3LAXA

The crystal structure of a domain of phenylacetate-coenzyme a ligase from bacteroides vulgatus atcc 8482
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
109
structure length
106
Chain Sequence
SNADDMIILKGVNIFPIQIETILLQFKELGSDYLITLETAESNDEMTVEVELSQLFTDDYGRLQALTREITRQLKDEILVTPRVKLVPKGALPKSAVRVKDLRKTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Phenylacetate-coenzyme A ligase
publication title The crystal structure of a domain of phenylacetate-coenzyme A ligase from Bacteroides vulgatus ATCC 8482
rcsb
source organism Bacteroides vulgatus
total genus 28
structure length 106
sequence length 109
ec nomenclature
pdb deposition date 2010-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14535 AMP-binding_C_2 AMP-binding enzyme C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.30 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3laxA00
1PG4A 3LAXA 1ULTA 3DHVA 3LNVA 1MDBA 4EATA 4G37A 2P2BA 2P2JA 5BURA 4U5YD 5BSTA 3RG2A 2WD9A 4ZJZA 3DLPX 3VNRA 1MDFA 4ISBA 5BSMA 1T5DX 2VSQA 3FCEA 2D1RA 3NI2A 4DG8A 5BUQA 1T5HX 4WV3A 4GXRA 3R44A 5JRHA 5BSRA 4RMNA 4DG9A 4R1MA 5KEIA 5BUSA 2QVXX 2P2FA 4GXQA 3EQ6A 5BSUA 3DAYA 3PBKA 1AMUA 2VZEA 5IFIA 3B7WA 3A9VA 3G7SA 3NYRA 1BA3A 2Y4OA 5KYTA 3NYQA 3E7XA 3VNSA 2D1SA 3IPLA 4R1LA 5BSWA 4GS5A 1PG3A 2P2QA 4D56A 4D4IA 3L8CA 4PZPA 4RVOA 2D1QA 3VNQA 3FCCA 4IR7A 3A9UA 3CW9A 4D4GA 4RM2A 4FUTA 4RVNA 4IZ6A 2Y27A 1RY2A 4RLFA 4RLQA 4FUQA 5K8FA 5E7QA 2P20A 2D1TA 5DV9A 4RM3A 4R0MA 2Y4NA 3C5EA 2QVZX 2QVYX 3GPCA 3LGXA 3ETCA 5K85A 4OXIA 5GTDA 2V7BA 2QW0X 3E7WA 5KYVA 2P2MA 3CW8X 4G36A 1LCIA 4OYCA 5BSVA 1YJ7A 4D57A 1MD9A 3KXWA
chains in the Genus database with same CATH superfamily
4BBYA 4LFCC 5ADZA 4PUGA 1QM4A 2KZFA 4G37A 2P2BA 5BURA 1P7LA 2WD9A 3DLPX 3R9XA 5BSMA 4BSZA 3JAMD 4DG8A 3IEVA 5CZXA 1T5HX 4WV3A 2UXDC 3R44A 2WP0C 5JRHA 2CXCA 4X65C 1V25A 4X66C 4MH4A 5KEIA 5AE1A 1N2FA 4DCTA 2UUBC 3UEBA 4TPSB 1XRAA 5IFIA 1MXCA 1HNXC 4LFBC 4LF8C 1L2FA 5KYTA 2QL8A 4DV0C 2JMPA 2PROA 3H2TA 5BSWA 4X62C 2UUAC 4KHPC 3CQ3A 4KTVA 2UXCC 1XMOC 2UU9C 4YY3C 3PROC 1JOSA 4RVOA 5BR8C 3A9UA 5AE3A 4RM2A 4JI1C 2YWBA 5AE2A 4I9GA 4JI2C 1N36C 4RLQA 2P20A 2D1TA 2OPLA 4DUYC 1IBMC 2E7GA 4RM3A 2MCQA 4JI3C 1O93A 4L2ZA 4DCSA 1QWIA 1V26A 5GTDA 2QW0X 1IBLC 3IEUA 2E5LC 1PA4A 3O2EA 1IBKC 1GPMA 2KZ0A 1M6XA 4K0KC 1M6XC 4OYCA 2YX1A 5A19A 1UWDA 4LF5C 1YJ7A 4D57A 4X64C 1FLOA 4JI5C 3LAXA 3DHVA 3LNVA 4EATA 4U5YD 4ISBA 5H9UA 1T5DX 1WF3A 2F4VC 2VSQA 3NPDA 4JM1A 2D1RA 2M5OA 3LNOA 4DCVA 4FTFA 4DG9A 4R1MA 4JV5C 2QVXX 3GR0A 4GXQA 2JNVA 2ONFA 3EQ6A 4G1IA 3J80D 3DAYA 2CU6A 1N32C 1USPB 1AMUA 4MTNA 2YCBA 3A9VA 3NYRA 4B3RC 4DV4C 4WS9A 4R1LA 4NDNA 4JI7C 3CQ2A 4DV7C 1FUGA 4DR7C 3N54B 2PN2A 4PZPA 3FCCA 4BCAA 4B3SC 2E0GA 3CW9A 1XRBA 4D4GA 1XRCA 2DHMA 4DR1C 3TDEA 2HJGA 2E8EA 4RLFA 5K8FA 2D28C 1XNRC 2ZZMA 2ATWA 3I07A 5DV9A 2ASBA 4DR4C 1MXAA 3GPCA 4JI8C 3ETCA 4DV2C 5K85A 4OXIA 3LUSA 3N2QA 2M5HA 3E7WA 4NXMC 3ETOA 3T1HC 1LCIA 1NYEA 2AYAA 5BSVA 1O90A 1HH2P 1UKKA 3GKUA 4XX2A 2EGTA 4YHHC 3TUFA 5A1GA 1ULTA 2P2JA 4NOZA 5BSTA 1HR0C 3AY0A 3TR3A 2OO4A 1HNWC 4L7IA 4PROC 2KDNA 3NI2A 1J5EC 1VLAA 1K0RA 5BUQA 5CZVA 1XHJA 2HHHC 4RMNA 1XMQC 5BUSA 1KKGA 2P2FA 4JYAC 3PBKA 2VZEA 1USPA 5LMUC 3UZ0A 3A26A 5T8SA 3A25A 1XS3A 5A2QD 3E7XA 1WH9A 2D1SA 3IPLA 4DCUA 4PUHA 1MXBA 4LF6C 2E8FA 4PHTA 4BC9A 1PG3A 4D4IA 3L8CA 3R9WA 1VEHA 2D1QA 4BC7A 1XNQC 4B3TC 5T8TA 1I94C 1RG9A 4JI4C 2DYJA 2ZM6C 2Y27A 1RY2A 3AF5A 4FUQA 5E7QA 4LFAC 2PT7G 1O92A 2VQEC 5LMNC 4R0MA 3T1YC 4LF9C 3CQ1A 3UOWA 2QVZX 3EERA 2QVYX 1HNZC 1MKYA 3LGXA 2OBVA 2BH1X 4HPVA 2P02A 5IWAC 2D27A 2NCLA 4JI6C 2VQFC 5FLXD 3CW8X 4G36A 4DR5C 4NXNC 1EGAA 3AF6A 4LE5A 1PG4A 2MM9A 1IB8A 4DV6C 1MDBA 1ZB9A 3PESA 3SO4A 2XR1A 2E8CA 3RG2A 4ZJZA 3VNRA 4DV1C 1MDFA 5A1IA 4PUIA 4K0BA 3FCEA 4GKJC 1N34C 4DR2C 4GXRA 5BSRA 4B3MC 1N33C 3L95X 2D7VA 3IMLA 5BSUA 4JI0C 1TH5A 3UX2A 3OTOC 4DV5C 4L4QA 4OX9C 3CJEA 1P4EA 1P4EC 4I9FA 3B7WA 3TQIA 3G7SA 2UXBC 4LF4C 1BA3A 2Y4OA 3NYQA 4ODJA 1V60A 3VNSA 4DV3C 4DR6C 5IT9D 4GS5A 2P2QA 4D56A 1ML8A 2CY1A 4LF7C 3J81D 3GR1A 3K6RA 3VNQA 2BJOA 4IR7A 1ZB8A 4FUTA 1NY8A 3RV2A 1PU1A 1O9TA 4RVNA 4ZLPA 4IZ6A 2OPLB 1WCJA 2YWCA 4DR3C 4DUZC 2Z51A 2UUCC 4AQYC 3S82A 2Y4NA 3C5EA 4GKKC 2DPLA 3I08A 2ZZNA 2V7BA 4KTTA 1FJGC 2MMAB 5KYVA 3A4IA 2P2MA 5LCIA 1LQLA 1MD9A 3KXWA 3UX3A
chains in the Genus database with same CATH topology
4BBYA 4LFCC 5ADZA 1QM4A 2KZFA 4G37A 2P2BA 5BURA 1P7LA 2WD9A 3DLPX 3R9XA 5BSMA 4BSZA 3JAMD 4DG8A 3IEVA 5CZXA 1T5HX 4WV3A 2UXDC 3R44A 2WP0C 5JRHA 2CXCA 4X65C 1V25A 4X66C 4MH4A 5KEIA 5AE1A 1N2FA 4DCTA 2UUBC 4TPSB 1XRAA 5IFIA 1MXCA 1HNXC 4LFBC 4LF8C 1L2FA 5KYTA 2QL8A 4DV0C 2JMPA 2PROA 3H2TA 5BSWA 4X62C 2UUAC 4KHPC 4KTVA 2UXCC 1XMOC 2UU9C 4YY3C 3PROC 1JOSA 4RVOA 5BR8C 3A9UA 5AE3A 4RM2A 4JI1C 2YWBA 5AE2A 4I9GA 4JI2C 1N36C 4RLQA 2P20A 2D1TA 2OPLA 4DUYC 1IBMC 2E7GA 4RM3A 4JI3C 1O93A 4L2ZA 4DCSA 1QWIA 1V26A 5GTDA 2QW0X 1IBLC 3IEUA 2E5LC 1PA4A 1IBKC 1GPMA 4K0KC 4OYCA 5A19A 4LF5C 1YJ7A 4D57A 4X64C 4JI5C 3LAXA 3DHVA 3LNVA 4EATA 4U5YD 4ISBA 5H9UA 1T5DX 1WF3A 2F4VC 2VSQA 3NPDA 4JM1A 2D1RA 4DCVA 4FTFA 4DG9A 4R1MA 4JV5C 2QVXX 3GR0A 4GXQA 3EQ6A 2ONFA 4G1IA 3J80D 3DAYA 1N32C 1USPB 1AMUA 4MTNA 2YCBA 3A9VA 3NYRA 4B3RC 4DV4C 4WS9A 4R1LA 4NDNA 4JI7C 4DV7C 1FUGA 4DR7C 3N54B 2PN2A 4PZPA 3FCCA 4BCAA 4B3SC 2E0GA 3CW9A 1XRBA 4D4GA 1XRCA 4DR1C 3TDEA 2HJGA 2E8EA 4RLFA 5K8FA 2D28C 1XNRC 2ATWA 3I07A 5DV9A 2ASBA 4DR4C 1MXAA 3GPCA 4JI8C 3ETCA 4DV2C 5K85A 4OXIA 3LUSA 3N2QA 3E7WA 4NXMC 3ETOA 3T1HC 1LCIA 1NYEA 2AYAA 5BSVA 1O90A 1HH2P 1UKKA 3GKUA 4YHHC 4XX2A 2EGTA 3TUFA 5A1GA 1ULTA 2P2JA 4NOZA 5BSTA 1HR0C 2OO4A 1HNWC 4L7IA 4PROC 3NI2A 1J5EC 1VLAA 1K0RA 5BUQA 5CZVA 2HHHC 4RMNA 1XMQC 5BUSA 1KKGA 2P2FA 4JYAC 3PBKA 2VZEA 1USPA 5LMUC 3UZ0A 5T8SA 5A2QD 3E7XA 1WH9A 2D1SA 3IPLA 4DCUA 1MXBA 4LF6C 2E8FA 4PHTA 4BC9A 1PG3A 4D4IA 3L8CA 3R9WA 2D1QA 4BC7A 1XNQC 4B3TC 5T8TA 1I94C 1RG9A 4JI4C 2DYJA 2ZM6C 2Y27A 1RY2A 3AF5A 4FUQA 5E7QA 4LFAC 2PT7G 1O92A 2VQEC 5LMNC 4R0MA 3T1YC 4LF9C 3UOWA 2QVZX 3EERA 2QVYX 1HNZC 1MKYA 3LGXA 2OBVA 2BH1X 4HPVA 2P02A 5IWAC 2D27A 4JI6C 2VQFC 5FLXD 3CW8X 4G36A 4DR5C 4NXNC 1EGAA 3AF6A 4LE5A 1PG4A 4DV6C 1MDBA 1ZB9A 3PESA 3SO4A 2XR1A 2E8CA 3RG2A 4ZJZA 3VNRA 4DV1C 1MDFA 5A1IA 4K0BA 3FCEA 4GKJC 1N34C 4DR2C 4GXRA 5BSRA 4B3MC 1N33C 3L95X 2D7VA 3IMLA 5BSUA 4JI0C 3OTOC 4DV5C 4L4QA 4OX9C 3CJEA 4I9FA 3B7WA 3TQIA 3G7SA 2UXBC 4LF4C 1BA3A 2Y4OA 3NYQA 4ODJA 3VNSA 4DV3C 4DR6C 5IT9D 4GS5A 2P2QA 4D56A 1ML8A 2CY1A 4LF7C 3J81D 3GR1A 3VNQA 2BJOA 4IR7A 1ZB8A 4FUTA 3RV2A 1O9TA 4RVNA 4ZLPA 4IZ6A 2OPLB 2YWCA 4DR3C 4DUZC 2UUCC 4AQYC 3S82A 2Y4NA 3C5EA 4GKKC 2DPLA 3I08A 2V7BA 4KTTA 1FJGC 5KYVA 3A4IA 2P2MA 1LQLA 1MD9A 3KXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PG4 A;  3LAX A;  1ULT A;  3DHV A;  3LNV A;  1MDB A;  4EAT A;  4G37 A;  2P2B A;  2P2J A;  5BUR A;  4U5Y D;  5BST A;  3RG2 A;  2WD9 A;  4ZJZ A;  3DLP X;  3VNR A;  1MDF A;  4ISB A;  5BSM A;  1T5D X;  2VSQ A;  3FCE A;  2D1R A;  3NI2 A;  4DG8 A;  5BUQ A;  1T5H X;  4WV3 A;  4GXR A;  3R44 A;  5JRH A;  5BSR A;  4RMN A;  4DG9 A;  4R1M A;  5KEI A;  5BUS A;  2QVX X;  2P2F A;  4GXQ A;  3EQ6 A;  5BSU A;  3DAY A;  3PBK A;  1AMU A;  2VZE A;  5IFI A;  3B7W A;  3A9V A;  3G7S A;  3NYR A;  1BA3 A;  2Y4O A;  5KYT A;  3NYQ A;  3E7X A;  3VNS A;  2D1S A;  3IPL A;  4R1L A;  5BSW A;  4GS5 A;  1PG3 A;  2P2Q A;  4D56 A;  4D4I A;  3L8C A;  4PZP A;  4RVO A;  2D1Q A;  3VNQ A;  3FCC A;  4IR7 A;  3A9U A;  3CW9 A;  4D4G A;  4RM2 A;  4FUT A;  4RVN A;  4IZ6 A;  2Y27 A;  1RY2 A;  4RLF A;  4RLQ A;  4FUQ A;  5K8F A;  5E7Q A;  2P20 A;  2D1T A;  5DV9 A;  4RM3 A;  4R0M A;  2Y4N A;  3C5E A;  2QVZ X;  2QVY X;  3GPC A;  3LGX A;  3ETC A;  5K85 A;  4OXI A;  5GTD A;  2V7B A;  2QW0 X;  3E7W A;  5KYV A;  2P2M A;  3CW8 X;  4G36 A;  1LCI A;  4OYC A;  5BSV A;  1YJ7 A;  4D57 A;  1MD9 A;  3KXW A; 
#chains in the Genus database with same CATH topology
 4BBY A;  4LFC C;  5ADZ A;  4PUG A;  1QM4 A;  2KZF A;  4G37 A;  2P2B A;  5BUR A;  1P7L A;  2WD9 A;  3DLP X;  3R9X A;  5BSM A;  4BSZ A;  3JAM D;  4DG8 A;  3IEV A;  5CZX A;  1T5H X;  4WV3 A;  2UXD C;  3R44 A;  2WP0 C;  5JRH A;  2CXC A;  4X65 C;  1V25 A;  4X66 C;  4MH4 A;  5KEI A;  5AE1 A;  1N2F A;  4DCT A;  2UUB C;  3UEB A;  4TPS B;  1XRA A;  5IFI A;  1MXC A;  1HNX C;  4LFB C;  4LF8 C;  1L2F A;  5KYT A;  2QL8 A;  4DV0 C;  2JMP A;  2PRO A;  3H2T A;  5BSW A;  4X62 C;  2UUA C;  4KHP C;  3CQ3 A;  4KTV A;  2UXC C;  1XMO C;  2UU9 C;  4YY3 C;  3PRO C;  1JOS A;  4RVO A;  5BR8 C;  3A9U A;  5AE3 A;  4RM2 A;  4JI1 C;  2YWB A;  5AE2 A;  4I9G A;  4JI2 C;  1N36 C;  4RLQ A;  2P20 A;  2D1T A;  2OPL A;  4DUY C;  1IBM C;  2E7G A;  4RM3 A;  2MCQ A;  4JI3 C;  1O93 A;  4L2Z A;  4DCS A;  1QWI A;  1V26 A;  5GTD A;  2QW0 X;  1IBL C;  3IEU A;  2E5L C;  1PA4 A;  3O2E A;  1IBK C;  1GPM A;  2KZ0 A;  1M6X A;  4K0K C;  1M6X C;  4OYC A;  2YX1 A;  5A19 A;  1UWD A;  4LF5 C;  1YJ7 A;  4D57 A;  4X64 C;  1FLO A;  4JI5 C;  3LAX A;  3DHV A;  3LNV A;  4EAT A;  4U5Y D;  4ISB A;  5H9U A;  1T5D X;  1WF3 A;  2F4V C;  2VSQ A;  3NPD A;  4JM1 A;  2D1R A;  2M5O A;  3LNO A;  4DCV A;  4FTF A;  4DG9 A;  4R1M A;  4JV5 C;  2QVX X;  3GR0 A;  4GXQ A;  2JNV A;  2ONF A;  3EQ6 A;  4G1I A;  3J80 D;  3DAY A;  2CU6 A;  1N32 C;  1USP B;  1AMU A;  4MTN A;  2YCB A;  3A9V A;  3NYR A;  4B3R C;  4DV4 C;  4WS9 A;  4R1L A;  4NDN A;  4JI7 C;  3CQ2 A;  4DV7 C;  1FUG A;  4DR7 C;  3N54 B;  2PN2 A;  4PZP A;  3FCC A;  4BCA A;  4B3S C;  2E0G A;  3CW9 A;  1XRB A;  4D4G A;  1XRC A;  2DHM A;  4DR1 C;  3TDE A;  2HJG A;  2E8E A;  4RLF A;  5K8F A;  2D28 C;  1XNR C;  2ZZM A;  2ATW A;  3I07 A;  5DV9 A;  2ASB A;  4DR4 C;  1MXA A;  3GPC A;  4JI8 C;  3ETC A;  4DV2 C;  5K85 A;  4OXI A;  3LUS A;  3N2Q A;  2M5H A;  3E7W A;  4NXM C;  3ETO A;  3T1H C;  1LCI A;  1NYE A;  2AYA A;  5BSV A;  1O90 A;  1HH2 P;  1UKK A;  3GKU A;  4XX2 A;  2EGT A;  4YHH C;  3TUF A;  5A1G A;  1ULT A;  2P2J A;  4NOZ A;  5BST A;  1HR0 C;  3AY0 A;  3TR3 A;  2OO4 A;  1HNW C;  4L7I A;  4PRO C;  2KDN A;  3NI2 A;  1J5E C;  1VLA A;  1K0R A;  5BUQ A;  5CZV A;  1XHJ A;  2HHH C;  4RMN A;  1XMQ C;  5BUS A;  1KKG A;  2P2F A;  4JYA C;  3PBK A;  2VZE A;  1USP A;  5LMU C;  3UZ0 A;  3A26 A;  5T8S A;  3A25 A;  1XS3 A;  5A2Q D;  3E7X A;  1WH9 A;  2D1S A;  3IPL A;  4DCU A;  4PUH A;  1MXB A;  4LF6 C;  2E8F A;  4PHT A;  4BC9 A;  1PG3 A;  4D4I A;  3L8C A;  3R9W A;  1VEH A;  2D1Q A;  4BC7 A;  1XNQ C;  4B3T C;  5T8T A;  1I94 C;  1RG9 A;  4JI4 C;  2DYJ A;  2ZM6 C;  2Y27 A;  1RY2 A;  3AF5 A;  4FUQ A;  5E7Q A;  4LFA C;  2PT7 G;  1O92 A;  2VQE C;  5LMN C;  4R0M A;  3T1Y C;  4LF9 C;  3CQ1 A;  3UOW A;  2QVZ X;  3EER A;  2QVY X;  1HNZ C;  1MKY A;  3LGX A;  2OBV A;  2BH1 X;  4HPV A;  2P02 A;  5IWA C;  2D27 A;  2NCL A;  4JI6 C;  2VQF C;  5FLX D;  3CW8 X;  4G36 A;  4DR5 C;  4NXN C;  1EGA A;  3AF6 A;  4LE5 A;  1PG4 A;  2MM9 A;  1IB8 A;  4DV6 C;  1MDB A;  1ZB9 A;  3PES A;  3SO4 A;  2XR1 A;  2E8C A;  3RG2 A;  4ZJZ A;  3VNR A;  4DV1 C;  1MDF A;  5A1I A;  4PUI A;  4K0B A;  3FCE A;  4GKJ C;  1N34 C;  4DR2 C;  4GXR A;  5BSR A;  4B3M C;  1N33 C;  3L95 X;  2D7V A;  3IML A;  5BSU A;  4JI0 C;  1TH5 A;  3UX2 A;  3OTO C;  4DV5 C;  4L4Q A;  4OX9 C;  3CJE A;  1P4E A;  1P4E C;  4I9F A;  3B7W A;  3TQI A;  3G7S A;  2UXB C;  4LF4 C;  1BA3 A;  2Y4O A;  3NYQ A;  4ODJ A;  1V60 A;  3VNS A;  4DV3 C;  4DR6 C;  5IT9 D;  4GS5 A;  2P2Q A;  4D56 A;  1ML8 A;  2CY1 A;  4LF7 C;  3J81 D;  3GR1 A;  3K6R A;  3VNQ A;  2BJO A;  4IR7 A;  1ZB8 A;  4FUT A;  1NY8 A;  3RV2 A;  1PU1 A;  1O9T A;  4RVN A;  4ZLP A;  4IZ6 A;  2OPL B;  1WCJ A;  2YWC A;  4DR3 C;  4DUZ C;  2Z51 A;  2UUC C;  4AQY C;  3S82 A;  2Y4N A;  3C5E A;  4GKK C;  2DPL A;  3I08 A;  2ZZN A;  2V7B A;  4KTT A;  1FJG C;  2MMA B;  5KYV A;  3A4I A;  2P2M A;  5LCI A;  1LQL A;  1MD9 A;  3KXW A;  3UX3 A; 
#chains in the Genus database with same CATH homology
 4BBY A;  4LFC C;  5ADZ A;  1QM4 A;  2KZF A;  4G37 A;  2P2B A;  5BUR A;  1P7L A;  2WD9 A;  3DLP X;  3R9X A;  5BSM A;  4BSZ A;  3JAM D;  4DG8 A;  3IEV A;  5CZX A;  1T5H X;  4WV3 A;  2UXD C;  3R44 A;  2WP0 C;  5JRH A;  2CXC A;  4X65 C;  1V25 A;  4X66 C;  4MH4 A;  5KEI A;  5AE1 A;  1N2F A;  4DCT A;  2UUB C;  4TPS B;  1XRA A;  5IFI A;  1MXC A;  1HNX C;  4LFB C;  4LF8 C;  1L2F A;  5KYT A;  2QL8 A;  4DV0 C;  2JMP A;  2PRO A;  3H2T A;  5BSW A;  4X62 C;  2UUA C;  4KHP C;  4KTV A;  2UXC C;  1XMO C;  2UU9 C;  4YY3 C;  3PRO C;  1JOS A;  4RVO A;  5BR8 C;  3A9U A;  5AE3 A;  4RM2 A;  4JI1 C;  2YWB A;  5AE2 A;  4I9G A;  4JI2 C;  1N36 C;  4RLQ A;  2P20 A;  2D1T A;  2OPL A;  4DUY C;  1IBM C;  2E7G A;  4RM3 A;  4JI3 C;  1O93 A;  4L2Z A;  4DCS A;  1QWI A;  1V26 A;  5GTD A;  2QW0 X;  1IBL C;  3IEU A;  2E5L C;  1PA4 A;  1IBK C;  1GPM A;  4K0K C;  4OYC A;  5A19 A;  4LF5 C;  1YJ7 A;  4D57 A;  4X64 C;  4JI5 C;  3LAX A;  3DHV A;  3LNV A;  4EAT A;  4U5Y D;  4ISB A;  5H9U A;  1T5D X;  1WF3 A;  2F4V C;  2VSQ A;  3NPD A;  4JM1 A;  2D1R A;  4DCV A;  4FTF A;  4DG9 A;  4R1M A;  4JV5 C;  2QVX X;  3GR0 A;  4GXQ A;  3EQ6 A;  2ONF A;  4G1I A;  3J80 D;  3DAY A;  1N32 C;  1USP B;  1AMU A;  4MTN A;  2YCB A;  3A9V A;  3NYR A;  4B3R C;  4DV4 C;  4WS9 A;  4R1L A;  4NDN A;  4JI7 C;  4DV7 C;  1FUG A;  4DR7 C;  3N54 B;  2PN2 A;  4PZP A;  3FCC A;  4BCA A;  4B3S C;  2E0G A;  3CW9 A;  1XRB A;  4D4G A;  1XRC A;  4DR1 C;  3TDE A;  2HJG A;  2E8E A;  4RLF A;  5K8F A;  2D28 C;  1XNR C;  2ATW A;  3I07 A;  5DV9 A;  2ASB A;  4DR4 C;  1MXA A;  3GPC A;  4JI8 C;  3ETC A;  4DV2 C;  5K85 A;  4OXI A;  3LUS A;  3N2Q A;  3E7W A;  4NXM C;  3ETO A;  3T1H C;  1LCI A;  1NYE A;  2AYA A;  5BSV A;  1O90 A;  1HH2 P;  1UKK A;  3GKU A;  4YHH C;  4XX2 A;  2EGT A;  3TUF A;  5A1G A;  1ULT A;  2P2J A;  4NOZ A;  5BST A;  1HR0 C;  2OO4 A;  1HNW C;  4L7I A;  4PRO C;  3NI2 A;  1J5E C;  1VLA A;  1K0R A;  5BUQ A;  5CZV A;  2HHH C;  4RMN A;  1XMQ C;  5BUS A;  1KKG A;  2P2F A;  4JYA C;  3PBK A;  2VZE A;  1USP A;  5LMU C;  3UZ0 A;  5T8S A;  5A2Q D;  3E7X A;  1WH9 A;  2D1S A;  3IPL A;  4DCU A;  1MXB A;  4LF6 C;  2E8F A;  4PHT A;  4BC9 A;  1PG3 A;  4D4I A;  3L8C A;  3R9W A;  2D1Q A;  4BC7 A;  1XNQ C;  4B3T C;  5T8T A;  1I94 C;  1RG9 A;  4JI4 C;  2DYJ A;  2ZM6 C;  2Y27 A;  1RY2 A;  3AF5 A;  4FUQ A;  5E7Q A;  4LFA C;  2PT7 G;  1O92 A;  2VQE C;  5LMN C;  4R0M A;  3T1Y C;  4LF9 C;  3UOW A;  2QVZ X;  3EER A;  2QVY X;  1HNZ C;  1MKY A;  3LGX A;  2OBV A;  2BH1 X;  4HPV A;  2P02 A;  5IWA C;  2D27 A;  4JI6 C;  2VQF C;  5FLX D;  3CW8 X;  4G36 A;  4DR5 C;  4NXN C;  1EGA A;  3AF6 A;  4LE5 A;  1PG4 A;  4DV6 C;  1MDB A;  1ZB9 A;  3PES A;  3SO4 A;  2XR1 A;  2E8C A;  3RG2 A;  4ZJZ A;  3VNR A;  4DV1 C;  1MDF A;  5A1I A;  4K0B A;  3FCE A;  4GKJ C;  1N34 C;  4DR2 C;  4GXR A;  5BSR A;  4B3M C;  1N33 C;  3L95 X;  2D7V A;  3IML A;  5BSU A;  4JI0 C;  3OTO C;  4DV5 C;  4L4Q A;  4OX9 C;  3CJE A;  4I9F A;  3B7W A;  3TQI A;  3G7S A;  2UXB C;  4LF4 C;  1BA3 A;  2Y4O A;  3NYQ A;  4ODJ A;  3VNS A;  4DV3 C;  4DR6 C;  5IT9 D;  4GS5 A;  2P2Q A;  4D56 A;  1ML8 A;  2CY1 A;  4LF7 C;  3J81 D;  3GR1 A;  3VNQ A;  2BJO A;  4IR7 A;  1ZB8 A;  4FUT A;  3RV2 A;  1O9T A;  4RVN A;  4ZLP A;  4IZ6 A;  2OPL B;  2YWC A;  4DR3 C;  4DUZ C;  2UUC C;  4AQY C;  3S82 A;  2Y4N A;  3C5E A;  4GKK C;  2DPL A;  3I08 A;  2V7B A;  4KTT A;  1FJG C;  5KYV A;  3A4I A;  2P2M A;  1LQL A;  1MD9 A;  3KXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...