3LAXA

The crystal structure of a domain of phenylacetate-coenzyme a ligase from bacteroides vulgatus atcc 8482
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
106
Chain Sequence
b'SNADDMIILKGVNIFPIQIETILLQFKELGSDYLITLETAESNDEMTVEVELSQLFTDDYGRLQALTREITRQLKDEILVTPRVKLVPKGALPKSAVRVKDLRKTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phenylacetate-coenzyme A ligase
publication title The crystal structure of a domain of phenylacetate-coenzyme A ligase from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus
molecule tags Ligase
total genus 28
structure length 106
sequence length 109
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3laxA00
5BSTA 5KEIA 3PBKA 4DG8A 3DLPX 4RM3A 4G36A 4R1LA 5BSUA 5BUSA 5BSMA 2Y4OA 5E7QA 5BSVA 3CW9A 4RMNA 4D4IA 3NYRA 3FCCA 4RLQA 4WV3A 1ULTA 3G7SA 3EQ6A 2D1SA 2P2QA 3E7WA 3LAXA 4RLFA 4G37A 1AMUA 3ETCA 1MDFA 4GS5A 4OXIA 5IFIA 3LGXA 2P2MA 3CW8X 5KYTA 2Y27A 5KYVA 1LCIA 5BUQA 2P2JA 1RY2A 1MD9A 3GPCA 4R1MA 4R0MA 3A9UA 4FUTA 3DAYA 3NI2A 4OYCA 3VNQA 1PG3A 4IZ6A 3FCEA 3IPLA 4RVOA 2P20A 3C5EA 2QVZX 5K8FA 4FUQA 2VZEA 3NYQA 4ISBA 1T5HX 3VNRA 1YJ7A 2V7BA 3E7XA 2P2FA 4GXRA 4U5YD 2D1RA 2WD9A 1BA3A 4PZPA 4DG9A 5BSRA 5BURA 5DV9A 4RVNA 1T5DX 4RM2A 3KXWA 3R44A 4D4GA 3LNVA 5GTDA 2QW0X 4IR7A 5JRHA 3L8CA 1PG4A 1MDBA 2QVYX 2P2BA 3DHVA 4ZJZA 2VSQA 5BSWA 2D1QA 2D1TA 4D56A 2QVXX 4GXQA 4EATA 5K85A 2Y4NA 3RG2A 3VNSA 4D57A 3A9VA 3B7WA
chains in the Genus database with same CATH superfamily
5BSTA 5KEIA 4LE5A 4BCAA 4G36A 2KZFA 4HPVA 3JAMD 2CY1A 3J80D 2YCBA 1P7LA 1RG9A 3CW9A 5A2QD 5A19A 1ULTA 4G37A 3UEBA 1AMUA 1XMOC 4NXMC 4GS5A 3LGXA 2JMPA 4LFAC 1L2FA 1XRBA 3CW8X 2Y27A 1JOSA 5KYVA 5BUQA 2D7VA 4NXNC 4R1MA 3N54B 4X62C 3DAYA 2ZZMA 2MM9A 4XX2A 1PG3A 3UX3A 4RVOA 1P4EC 2P20A 3C5EA 3R9XA 4JI1C 3NYQA 3I07A 1P4EA 3VNRA 4DR6C 4JI0C 1PU1A 1ZB8A 1IBMC 4U5YD 4PZPA 4RVNA 1QM4A 1XRCA 1TH5A 2D28C 3IEUA 4JM1A 3L95X 4L7IA 2QVYX 4MH4A 2KDNA 3LUSA 4ZJZA 2E0GA 1MXAA 2BJOA 2D1QA 4JI8C 4GXQA 1J5EC 2MCQA 2PT7G 4X66C 4L2ZA 4D57A 1UKKA 2E5LC 3IMLA 2YWCA 4JV5C 2DHMA 3DLPX 5A1IA 3A26A 4R1LA 4DR4C 1N32C 4RMNA 1XHJA 1M6XC 3EERA 2D1SA 2P2QA 3E7WA 1M6XA 2VQEC 4PHTA 2JNVA 3CJEA 5T8TA 4LFBC 5IWAC 3GKUA 4B3TC 3CQ2A 4KTVA 4BC7A 1LCIA 1MD9A 4B3MC 5A1GA 4DV1C 3A25A 2AYAA 3NI2A 4OYCA 2OPLB 2HJGA 2PN2A 4AQYC 1IBKC 1XNRC 2QVZX 5K8FA 4FUQA 4ISBA 4JI6C 4PUHA 3SO4A 1T5HX 5LCIA 1LQLA 1USPB 1YJ7A 1O93A 3E7XA 4DV0C 2P2FA 3LNOA 4LFCC 3CQ3A 1FLOA 1I94C 2WD9A 4DCTA 4KHPC 2E8EA 2MMAB 1V26A 1T5DX 4RM2A 4D4GA 3LNVA 1HNWC 1O92A 3L8CA 1HNXC 4K0BA 2NCLA 4TPSB 2VSQA 4DV7C 5BSWA 2D1TA 2ONFA 3T1YC 1IBLC 4EATA 1WCJA 5K85A 4JI4C 1KKGA 3AF5A 3AY0A 3CQ1A 5AE1A 3B7WA 1N36C 2BH1X 4DG8A 4DR7C 4MTNA 2Z51A 5ADZA 5BSMA 3TR3A 2UUAC 5E7QA 2PROA 5FLXD 4LF4C 5BSVA 4DV2C 3PROC 4D4IA 5IT9D 3NYRA 4RLQA 4WV3A 5LMNC 4BSZA 3NPDA 2UXBC 3LAXA 4RLFA 2OO4A 2M5HA 3PESA 4OXIA 5IFIA 2P2MA 2P02A 4LF7C 2XR1A 1V60A 2P2JA 2UU9C 4R0MA 3A9UA 1NYEA 1FUGA 2ZZNA 4BBYA 4B3SC 1UWDA 3FCEA 5CZVA 1WH9A 3TQIA 4DV3C 4OX9C 2CU6A 3H2TA 2VZEA 2EGTA 2HHHC 4X64C 2CXCA 4GXRA 3AF6A 3R9WA 4BC9A 2E8CA 5BSRA 4KTTA 5BURA 4LF5C 5DV9A 1NY8A 1N33C 2YWBA 2F4VC 3R44A 5BR8C 5GTDA 4DR1C 2QW0X 1ZB9A 2P2BA 3GR0A 4ZLPA 1IB8A 4DUZC 3A4IA 2UUBC 2E8FA 2QVXX 1QWIA 3N2QA 1GPMA 2E7GA 5CZXA 3ETOA 4LF9C 2ATWA 3PBKA 4RM3A 4JI3C 5T8SA 1MXBA 2QL8A 5BSUA 4B3RC 2WP0C 5BUSA 3T1HC 2Y4OA 3TUFA 4JI5C 4JYAC 1PA4A 1MKYA 3FCCA 4GKJC 2ZM6C 4ODJA 4DV5C 1ML8A 3G7SA 4YHHC 3EQ6A 3S82A 2UXDC 4DR2C 3RV2A 4DCUA 3ETCA 1MDFA 5H9UA 1WF3A 2UXCC 5LMUC 5KYTA 4DR3C 4WS9A 5AE2A 1XRAA 1RY2A 3UX2A 3GPCA 1HR0C 4K0KC 4DCSA 4PUGA 4G1IA 2YX1A 4FUTA 3I08A 4PUIA 4JI7C 4JI2C 4I9FA 1XMQC 3VNQA 1V25A 4X65C 3J81D 4IZ6A 4PROC 1FJGC 3IPLA 3K6RA 2KZ0A 4GKKC 1VLAA 2D27A 2M5OA 1N2FA 4YY3C 1XS3A 4DCVA 2V7BA 2OPLA 2OBVA 2D1RA 1BA3A 4DG9A 1K0RA 1MXCA 3UZ0A 4LF8C 3GR1A 3O2EA 3TDEA 3KXWA 5AE3A 1O90A 3OTOC 4LF6C 4NDNA 1USPA 5JRHA 4IR7A 2ASBA 2UUCC 1PG4A 1MDBA 2VQFC 3IEVA 4FTFA 4NOZA 1XNQC 1O9TA 3DHVA 3UOWA 4DV6C 1HH2P 4D56A 2DPLA 2DYJA 4L4QA 2Y4NA 3RG2A 1HNZC 1N34C 4DR5C 3VNSA 4DV4C 4I9GA 1EGAA 1VEHA 3A9VA 4DUYC
chains in the Genus database with same CATH topology
5BSTA 5KEIA 4LE5A 4BCAA 4G36A 2KZFA 4HPVA 3JAMD 2CY1A 3J80D 2YCBA 1P7LA 1RG9A 3CW9A 5A2QD 5A19A 1ULTA 4G37A 1AMUA 1XMOC 4NXMC 4GS5A 3LGXA 2JMPA 4LFAC 1L2FA 1XRBA 3CW8X 2Y27A 1JOSA 5KYVA 5BUQA 2D7VA 4NXNC 4R1MA 3N54B 4X62C 3DAYA 4XX2A 1PG3A 4RVOA 2P20A 3C5EA 3R9XA 4JI1C 3NYQA 3I07A 3VNRA 4DR6C 4JI0C 1ZB8A 1IBMC 4U5YD 4PZPA 4RVNA 1QM4A 1XRCA 4JM1A 2D28C 3IEUA 3L95X 4L7IA 2QVYX 4MH4A 3LUSA 4ZJZA 2E0GA 1MXAA 2BJOA 2D1QA 4JI8C 4GXQA 1J5EC 2PT7G 4X66C 4L2ZA 4D57A 1UKKA 2E5LC 3IMLA 2YWCA 4JV5C 3DLPX 5A1IA 4R1LA 4DR4C 1N32C 4RMNA 3EERA 2D1SA 2P2QA 3E7WA 2VQEC 4PHTA 3CJEA 5T8TA 4LFBC 5IWAC 3GKUA 4B3TC 4KTVA 4BC7A 1LCIA 1MD9A 4B3MC 5A1GA 4DV1C 2AYAA 3NI2A 4OYCA 2OPLB 2HJGA 2PN2A 4AQYC 1IBKC 1XNRC 2QVZX 5K8FA 4FUQA 4ISBA 4JI6C 3SO4A 1T5HX 1LQLA 1USPB 1YJ7A 1O93A 3E7XA 4DV0C 2P2FA 4LFCC 1I94C 2WD9A 4DCTA 4KHPC 2E8EA 1V26A 1T5DX 4RM2A 4D4GA 3LNVA 1HNWC 1O92A 3L8CA 1HNXC 4K0BA 4TPSB 2VSQA 4DV7C 5BSWA 2D1TA 2ONFA 3T1YC 1IBLC 4EATA 5K85A 4JI4C 1KKGA 3AF5A 5AE1A 3B7WA 1N36C 2BH1X 4DG8A 4DR7C 4MTNA 5ADZA 5BSMA 2UUAC 5E7QA 2PROA 5FLXD 4LF4C 5BSVA 4DV2C 3PROC 4D4IA 5IT9D 3NYRA 4RLQA 4WV3A 5LMNC 4BSZA 3NPDA 2UXBC 3LAXA 4RLFA 2OO4A 3PESA 4OXIA 5IFIA 2P2MA 2P02A 4LF7C 2XR1A 2P2JA 2UU9C 4R0MA 3A9UA 1NYEA 1FUGA 4BBYA 4B3SC 3FCEA 5CZVA 3TQIA 1WH9A 4DV3C 4OX9C 3H2TA 2VZEA 2EGTA 2HHHC 4X64C 2CXCA 4GXRA 3AF6A 3R9WA 4BC9A 2E8CA 5BSRA 4KTTA 5BURA 4LF5C 5DV9A 1N33C 2YWBA 2F4VC 3R44A 5BR8C 5GTDA 4DR1C 2QW0X 1ZB9A 2P2BA 3GR0A 4ZLPA 4DUZC 3A4IA 2UUBC 2E8FA 2QVXX 1QWIA 3N2QA 1GPMA 2E7GA 5CZXA 3ETOA 4LF9C 2ATWA 3PBKA 4RM3A 4JI3C 5T8SA 1MXBA 2QL8A 5BSUA 4B3RC 2WP0C 5BUSA 3T1HC 2Y4OA 3TUFA 4JI5C 4JYAC 1PA4A 1MKYA 3FCCA 4GKJC 2ZM6C 4ODJA 4DV5C 1ML8A 3G7SA 4YHHC 3EQ6A 3S82A 2UXDC 4DR2C 3RV2A 4DCUA 3ETCA 1MDFA 5H9UA 1WF3A 2UXCC 5LMUC 5KYTA 4DR3C 4WS9A 5AE2A 1XRAA 1RY2A 3GPCA 1HR0C 4K0KC 4DCSA 4G1IA 4FUTA 3I08A 4JI7C 4JI2C 4I9FA 1XMQC 3VNQA 1V25A 4X65C 3J81D 4IZ6A 4PROC 1FJGC 3IPLA 4GKKC 1VLAA 2D27A 1N2FA 4YY3C 4DCVA 2V7BA 2OPLA 2OBVA 2D1RA 1BA3A 4DG9A 1K0RA 1MXCA 3UZ0A 4LF8C 3GR1A 3TDEA 3KXWA 3OTOC 1O90A 5AE3A 4LF6C 4NDNA 1USPA 5JRHA 4IR7A 2ASBA 2UUCC 1PG4A 1MDBA 2VQFC 3IEVA 4FTFA 4NOZA 1XNQC 1O9TA 3DHVA 3UOWA 4DV6C 1HH2P 4D56A 2DPLA 2DYJA 4L4QA 2Y4NA 3RG2A 1HNZC 1N34C 4DR5C 3VNSA 4DV4C 4I9GA 1EGAA 3A9VA 4DUYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BST A;  5KEI A;  3PBK A;  4DG8 A;  3DLP X;  4RM3 A;  4G36 A;  4R1L A;  5BSU A;  5BUS A;  5BSM A;  2Y4O A;  5E7Q A;  5BSV A;  3CW9 A;  4RMN A;  4D4I A;  3NYR A;  3FCC A;  4RLQ A;  4WV3 A;  1ULT A;  3G7S A;  3EQ6 A;  2D1S A;  2P2Q A;  3E7W A;  3LAX A;  4RLF A;  4G37 A;  1AMU A;  3ETC A;  1MDF A;  4GS5 A;  4OXI A;  5IFI A;  3LGX A;  2P2M A;  3CW8 X;  5KYT A;  2Y27 A;  5KYV A;  1LCI A;  5BUQ A;  2P2J A;  1RY2 A;  1MD9 A;  3GPC A;  4R1M A;  4R0M A;  3A9U A;  4FUT A;  3DAY A;  3NI2 A;  4OYC A;  3VNQ A;  1PG3 A;  4IZ6 A;  3FCE A;  3IPL A;  4RVO A;  2P20 A;  3C5E A;  2QVZ X;  5K8F A;  4FUQ A;  2VZE A;  3NYQ A;  4ISB A;  1T5H X;  3VNR A;  1YJ7 A;  2V7B A;  3E7X A;  2P2F A;  4GXR A;  4U5Y D;  2D1R A;  2WD9 A;  1BA3 A;  4PZP A;  4DG9 A;  5BSR A;  5BUR A;  5DV9 A;  4RVN A;  1T5D X;  4RM2 A;  3KXW A;  3R44 A;  4D4G A;  3LNV A;  5GTD A;  2QW0 X;  4IR7 A;  5JRH A;  3L8C A;  1PG4 A;  1MDB A;  2QVY X;  2P2B A;  3DHV A;  4ZJZ A;  2VSQ A;  5BSW A;  2D1Q A;  2D1T A;  4D56 A;  2QVX X;  4GXQ A;  4EAT A;  5K85 A;  2Y4N A;  3RG2 A;  3VNS A;  4D57 A;  3A9V A;  3B7W A; 
#chains in the Genus database with same CATH topology
 5BST A;  5KEI A;  4LE5 A;  4BCA A;  4G36 A;  2KZF A;  4HPV A;  3JAM D;  2CY1 A;  3J80 D;  2YCB A;  1P7L A;  1RG9 A;  3CW9 A;  5A2Q D;  5A19 A;  1ULT A;  4G37 A;  3UEB A;  1AMU A;  1XMO C;  4NXM C;  4GS5 A;  3LGX A;  2JMP A;  4LFA C;  1L2F A;  1XRB A;  3CW8 X;  2Y27 A;  1JOS A;  5KYV A;  5BUQ A;  2D7V A;  4NXN C;  4R1M A;  3N54 B;  4X62 C;  3DAY A;  2ZZM A;  2MM9 A;  4XX2 A;  1PG3 A;  3UX3 A;  4RVO A;  1P4E C;  2P20 A;  3C5E A;  3R9X A;  4JI1 C;  3NYQ A;  3I07 A;  1P4E A;  3VNR A;  4DR6 C;  4JI0 C;  1PU1 A;  1ZB8 A;  1IBM C;  4U5Y D;  4PZP A;  4RVN A;  1QM4 A;  1XRC A;  1TH5 A;  2D28 C;  3IEU A;  4JM1 A;  3L95 X;  4L7I A;  2QVY X;  4MH4 A;  2KDN A;  3LUS A;  4ZJZ A;  2E0G A;  1MXA A;  2BJO A;  2D1Q A;  4JI8 C;  4GXQ A;  1J5E C;  2MCQ A;  2PT7 G;  4X66 C;  4L2Z A;  4D57 A;  1UKK A;  2E5L C;  3IML A;  2YWC A;  4JV5 C;  2DHM A;  3DLP X;  5A1I A;  3A26 A;  4R1L A;  4DR4 C;  1N32 C;  4RMN A;  1XHJ A;  1M6X C;  3EER A;  2D1S A;  2P2Q A;  3E7W A;  1M6X A;  2VQE C;  4PHT A;  2JNV A;  3CJE A;  5T8T A;  4LFB C;  5IWA C;  3GKU A;  4B3T C;  3CQ2 A;  4KTV A;  4BC7 A;  1LCI A;  1MD9 A;  4B3M C;  5A1G A;  4DV1 C;  3A25 A;  2AYA A;  3NI2 A;  4OYC A;  2OPL B;  2HJG A;  2PN2 A;  4AQY C;  1IBK C;  1XNR C;  2QVZ X;  5K8F A;  4FUQ A;  4ISB A;  4JI6 C;  4PUH A;  3SO4 A;  1T5H X;  5LCI A;  1LQL A;  1USP B;  1YJ7 A;  1O93 A;  3E7X A;  4DV0 C;  2P2F A;  3LNO A;  4LFC C;  3CQ3 A;  1FLO A;  1I94 C;  2WD9 A;  4DCT A;  4KHP C;  2E8E A;  2MMA B;  1V26 A;  1T5D X;  4RM2 A;  4D4G A;  3LNV A;  1HNW C;  1O92 A;  3L8C A;  1HNX C;  4K0B A;  2NCL A;  4TPS B;  2VSQ A;  4DV7 C;  5BSW A;  2D1T A;  2ONF A;  3T1Y C;  1IBL C;  4EAT A;  1WCJ A;  5K85 A;  4JI4 C;  1KKG A;  3AF5 A;  3AY0 A;  3CQ1 A;  5AE1 A;  3B7W A;  1N36 C;  2BH1 X;  4DG8 A;  4DR7 C;  4MTN A;  2Z51 A;  5ADZ A;  5BSM A;  3TR3 A;  2UUA C;  5E7Q A;  2PRO A;  5FLX D;  4LF4 C;  5BSV A;  4DV2 C;  3PRO C;  4D4I A;  5IT9 D;  3NYR A;  4RLQ A;  4WV3 A;  5LMN C;  4BSZ A;  3NPD A;  2UXB C;  3LAX A;  4RLF A;  2OO4 A;  2M5H A;  3PES A;  4OXI A;  5IFI A;  2P2M A;  2P02 A;  4LF7 C;  2XR1 A;  1V60 A;  2P2J A;  2UU9 C;  4R0M A;  3A9U A;  1NYE A;  1FUG A;  2ZZN A;  4BBY A;  4B3S C;  1UWD A;  3FCE A;  5CZV A;  1WH9 A;  3TQI A;  4DV3 C;  4OX9 C;  2CU6 A;  3H2T A;  2VZE A;  2EGT A;  2HHH C;  4X64 C;  2CXC A;  4GXR A;  3AF6 A;  3R9W A;  4BC9 A;  2E8C A;  5BSR A;  4KTT A;  5BUR A;  4LF5 C;  5DV9 A;  1NY8 A;  1N33 C;  2YWB A;  2F4V C;  3R44 A;  5BR8 C;  5GTD A;  4DR1 C;  2QW0 X;  1ZB9 A;  2P2B A;  3GR0 A;  4ZLP A;  1IB8 A;  4DUZ C;  3A4I A;  2UUB C;  2E8F A;  2QVX X;  1QWI A;  3N2Q A;  1GPM A;  2E7G A;  5CZX A;  3ETO A;  4LF9 C;  2ATW A;  3PBK A;  4RM3 A;  4JI3 C;  5T8S A;  1MXB A;  2QL8 A;  5BSU A;  4B3R C;  2WP0 C;  5BUS A;  3T1H C;  2Y4O A;  3TUF A;  4JI5 C;  4JYA C;  1PA4 A;  1MKY A;  3FCC A;  4GKJ C;  2ZM6 C;  4ODJ A;  4DV5 C;  1ML8 A;  3G7S A;  4YHH C;  3EQ6 A;  3S82 A;  2UXD C;  4DR2 C;  3RV2 A;  4DCU A;  3ETC A;  1MDF A;  5H9U A;  1WF3 A;  2UXC C;  5LMU C;  5KYT A;  4DR3 C;  4WS9 A;  5AE2 A;  1XRA A;  1RY2 A;  3UX2 A;  3GPC A;  1HR0 C;  4K0K C;  4DCS A;  4PUG A;  4G1I A;  2YX1 A;  4FUT A;  3I08 A;  4PUI A;  4JI7 C;  4JI2 C;  4I9F A;  1XMQ C;  3VNQ A;  1V25 A;  4X65 C;  3J81 D;  4IZ6 A;  4PRO C;  1FJG C;  3IPL A;  3K6R A;  2KZ0 A;  4GKK C;  1VLA A;  2D27 A;  2M5O A;  1N2F A;  4YY3 C;  1XS3 A;  4DCV A;  2V7B A;  2OPL A;  2OBV A;  2D1R A;  1BA3 A;  4DG9 A;  1K0R A;  1MXC A;  3UZ0 A;  4LF8 C;  3GR1 A;  3O2E A;  3TDE A;  3KXW A;  5AE3 A;  1O90 A;  3OTO C;  4LF6 C;  4NDN A;  1USP A;  5JRH A;  4IR7 A;  2ASB A;  2UUC C;  1PG4 A;  1MDB A;  2VQF C;  3IEV A;  4FTF A;  4NOZ A;  1XNQ C;  1O9T A;  3DHV A;  3UOW A;  4DV6 C;  1HH2 P;  4D56 A;  2DPL A;  2DYJ A;  4L4Q A;  2Y4N A;  3RG2 A;  1HNZ C;  1N34 C;  4DR5 C;  3VNS A;  4DV4 C;  4I9G A;  1EGA A;  1VEH A;  3A9V A;  4DUY C; 
#chains in the Genus database with same CATH homology
 5BST A;  5KEI A;  4LE5 A;  4BCA A;  4G36 A;  2KZF A;  4HPV A;  3JAM D;  2CY1 A;  3J80 D;  2YCB A;  1P7L A;  1RG9 A;  3CW9 A;  5A2Q D;  5A19 A;  1ULT A;  4G37 A;  1AMU A;  1XMO C;  4NXM C;  4GS5 A;  3LGX A;  2JMP A;  4LFA C;  1L2F A;  1XRB A;  3CW8 X;  2Y27 A;  1JOS A;  5KYV A;  5BUQ A;  2D7V A;  4NXN C;  4R1M A;  3N54 B;  4X62 C;  3DAY A;  4XX2 A;  1PG3 A;  4RVO A;  2P20 A;  3C5E A;  3R9X A;  4JI1 C;  3NYQ A;  3I07 A;  3VNR A;  4DR6 C;  4JI0 C;  1ZB8 A;  1IBM C;  4U5Y D;  4PZP A;  4RVN A;  1QM4 A;  1XRC A;  4JM1 A;  2D28 C;  3IEU A;  3L95 X;  4L7I A;  2QVY X;  4MH4 A;  3LUS A;  4ZJZ A;  2E0G A;  1MXA A;  2BJO A;  2D1Q A;  4JI8 C;  4GXQ A;  1J5E C;  2PT7 G;  4X66 C;  4L2Z A;  4D57 A;  1UKK A;  2E5L C;  3IML A;  2YWC A;  4JV5 C;  3DLP X;  5A1I A;  4R1L A;  4DR4 C;  1N32 C;  4RMN A;  3EER A;  2D1S A;  2P2Q A;  3E7W A;  2VQE C;  4PHT A;  3CJE A;  5T8T A;  4LFB C;  5IWA C;  3GKU A;  4B3T C;  4KTV A;  4BC7 A;  1LCI A;  1MD9 A;  4B3M C;  5A1G A;  4DV1 C;  2AYA A;  3NI2 A;  4OYC A;  2OPL B;  2HJG A;  2PN2 A;  4AQY C;  1IBK C;  1XNR C;  2QVZ X;  5K8F A;  4FUQ A;  4ISB A;  4JI6 C;  3SO4 A;  1T5H X;  1LQL A;  1USP B;  1YJ7 A;  1O93 A;  3E7X A;  4DV0 C;  2P2F A;  4LFC C;  1I94 C;  2WD9 A;  4DCT A;  4KHP C;  2E8E A;  1V26 A;  1T5D X;  4RM2 A;  4D4G A;  3LNV A;  1HNW C;  1O92 A;  3L8C A;  1HNX C;  4K0B A;  4TPS B;  2VSQ A;  4DV7 C;  5BSW A;  2D1T A;  2ONF A;  3T1Y C;  1IBL C;  4EAT A;  5K85 A;  4JI4 C;  1KKG A;  3AF5 A;  5AE1 A;  3B7W A;  1N36 C;  2BH1 X;  4DG8 A;  4DR7 C;  4MTN A;  5ADZ A;  5BSM A;  2UUA C;  5E7Q A;  2PRO A;  5FLX D;  4LF4 C;  5BSV A;  4DV2 C;  3PRO C;  4D4I A;  5IT9 D;  3NYR A;  4RLQ A;  4WV3 A;  5LMN C;  4BSZ A;  3NPD A;  2UXB C;  3LAX A;  4RLF A;  2OO4 A;  3PES A;  4OXI A;  5IFI A;  2P2M A;  2P02 A;  4LF7 C;  2XR1 A;  2P2J A;  2UU9 C;  4R0M A;  3A9U A;  1NYE A;  1FUG A;  4BBY A;  4B3S C;  3FCE A;  5CZV A;  3TQI A;  1WH9 A;  4DV3 C;  4OX9 C;  3H2T A;  2VZE A;  2EGT A;  2HHH C;  4X64 C;  2CXC A;  4GXR A;  3AF6 A;  3R9W A;  4BC9 A;  2E8C A;  5BSR A;  4KTT A;  5BUR A;  4LF5 C;  5DV9 A;  1N33 C;  2YWB A;  2F4V C;  3R44 A;  5BR8 C;  5GTD A;  4DR1 C;  2QW0 X;  1ZB9 A;  2P2B A;  3GR0 A;  4ZLP A;  4DUZ C;  3A4I A;  2UUB C;  2E8F A;  2QVX X;  1QWI A;  3N2Q A;  1GPM A;  2E7G A;  5CZX A;  3ETO A;  4LF9 C;  2ATW A;  3PBK A;  4RM3 A;  4JI3 C;  5T8S A;  1MXB A;  2QL8 A;  5BSU A;  4B3R C;  2WP0 C;  5BUS A;  3T1H C;  2Y4O A;  3TUF A;  4JI5 C;  4JYA C;  1PA4 A;  1MKY A;  3FCC A;  4GKJ C;  2ZM6 C;  4ODJ A;  4DV5 C;  1ML8 A;  3G7S A;  4YHH C;  3EQ6 A;  3S82 A;  2UXD C;  4DR2 C;  3RV2 A;  4DCU A;  3ETC A;  1MDF A;  5H9U A;  1WF3 A;  2UXC C;  5LMU C;  5KYT A;  4DR3 C;  4WS9 A;  5AE2 A;  1XRA A;  1RY2 A;  3GPC A;  1HR0 C;  4K0K C;  4DCS A;  4G1I A;  4FUT A;  3I08 A;  4JI7 C;  4JI2 C;  4I9F A;  1XMQ C;  3VNQ A;  1V25 A;  4X65 C;  3J81 D;  4IZ6 A;  4PRO C;  1FJG C;  3IPL A;  4GKK C;  1VLA A;  2D27 A;  1N2F A;  4YY3 C;  4DCV A;  2V7B A;  2OPL A;  2OBV A;  2D1R A;  1BA3 A;  4DG9 A;  1K0R A;  1MXC A;  3UZ0 A;  4LF8 C;  3GR1 A;  3TDE A;  3KXW A;  3OTO C;  1O90 A;  5AE3 A;  4LF6 C;  4NDN A;  1USP A;  5JRH A;  4IR7 A;  2ASB A;  2UUC C;  1PG4 A;  1MDB A;  2VQF C;  3IEV A;  4FTF A;  4NOZ A;  1XNQ C;  1O9T A;  3DHV A;  3UOW A;  4DV6 C;  1HH2 P;  4D56 A;  2DPL A;  2DYJ A;  4L4Q A;  2Y4N A;  3RG2 A;  1HNZ C;  1N34 C;  4DR5 C;  3VNS A;  4DV4 C;  4I9G A;  1EGA A;  3A9V A;  4DUY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...