3LAXA

The crystal structure of a domain of phenylacetate-coenzyme a ligase from bacteroides vulgatus atcc 8482
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
106
Chain Sequence
SNADDMIILKGVNIFPIQIETILLQFKELGSDYLITLETAESNDEMTVEVELSQLFTDDYGRLQALTREITRQLKDEILVTPRVKLVPKGALPKSAVRVKDLRKTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phenylacetate-coenzyme A ligase
publication title The crystal structure of a domain of phenylacetate-coenzyme A ligase from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus
molecule tags Ligase
total genus 28
structure length 106
sequence length 109
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3laxA00
2QVZX 5GTDA 5DV9A 3PBKA 3RG2A 5KEIA 2D1RA 5BUSA 1PG3A 2D1QA 5BURA 2Y27A 5BUQA 2WD9A 2QVYX 3B7WA 3CW8X 5K85A 1LCIA 4D4IA 4PZPA 3ETCA 5KYVA 4RLFA 3GPCA 3A9UA 3VNQA 3IPLA 3A9VA 4G37A 2Y4OA 2P2BA 3FCCA 4DG8A 4OXIA 4RMNA 2D1SA 3G7SA 3E7XA 5BSVA 4RVOA 1AMUA 4GXQA 4ZJZA 3EQ6A 3LNVA 2QVXX 3L8CA 5KYTA 2VZEA 2P2JA 3E7WA 4IR7A 4R0MA 4FUQA 2P2QA 4RM2A 4RVNA 2P2FA 3NI2A 4GS5A 3NYQA 4D4GA 5E7QA 5BSMA 1YJ7A 4OYCA 3VNSA 5BSTA 2VSQA 1PG4A 4WV3A 4RLQA 1BA3A 4D56A 1MD9A 4R1LA 3LAXA 5BSUA 1RY2A 1T5HX 3DAYA 2P2MA 4D57A 4GXRA 4R1MA 5IFIA 3FCEA 3NYRA 2V7BA 4DG9A 5JRHA 3KXWA 4IZ6A 4RM3A 1ULTA 3R44A 1MDFA 5BSWA 2Y4NA 1T5DX 3C5EA 2D1TA 2P20A 4EATA 5K8FA 4FUTA 4ISBA 3DLPX 5BSRA 1MDBA 2QW0X 3LGXA 4G36A 3VNRA 3CW9A 4U5YD 3DHVA
chains in the Genus database with same CATH superfamily
2QVZX 5GTDA 1XRBA 2D1RA 5BUSA 1V26A 4B3MC 1MXAA 3N2QA 1EGAA 1N34C 4JYAC 5CZVA 3O2EA 3CW8X 3N54B 3CQ1A 4JI5C 4BSZA 2AYAA 3ETCA 4LF5C 2OPLB 2D28C 2NCLA 3GPCA 1UWDA 3A9VA 4G37A 5FLXD 4X65C 2Y4OA 3FCCA 4YHHC 4L2ZA 2MM9A 4PROC 3LNOA 4DR6C 1MKYA 2UXCC 1AMUA 4GXQA 1XMQC 1ML8A 1UKKA 2E7GA 2PT7G 1XRAA 3A25A 3L8CA 3AF5A 1USPB 4DR4C 4DV7C 4I9GA 2F4VC 1WCJA 3E7WA 1IB8A 5IWAC 4R0MA 1K0RA 4RM2A 5AE2A 4DV2C 4JI7C 2P2FA 1QM4A 5BSMA 3CQ2A 2BH1X 5IT9D 1JOSA 1V60A 1M6XA 1HNZC 4BC7A 2VSQA 3NPDA 2E8FA 4RLQA 5LCIA 1HNWC 3A4IA 4D56A 4NDNA 4YY3C 1RY2A 2EGTA 4JI6C 2YCBA 2UUCC 3L95X 2P2MA 2OPLA 3OTOC 1O9TA 5IFIA 2CXCA 3FCEA 5BR8C 1WH9A 3KXWA 3A26A 4LF8C 1ULTA 4PUIA 5T8SA 5CZXA 5H9UA 2KZ0A 2P20A 5K8FA 4FTFA 4I9FA 4NXMC 4JI4C 2PN2A 5DV9A 1USPA 2YX1A 4TPSB 5KEIA 4DV1C 2QL8A 1PG3A 3J80D 4JI1C 1V25A 2KZFA 2WD9A 2QVYX 4K0BA 2XR1A 4X66C 5A1IA 4DV0C 4PZPA 1IBKC 4DCVA 5KYVA 4RLFA 3A9UA 3VNQA 2E8CA 3TDEA 2KDNA 2P2BA 2MCQA 1RG9A 4LFCC 4OXIA 4JI8C 4RMNA 4DV5C 1P4EA 5AE3A 4WS9A 4ZJZA 1I94C 1N36C 1NY8A 2DYJA 5KYTA 3JAMD 3AF6A 3UZ0A 2M5OA 2VZEA 2P2JA 4KTTA 4KHPC 3T1HC 1IBMC 4B3RC 4L7IA 1XS3A 4BBYA 4GS5A 3UX3A 3NYQA 4BCAA 4D4GA 3UEBA 4XX2A 2M5HA 5LMUC 3VNSA 1PG4A 3CQ3A 3IMLA 3R9WA 1J5EC 3GKUA 3SO4A 3LAXA 4LF4C 5BSUA 4JI3C 2UXDC 3TR3A 3GR0A 1T5HX 4GXRA 4R1MA 1NYEA 4DR7C 4DG9A 1PA4A 1HNXC 1GPMA 2CY1A 4IZ6A 1MXBA 1VEHA 1FUGA 4RM3A 1TH5A 1XNRC 2E8EA 2YWCA 4MTNA 4DUZC 1XRCA 3TQIA 3LGXA 3VNRA 3CW9A 3DHVA 3PBKA 4G1IA 1ZB8A 2BJOA 4LE5A 5AE1A 4DCTA 2D1QA 1O93A 1LQLA 2Z51A 5BURA 2Y27A 5BUQA 3B7WA 4BC9A 4D4IA 3ETOA 4DCUA 4DR5C 1XNQC 3IPLA 3CJEA 4JI0C 1L2FA 4DG8A 1HH2P 1O90A 4ZLPA 2ASBA 5A2QD 2D1SA 4PUGA 2UU9C 1HR0C 5BSVA 4RVOA 1MXCA 2HHHC 3EQ6A 3LNVA 2OO4A 2WP0C 1FLOA 2UXBC 2JMPA 2YWBA 4FUQA 4L4QA 2P2QA 1KKGA 5LMNC 1P4EC 3TUFA 5E7QA 3K6RA 4GKJC 1YJ7A 4OYCA 1QWIA 5BSTA 4B3SC 1BA3A 3EERA 1MD9A 2ZZNA 4D57A 1IBLC 4JV5C 3R44A 2CU6A 4X64C 2ZM6C 3C5EA 3R9XA 1PU1A 2UUBC 3DLPX 2OBVA 1MDBA 5BSRA 4LF6C 3H2TA 3AY0A 4U5YD 3DAYA 3S82A 1N33C 1N2FA 4NXNC 2DHMA 2UUAC 2ZZMA 3RG2A 2PROA 2D7VA 2ONFA 5A19A 4MH4A 1M6XC 2E0GA 3GR1A 2ATWA 2P02A 4KTVA 5K85A 3I07A 1LCIA 1O92A 3UOWA 2E5LC 3IEUA 4LFBC 3RV2A 5ADZA 4AQYC 3G7SA 4K0KC 3E7XA 4NOZA 4DV3C 4OX9C 2QVXX 1P7LA 4ODJA 3LUSA 4PHTA 4IR7A 4DCSA 3PROC 2DPLA 1FJGC 4RVNA 3I08A 3NI2A 2VQEC 3T1YC 1ZB9A 4DR1C 4DR3C 1N32C 4JI2C 4GKKC 1XHJA 2VQFC 2D27A 4WV3A 4X62C 4DR2C 3PESA 4DUYC 4R1LA 4PUHA 3J81D 4LF7C 4LFAC 4JM1A 5T8TA 3UX2A 3NYRA 4DV6C 2V7BA 1VLAA 5JRHA 2MMAB 5A1GA 1MDFA 5BSWA 2HJGA 2Y4NA 1T5DX 2D1TA 4B3TC 4EATA 4LF9C 4FUTA 4ISBA 3IEVA 2QW0X 1XMOC 4G36A 4HPVA 2JNVA 4DV4C 1WF3A
chains in the Genus database with same CATH topology
2QVZX 5GTDA 1XRBA 2D1RA 5BUSA 1V26A 4B3MC 1MXAA 3N2QA 1EGAA 1N34C 4JYAC 5CZVA 3CW8X 3N54B 4JI5C 4BSZA 2AYAA 3ETCA 4LF5C 2OPLB 2D28C 3GPCA 3A9VA 4G37A 5FLXD 4X65C 2Y4OA 3FCCA 4YHHC 4L2ZA 4PROC 4DR6C 1MKYA 2UXCC 1AMUA 4GXQA 1XMQC 1ML8A 1UKKA 2E7GA 2PT7G 1XRAA 3L8CA 3AF5A 1USPB 4DR4C 4DV7C 4I9GA 2F4VC 3E7WA 5IWAC 4R0MA 1K0RA 4RM2A 5AE2A 4DV2C 4JI7C 2P2FA 1QM4A 5BSMA 2BH1X 5IT9D 1JOSA 1HNZC 4BC7A 2VSQA 3NPDA 2E8FA 4RLQA 1HNWC 3A4IA 4D56A 4NDNA 4YY3C 1RY2A 2EGTA 4JI6C 2YCBA 2UUCC 3L95X 2P2MA 2OPLA 3OTOC 1O9TA 5IFIA 2CXCA 3FCEA 5BR8C 1WH9A 3KXWA 4LF8C 1ULTA 5T8SA 5CZXA 5H9UA 2P20A 5K8FA 4FTFA 4I9FA 4NXMC 4JI4C 2PN2A 5DV9A 1USPA 4TPSB 5KEIA 4DV1C 2QL8A 1PG3A 3J80D 4JI1C 1V25A 2KZFA 2WD9A 2QVYX 4K0BA 2XR1A 4X66C 5A1IA 4DV0C 4PZPA 1IBKC 4DCVA 5KYVA 4RLFA 3A9UA 3VNQA 2E8CA 3TDEA 2P2BA 1RG9A 4LFCC 4OXIA 4JI8C 4RMNA 4DV5C 5AE3A 4WS9A 4ZJZA 1I94C 1N36C 2DYJA 5KYTA 3JAMD 3AF6A 3UZ0A 2VZEA 2P2JA 4KTTA 4KHPC 3T1HC 1IBMC 4B3RC 4L7IA 4BBYA 4GS5A 3NYQA 4BCAA 4D4GA 4XX2A 5LMUC 3VNSA 1PG4A 3IMLA 3R9WA 1J5EC 3GKUA 3SO4A 3LAXA 4LF4C 5BSUA 4JI3C 2UXDC 3GR0A 1T5HX 4GXRA 4R1MA 1NYEA 4DR7C 4DG9A 1PA4A 1HNXC 1GPMA 2CY1A 4IZ6A 1MXBA 4RM3A 1FUGA 1XNRC 2E8EA 2YWCA 4MTNA 4DUZC 1XRCA 3TQIA 3LGXA 3VNRA 3CW9A 3DHVA 3PBKA 4G1IA 1ZB8A 2BJOA 4LE5A 5AE1A 4DCTA 2D1QA 1O93A 1LQLA 5BURA 2Y27A 5BUQA 3B7WA 4BC9A 4D4IA 3ETOA 4DCUA 4DR5C 1XNQC 3IPLA 3CJEA 4JI0C 1L2FA 4DG8A 1HH2P 1O90A 4ZLPA 2ASBA 5A2QD 2D1SA 2UU9C 1HR0C 5BSVA 4RVOA 1MXCA 2HHHC 3EQ6A 3LNVA 2OO4A 2WP0C 2UXBC 2JMPA 2YWBA 4FUQA 4L4QA 2P2QA 1KKGA 5LMNC 3TUFA 5E7QA 4GKJC 1YJ7A 4OYCA 1QWIA 5BSTA 4B3SC 1BA3A 3EERA 1MD9A 4D57A 1IBLC 4JV5C 3R44A 4X64C 2ZM6C 3C5EA 3R9XA 2UUBC 3DLPX 2OBVA 1MDBA 5BSRA 4LF6C 3H2TA 4U5YD 3DAYA 3S82A 1N33C 1N2FA 4NXNC 2UUAC 3RG2A 2PROA 2D7VA 2ONFA 5A19A 4MH4A 2E0GA 3GR1A 2ATWA 2P02A 4KTVA 5K85A 3I07A 1LCIA 1O92A 3UOWA 2E5LC 3IEUA 4LFBC 3RV2A 5ADZA 4AQYC 3G7SA 4K0KC 3E7XA 4NOZA 4DV3C 4OX9C 2QVXX 1P7LA 4ODJA 3LUSA 4PHTA 4IR7A 4DCSA 3PROC 2DPLA 1FJGC 4RVNA 3I08A 3NI2A 2VQEC 3T1YC 1ZB9A 4DR1C 4DR3C 1N32C 4JI2C 4GKKC 2VQFC 2D27A 4WV3A 4X62C 4DR2C 3PESA 4DUYC 4R1LA 3J81D 4LF7C 4LFAC 4JM1A 5T8TA 3NYRA 4DV6C 2V7BA 1VLAA 5JRHA 5A1GA 1MDFA 5BSWA 2HJGA 2Y4NA 1T5DX 2D1TA 4B3TC 4EATA 4LF9C 4FUTA 4ISBA 3IEVA 2QW0X 1XMOC 4G36A 4HPVA 4DV4C 1WF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVZ X;  5GTD A;  5DV9 A;  3PBK A;  3RG2 A;  5KEI A;  2D1R A;  5BUS A;  1PG3 A;  2D1Q A;  5BUR A;  2Y27 A;  5BUQ A;  2WD9 A;  2QVY X;  3B7W A;  3CW8 X;  5K85 A;  1LCI A;  4D4I A;  4PZP A;  3ETC A;  5KYV A;  4RLF A;  3GPC A;  3A9U A;  3VNQ A;  3IPL A;  3A9V A;  4G37 A;  2Y4O A;  2P2B A;  3FCC A;  4DG8 A;  4OXI A;  4RMN A;  2D1S A;  3G7S A;  3E7X A;  5BSV A;  4RVO A;  1AMU A;  4GXQ A;  4ZJZ A;  3EQ6 A;  3LNV A;  2QVX X;  3L8C A;  5KYT A;  2VZE A;  2P2J A;  3E7W A;  4IR7 A;  4R0M A;  4FUQ A;  2P2Q A;  4RM2 A;  4RVN A;  2P2F A;  3NI2 A;  4GS5 A;  3NYQ A;  4D4G A;  5E7Q A;  5BSM A;  1YJ7 A;  4OYC A;  3VNS A;  5BST A;  2VSQ A;  1PG4 A;  4WV3 A;  4RLQ A;  1BA3 A;  4D56 A;  1MD9 A;  4R1L A;  3LAX A;  5BSU A;  1RY2 A;  1T5H X;  3DAY A;  2P2M A;  4D57 A;  4GXR A;  4R1M A;  5IFI A;  3FCE A;  3NYR A;  2V7B A;  4DG9 A;  5JRH A;  3KXW A;  4IZ6 A;  4RM3 A;  1ULT A;  3R44 A;  1MDF A;  5BSW A;  2Y4N A;  1T5D X;  3C5E A;  2D1T A;  2P20 A;  4EAT A;  5K8F A;  4FUT A;  4ISB A;  3DLP X;  5BSR A;  1MDB A;  2QW0 X;  3LGX A;  4G36 A;  3VNR A;  3CW9 A;  4U5Y D;  3DHV A; 
#chains in the Genus database with same CATH topology
 2QVZ X;  5GTD A;  1XRB A;  2D1R A;  5BUS A;  1V26 A;  4B3M C;  1MXA A;  3N2Q A;  1EGA A;  1N34 C;  4JYA C;  5CZV A;  3O2E A;  3CW8 X;  3N54 B;  3CQ1 A;  4JI5 C;  4BSZ A;  2AYA A;  3ETC A;  4LF5 C;  2OPL B;  2D28 C;  2NCL A;  3GPC A;  1UWD A;  3A9V A;  4G37 A;  5FLX D;  4X65 C;  2Y4O A;  3FCC A;  4YHH C;  4L2Z A;  2MM9 A;  4PRO C;  3LNO A;  4DR6 C;  1MKY A;  2UXC C;  1AMU A;  4GXQ A;  1XMQ C;  1ML8 A;  1UKK A;  2E7G A;  2PT7 G;  1XRA A;  3A25 A;  3L8C A;  3AF5 A;  1USP B;  4DR4 C;  4DV7 C;  4I9G A;  2F4V C;  1WCJ A;  3E7W A;  1IB8 A;  5IWA C;  4R0M A;  1K0R A;  4RM2 A;  5AE2 A;  4DV2 C;  4JI7 C;  2P2F A;  1QM4 A;  5BSM A;  3CQ2 A;  2BH1 X;  5IT9 D;  1JOS A;  1V60 A;  1M6X A;  1HNZ C;  4BC7 A;  2VSQ A;  3NPD A;  2E8F A;  4RLQ A;  5LCI A;  1HNW C;  3A4I A;  4D56 A;  4NDN A;  4YY3 C;  1RY2 A;  2EGT A;  4JI6 C;  2YCB A;  2UUC C;  3L95 X;  2P2M A;  2OPL A;  3OTO C;  1O9T A;  5IFI A;  2CXC A;  3FCE A;  5BR8 C;  1WH9 A;  3KXW A;  3A26 A;  4LF8 C;  1ULT A;  4PUI A;  5T8S A;  5CZX A;  5H9U A;  2KZ0 A;  2P20 A;  5K8F A;  4FTF A;  4I9F A;  4NXM C;  4JI4 C;  2PN2 A;  5DV9 A;  1USP A;  2YX1 A;  4TPS B;  5KEI A;  4DV1 C;  2QL8 A;  1PG3 A;  3J80 D;  4JI1 C;  1V25 A;  2KZF A;  2WD9 A;  2QVY X;  4K0B A;  2XR1 A;  4X66 C;  5A1I A;  4DV0 C;  4PZP A;  1IBK C;  4DCV A;  5KYV A;  4RLF A;  3A9U A;  3VNQ A;  2E8C A;  3TDE A;  2KDN A;  2P2B A;  2MCQ A;  1RG9 A;  4LFC C;  4OXI A;  4JI8 C;  4RMN A;  4DV5 C;  1P4E A;  5AE3 A;  4WS9 A;  4ZJZ A;  1I94 C;  1N36 C;  1NY8 A;  2DYJ A;  5KYT A;  3JAM D;  3AF6 A;  3UZ0 A;  2M5O A;  2VZE A;  2P2J A;  4KTT A;  4KHP C;  3T1H C;  1IBM C;  4B3R C;  4L7I A;  1XS3 A;  4BBY A;  4GS5 A;  3UX3 A;  3NYQ A;  4BCA A;  4D4G A;  3UEB A;  4XX2 A;  2M5H A;  5LMU C;  3VNS A;  1PG4 A;  3CQ3 A;  3IML A;  3R9W A;  1J5E C;  3GKU A;  3SO4 A;  3LAX A;  4LF4 C;  5BSU A;  4JI3 C;  2UXD C;  3TR3 A;  3GR0 A;  1T5H X;  4GXR A;  4R1M A;  1NYE A;  4DR7 C;  4DG9 A;  1PA4 A;  1HNX C;  1GPM A;  2CY1 A;  4IZ6 A;  1MXB A;  1VEH A;  1FUG A;  4RM3 A;  1TH5 A;  1XNR C;  2E8E A;  2YWC A;  4MTN A;  4DUZ C;  1XRC A;  3TQI A;  3LGX A;  3VNR A;  3CW9 A;  3DHV A;  3PBK A;  4G1I A;  1ZB8 A;  2BJO A;  4LE5 A;  5AE1 A;  4DCT A;  2D1Q A;  1O93 A;  1LQL A;  2Z51 A;  5BUR A;  2Y27 A;  5BUQ A;  3B7W A;  4BC9 A;  4D4I A;  3ETO A;  4DCU A;  4DR5 C;  1XNQ C;  3IPL A;  3CJE A;  4JI0 C;  1L2F A;  4DG8 A;  1HH2 P;  1O90 A;  4ZLP A;  2ASB A;  5A2Q D;  2D1S A;  4PUG A;  2UU9 C;  1HR0 C;  5BSV A;  4RVO A;  1MXC A;  2HHH C;  3EQ6 A;  3LNV A;  2OO4 A;  2WP0 C;  1FLO A;  2UXB C;  2JMP A;  2YWB A;  4FUQ A;  4L4Q A;  2P2Q A;  1KKG A;  5LMN C;  1P4E C;  3TUF A;  5E7Q A;  3K6R A;  4GKJ C;  1YJ7 A;  4OYC A;  1QWI A;  5BST A;  4B3S C;  1BA3 A;  3EER A;  1MD9 A;  2ZZN A;  4D57 A;  1IBL C;  4JV5 C;  3R44 A;  2CU6 A;  4X64 C;  2ZM6 C;  3C5E A;  3R9X A;  1PU1 A;  2UUB C;  3DLP X;  2OBV A;  1MDB A;  5BSR A;  4LF6 C;  3H2T A;  3AY0 A;  4U5Y D;  3DAY A;  3S82 A;  1N33 C;  1N2F A;  4NXN C;  2DHM A;  2UUA C;  2ZZM A;  3RG2 A;  2PRO A;  2D7V A;  2ONF A;  5A19 A;  4MH4 A;  1M6X C;  2E0G A;  3GR1 A;  2ATW A;  2P02 A;  4KTV A;  5K85 A;  3I07 A;  1LCI A;  1O92 A;  3UOW A;  2E5L C;  3IEU A;  4LFB C;  3RV2 A;  5ADZ A;  4AQY C;  3G7S A;  4K0K C;  3E7X A;  4NOZ A;  4DV3 C;  4OX9 C;  2QVX X;  1P7L A;  4ODJ A;  3LUS A;  4PHT A;  4IR7 A;  4DCS A;  3PRO C;  2DPL A;  1FJG C;  4RVN A;  3I08 A;  3NI2 A;  2VQE C;  3T1Y C;  1ZB9 A;  4DR1 C;  4DR3 C;  1N32 C;  4JI2 C;  4GKK C;  1XHJ A;  2VQF C;  2D27 A;  4WV3 A;  4X62 C;  4DR2 C;  3PES A;  4DUY C;  4R1L A;  4PUH A;  3J81 D;  4LF7 C;  4LFA C;  4JM1 A;  5T8T A;  3UX2 A;  3NYR A;  4DV6 C;  2V7B A;  1VLA A;  5JRH A;  2MMA B;  5A1G A;  1MDF A;  5BSW A;  2HJG A;  2Y4N A;  1T5D X;  2D1T A;  4B3T C;  4EAT A;  4LF9 C;  4FUT A;  4ISB A;  3IEV A;  2QW0 X;  1XMO C;  4G36 A;  4HPV A;  2JNV A;  4DV4 C;  1WF3 A; 
#chains in the Genus database with same CATH homology
 2QVZ X;  5GTD A;  1XRB A;  2D1R A;  5BUS A;  1V26 A;  4B3M C;  1MXA A;  3N2Q A;  1EGA A;  1N34 C;  4JYA C;  5CZV A;  3CW8 X;  3N54 B;  4JI5 C;  4BSZ A;  2AYA A;  3ETC A;  4LF5 C;  2OPL B;  2D28 C;  3GPC A;  3A9V A;  4G37 A;  5FLX D;  4X65 C;  2Y4O A;  3FCC A;  4YHH C;  4L2Z A;  4PRO C;  4DR6 C;  1MKY A;  2UXC C;  1AMU A;  4GXQ A;  1XMQ C;  1ML8 A;  1UKK A;  2E7G A;  2PT7 G;  1XRA A;  3L8C A;  3AF5 A;  1USP B;  4DR4 C;  4DV7 C;  4I9G A;  2F4V C;  3E7W A;  5IWA C;  4R0M A;  1K0R A;  4RM2 A;  5AE2 A;  4DV2 C;  4JI7 C;  2P2F A;  1QM4 A;  5BSM A;  2BH1 X;  5IT9 D;  1JOS A;  1HNZ C;  4BC7 A;  2VSQ A;  3NPD A;  2E8F A;  4RLQ A;  1HNW C;  3A4I A;  4D56 A;  4NDN A;  4YY3 C;  1RY2 A;  2EGT A;  4JI6 C;  2YCB A;  2UUC C;  3L95 X;  2P2M A;  2OPL A;  3OTO C;  1O9T A;  5IFI A;  2CXC A;  3FCE A;  5BR8 C;  1WH9 A;  3KXW A;  4LF8 C;  1ULT A;  5T8S A;  5CZX A;  5H9U A;  2P20 A;  5K8F A;  4FTF A;  4I9F A;  4NXM C;  4JI4 C;  2PN2 A;  5DV9 A;  1USP A;  4TPS B;  5KEI A;  4DV1 C;  2QL8 A;  1PG3 A;  3J80 D;  4JI1 C;  1V25 A;  2KZF A;  2WD9 A;  2QVY X;  4K0B A;  2XR1 A;  4X66 C;  5A1I A;  4DV0 C;  4PZP A;  1IBK C;  4DCV A;  5KYV A;  4RLF A;  3A9U A;  3VNQ A;  2E8C A;  3TDE A;  2P2B A;  1RG9 A;  4LFC C;  4OXI A;  4JI8 C;  4RMN A;  4DV5 C;  5AE3 A;  4WS9 A;  4ZJZ A;  1I94 C;  1N36 C;  2DYJ A;  5KYT A;  3JAM D;  3AF6 A;  3UZ0 A;  2VZE A;  2P2J A;  4KTT A;  4KHP C;  3T1H C;  1IBM C;  4B3R C;  4L7I A;  4BBY A;  4GS5 A;  3NYQ A;  4BCA A;  4D4G A;  4XX2 A;  5LMU C;  3VNS A;  1PG4 A;  3IML A;  3R9W A;  1J5E C;  3GKU A;  3SO4 A;  3LAX A;  4LF4 C;  5BSU A;  4JI3 C;  2UXD C;  3GR0 A;  1T5H X;  4GXR A;  4R1M A;  1NYE A;  4DR7 C;  4DG9 A;  1PA4 A;  1HNX C;  1GPM A;  2CY1 A;  4IZ6 A;  1MXB A;  4RM3 A;  1FUG A;  1XNR C;  2E8E A;  2YWC A;  4MTN A;  4DUZ C;  1XRC A;  3TQI A;  3LGX A;  3VNR A;  3CW9 A;  3DHV A;  3PBK A;  4G1I A;  1ZB8 A;  2BJO A;  4LE5 A;  5AE1 A;  4DCT A;  2D1Q A;  1O93 A;  1LQL A;  5BUR A;  2Y27 A;  5BUQ A;  3B7W A;  4BC9 A;  4D4I A;  3ETO A;  4DCU A;  4DR5 C;  1XNQ C;  3IPL A;  3CJE A;  4JI0 C;  1L2F A;  4DG8 A;  1HH2 P;  1O90 A;  4ZLP A;  2ASB A;  5A2Q D;  2D1S A;  2UU9 C;  1HR0 C;  5BSV A;  4RVO A;  1MXC A;  2HHH C;  3EQ6 A;  3LNV A;  2OO4 A;  2WP0 C;  2UXB C;  2JMP A;  2YWB A;  4FUQ A;  4L4Q A;  2P2Q A;  1KKG A;  5LMN C;  3TUF A;  5E7Q A;  4GKJ C;  1YJ7 A;  4OYC A;  1QWI A;  5BST A;  4B3S C;  1BA3 A;  3EER A;  1MD9 A;  4D57 A;  1IBL C;  4JV5 C;  3R44 A;  4X64 C;  2ZM6 C;  3C5E A;  3R9X A;  2UUB C;  3DLP X;  2OBV A;  1MDB A;  5BSR A;  4LF6 C;  3H2T A;  4U5Y D;  3DAY A;  3S82 A;  1N33 C;  1N2F A;  4NXN C;  2UUA C;  3RG2 A;  2PRO A;  2D7V A;  2ONF A;  5A19 A;  4MH4 A;  2E0G A;  3GR1 A;  2ATW A;  2P02 A;  4KTV A;  5K85 A;  3I07 A;  1LCI A;  1O92 A;  3UOW A;  2E5L C;  3IEU A;  4LFB C;  3RV2 A;  5ADZ A;  4AQY C;  3G7S A;  4K0K C;  3E7X A;  4NOZ A;  4DV3 C;  4OX9 C;  2QVX X;  1P7L A;  4ODJ A;  3LUS A;  4PHT A;  4IR7 A;  4DCS A;  3PRO C;  2DPL A;  1FJG C;  4RVN A;  3I08 A;  3NI2 A;  2VQE C;  3T1Y C;  1ZB9 A;  4DR1 C;  4DR3 C;  1N32 C;  4JI2 C;  4GKK C;  2VQF C;  2D27 A;  4WV3 A;  4X62 C;  4DR2 C;  3PES A;  4DUY C;  4R1L A;  3J81 D;  4LF7 C;  4LFA C;  4JM1 A;  5T8T A;  3NYR A;  4DV6 C;  2V7B A;  1VLA A;  5JRH A;  5A1G A;  1MDF A;  5BSW A;  2HJG A;  2Y4N A;  1T5D X;  2D1T A;  4B3T C;  4EAT A;  4LF9 C;  4FUT A;  4ISB A;  3IEV A;  2QW0 X;  1XMO C;  4G36 A;  4HPV A;  4DV4 C;  1WF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...