3LUS A;  2ZM6 C;  3NPD A;  4L7I A;  1IBL C;  2D28 C;  5KYT A;  4DV0 C;  3TR3 A;  1FUG A;  5A1I A;  2YWC A;  2Y4O A;  2YCB A;  3T1H C;  1MDB A;  5KYV A;  1XNR C;  3IPL A;  1WH9 A;  4LF8 C;  2VQE C;  2ONF A;  5AE2 A;  5E7Q A;  3LAX A; 
#chains in the Genus database with same CATH homology
 2BJO A;  1QWI A;  4HPV A;  3TQI A;  4LE5 A;  4D4G A;  4DCV A;  4B3T C;  4GKK C;  2P2J A;  2ATW A;  5BSR A;  5CZV A;  4FUQ A;  5BST A;  4LF7 C;  4OXI A;  4GXR A;  2E7G A;  1KKG A;  2UUA C;  4IZ6 A;  4RVN A;  3GPC A;  1QM4 A;  5IWA C;  4K0B A;  4MTN A;  4OX9 C;  3EER A;  5BSW A;  4OYC A;  2UXD C;  1USP B;  4FUT A;  1XMO C;  4DCS A;  5T8S A;  1O9T A;  3UOW A;  4DUY C;  1HNX C;  1XNQ C;  4YY3 C;  1N34 C;  4JI1 C;  1NYE A;  4DR1 C;  5LMU C;  2DYJ A;  4RM3 A;  1FJG C;  1ML8 A;  5BSU A;  4LFA C;  1HH2 P;  3A9V A;  1O90 A;  2QVY X;  4PRO C;  4GXQ A;  2OBV A;  3SO4 A;  1HNW C;  4BC7 A;  1BA3 A;  1RG9 A;  3R44 A;  2WD9 A;  2HHH C;  3CW9 A;  3IEV A;  2QL8 A;  4X64 C;  3NI2 A;  4FTF A;  4ODJ A;  4NOZ A;  4ISB A;  3N54 B;  2E5L C;  1V25 A;  5DV9 A;  3DHV A;  2UU9 C;  3UZ0 A;  4DV3 C;  1PG3 A;  5IT9 D;  3LGX A;  3PRO C;  1ULT A;  4WS9 A;  5LMN C;  1XRB A;  2YWB A;  1MXB A;  2WP0 C;  5FLX D;  3ETO A;  4G1I A;  2ASB A;  1N2F A;  4WV3 A;  5A2Q D;  3PES A;  1N33 C;  4JV5 C;  3I07 A;  1K0R A;  3J80 D;  4DR2 C;  4DG9 A;  2PT7 G;  5IFI A;  4JI6 C;  2VZE A;  4BSZ A;  4BC9 A;  3L95 X;  4DG8 A;  4LF6 C;  2E8E A;  4D57 A;  4JI4 C;  3AF6 A;  4I9F A;  4LF4 C;  1YJ7 A;  2Y4N A;  1JOS A;  2D1S A;  2D27 A;  4NDN A;  1XRA A;  2D7V A;  1T5H X;  3L8C A;  1UKK A;  1J5E C;  4DR3 C;  5CZX A;  4X62 C;  3IML A;  2E8F A;  1ZB8 A;  3A9U A;  1O92 A;  2DPL A;  1WF3 A;  4X65 C;  3NYQ A;  4KTT A;  3H2T A;  4RLF A;  3OTO C;  4DR4 C;  4KTV A;  3RV2 A;  1IBM C;  1MKY A;  4D56 A;  3E7W A;  4G36 A;  4KHP C;  4XX2 A;  5K85 A;  1O93 A;  1HR0 C;  5K8F A;  4AQY C;  5A19 A;  2D1T A;  4I9G A;  1EGA A;  5BSV A;  3VNR A;  4JI5 C;  1N32 C;  4R0M A;  5ADZ A;  4EAT A;  2QVZ X;  2V7B A;  4DR5 C;  3ETC A;  3GR0 A;  4RLQ A;  4DV5 C;  2CXC A;  3GR1 A;  4DV6 C;  2BH1 X;  3AF5 A;  1ZB9 A;  5BR8 C;  3LNV A;  4JI7 C;  3KXW A;  2E8C A;  3DAY A;  1AMU A;  4DCT A;  2D1R A;  1IBK C;  5BSM A;  3R9X A;  1MXC A;  1USP A;  4RM2 A;  3C5E A;  4DR6 C;  2CY1 A;  3RG2 A;  1HNZ C;  4YHH C;  4DUZ C;  1GPM A;  4L2Z A;  2PN2 A;  4D4I A;  4R1M A;  3TDE A;  4BCA A;  2P2M A;  4PZP A;  3T1Y C;  1RY2 A;  3IEU A;  4LFC C;  3CW8 X;  1N36 C;  2D1Q A;  3G7S A;  1PG4 A;  4JI0 C;  4R1L A;  1LQL A;  1I94 C;  4DV4 C;  2UUB C;  2Y27 A;  4X66 C;  2AYA A;  4DV1 C;  3J81 D;  3VNS A;  4RMN A;  5A1G A;  4GKJ C;  2P2F A;  2VSQ A;  5GTD A;  4ZLP A;  2UUC C;  3CJE A;  2KZF A;  1XRC A;  5KEI A;  3N2Q A;  4PHT A;  4TPS B;  3S82 A;  3GKU A;  1MD9 A;  5JRH A;  4LFB C;  3EQ6 A;  2OPL B;  1MXA A;  5AE1 A;  5BUS A;  3I08 A;  2EGT A;  2QVX X;  2P2Q A;  4DCU A;  4JI8 C;  2QW0 X;  4JI2 C;  3TUF A;  3FCE A;  1LCI A;  1VLA A;  4JYA C;  2UXC C;  4LF9 C;  2E0G A;  5T8T A;  3JAM D;  4NXM C;  4B3S C;  1XMQ C;  2P02 A;  2P2B A;  3FCC A;  4DV2 C;  1P7L A;  3R9W A;  5H9U A;  1T5D X;  4JI3 C;  2UXB C;  4BBY A;  3E7X A;  4RVO A;  4LF5 C;  4NXN C;  2XR1 A;  4B3M C;  1PA4 A;  4B3R C;  4GS5 A;  2VQF C;  4DR7 C;  5BUR A;  4DV7 C;  2HJG A;  1MDF A;  4MH4 A;  2JMP A;  2OPL A;  3A4I A;  3B7W A;  2P20 A;  3VNQ A;  1V26 A;  3NYR A;  4G37 A;  5BUQ A;  2F4V C;  4ZJZ A;  2OO4 A;  1L2F A;  4U5Y D;  4L4Q A;  5AE3 A;  4JM1 A;  3PBK A;  4IR7 A;  3DLP X;  4K0K C;  2PRO A;  3LUS A;  2ZM6 C;  3NPD A;  4L7I A;  1IBL C;  2D28 C;  5KYT A;  4DV0 C;  1FUG A;  5A1I A;  2YWC A;  2Y4O A;  2YCB A;  3T1H C;  1MDB A;  5KYV A;  1XNR C;  3IPL A;  1WH9 A;  4LF8 C;  2VQE C;  2ONF A;  5AE2 A;  5E7Q A;  3LAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...