1ZB8A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
140
Chain Sequence
SLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords organic hydroperoxide resistance protein
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
total genus 34
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb8A02
5C3EI 2QL8A 2OPLA 4A3EI 2CY1A 3HOZI 2F4MA 3S16I 4NBAA 2UU9C 3I4NI 1WCMI 4JI4C 1USPA 4DV2C 1JOSA 4A3LI 1LQLA 4DR1C 1ML8A 3VB9A 1KKGA 2OPLB 3GCFA 2ONFA 3AF5A 3GTKI 3H0GI 4NBBA 1USPB 4X62C 2UXBC 2E5LC 1WF3A 2JMPA 5CM2M 3IEVA 1IBLC 4A3FI 1DL6A 4A3JI 4NBFA 4DR4C 1UKKA 5C4JI 2UUAC 2K5RA 4BY1I 4JI1C 1L2FA 4MH4A 3S1RI 5IWAC 1XNQC 1TWFI 2XR1A 4LF8C 1R9TI 1XMQC 2VQEC 1PA4A 4JI3C 4DV7C 1I50I 3VMIA 2KZFA 3VMHA 3S2HI 5IT9D 3GKUA 2PT7G 4B3RC 2E8CA 1X3ZA 4X6AI 4JI8C 1HH2P 2JA5I 4DV5C 4JI0C 4DR6C 3CQZI 3S15I 2E8FA 4JI2C 3GTOI 2B63I 3M3YI 4X64C 3S1NI 4DCVA 4YY3C 2R7ZI 2BJOA 4A3CI 4B3SC 2DYJA 1RO4A 3R9XA 1X3WA 5C4XI 3AF6A 3S1QI 1NYEA 2JS4A 4Y52I 4DCSA 1I3QI 2PK7A 4DCUA 4LF9C 3CJEA 4A93I 3OTOC 1TWGI 1YUAA 3GTJI 2R92I 5A2QD 3VMGA 3GKQA 2VUMI 4OX9C 1IBKC 3T1HC 2EGTA 4DR7C 2F4VC 4A3BI 3HOUI 4JI5C 3ESWA 2NVXI 1I6HI 3PO3I 3K7AI 3GTPI 1J5EC 2NVYI 3IEUA 4LF7C 2KPIA 3EERA 2HJGA 4A3KI 3Q87A 3S2DI 4BBSI 2E2HI 5C44I 4XX2A 1QYPA 3LUSA 1IBMC 4DV0C 1FJGC 2HHHC 4A3MI 4Y7NI 1MKYA 4LF5C 3I4MI 4JYAC 4BBRI 1L1OC 2ZM6C 4DUYC 2VQFC 2R93I 2UUBC 4MTNA 4DR3C 4JV5C 4NB9A 1TWCI 2F4OA 4NBCA 5IP9I 1HNZC 3S1MI 2YU9I 4DV4C 1QWIA 4DUZC 1HR0C 4DR5C 2UXDC 3RZOI 3PO3S 1HNXC 3GTLI 3JAMD 1Y1VI 3GTMI 4LF4C 4A3GI 2E2II 4DV6C 1Y1WI 4AQYC 1TFIA 3T1YC 3RZDI 1RLYA 4GKJC 1N36C 2DE5A 5FLMI 4NBDA 4NXMC 4B3TC 1XMOC 4QTUA 3H3VJ 2UUCC 1TWAI 1N32C 1VLAA 2NVTI 4LFAC 3R9WA 3FKII 5IP7I 3HOVI 3I07A 1N33C 1EGAA 2CXCA 2E8EA 4X65C 4NBHA 1SFOI 3S14I 4KHPC 2HF1A 1I94C 4NOZA 2E7GA 5FLXD 4DCTA 2JA6I 2JA7I 1K0RA 1HNWC 2PN2A 2J6AA 3U50C 4X66C 2ASBA 2RBLA 2D7VA 4NB8A 2JR6A 4YHHC 1K83I 3GTGI 1N34C 3J81D 4LFBC 2NVQI 1ZB9A 4DR2C 3D6WA 4NBEA 2ATWA 1N2FA 5BR8C 2P3YA 4BY7I 3HOXI 1WH9A 1WW9A 4QTTA 2DE7A 4K0KC 4NBGA 1NUIA 3HOYI 4BSZA 2UXCC 3J80D 2E2JI 4LF6C 1ZB8A 2YCBA 3GTQI 5LMUC 1XNRC 1Y1VS 4LFCC 3GTMS 1TWHI 4GKKC 2AKLA 2JNYA 4JI7C 5LMNC 4B3MC 2JA8I 4JI6C 4A3II 4DV3C 3HOWI 3M4OI 1PFTA 4NXNC 4A3DI 3PO2I 4DV1C 3S17I 2DE6A 4BXXI
chains in the Genus database with same CATH superfamily
1Z02A 5C3EI 2QL8A 2OPLA 5E7QA 4A3EI 3TDHB 2OTLZ 2CY1A 5D1OA 1Z03A 3HOZI 2F4MA 3FQQA 1K731 2JIMA 3NI2A 2CU6A 3S16I 2VSQA 1P7LA 4NBAA 2UU9C 3I4NI 1VQ8Z 1YIJZ 5A2Qb 1MD9A 3IX0A 1MXBA 2M48A 3CW9A 1WCMI 2WAQA 1USPA 3CMEZ 4IR7A 4JI4C 3EQ6A 1KC82 1KQSY 2OBVA 4DV2C 1PG4A 4RM2A 1M1K2 3E7XA 3PBKA 4PZPA 1JOSA 4A3LI 5T67A 2V7BA 2QLVB 1LQLA 2VPYA 4DR1C 1ML8A 3VB9A 1KKGA 4DQYB 2OPLB 3GCFA 1Q7Y1 5IT9f 3NH8A 2ONFA 4E33A 2DHMA 5D1OB 3AY0A 5A1GA 3I55Z 1VQMZ 3AF5A 3TQIA 5BUQA 1WZNA 3H0GI 3GTKI 3CC2Z 1VQ9Z 5D1PA 4G37A 1YI21 4NBBA 2D28C 1USPB 3CCU1 4X62C 2VPWA 2QEX1 2UXBC 2NAPA 1RY2A 2NCLA 4G36A 4MD9A 2JMOA 2E5LC 2K3RA 2OTJZ 3E7WA 3L95X 2JIQA 1SIWA 3CC4Z 2D1RA 2MMAB 1W2BZ 4I9FA 1PG3A 2QRCB 2JIOA 5LCIA 1T5HX 1WF3A 5CM2M 1VQ6Z 2JMPA 4MONA 2MM9A 3IEVA 1IBLC 2OOXB 4A3FI 1DL6A 4A3JI 4NBFA 1YITZ 4DR4C 1UKKA 5C4JI 2Y4NA 3FQMA 2UUAC 2K5RA 4BY1I 1XS3A 4JI1C 3LNVA 1VQM1 1L2FA 4MH4A 3S1RI 5IWAC 1XNQC 3I56Z 1VQ41 1TWFI 2XR1A 4LF8C 1R9TI 2Q51A 4PUHA 2AYDA 3CPWY 5A1IA 1XMQC 3CC21 2P2QA 1KRLA 4I9GA 4DK1A 1PA4A 3J81b 3VNQA 2VQEC 1LCIA 4FUQA 4JI3C 1Q812 1I50I 4DV7C 3NDIA 1X0TA 3VMIA 2KZFA 4RMNA 3RV2A 3VMHA 1VQNZ 3S2HI 5IT9D 3P5JB 3GKUA 1P4EC 5K8FA 3CC41 1O90A 1T5DX 2PT7G 3CCQZ 1ULTA 4B3RC 2QRDB 5AN9F 3CQ2A 1RO0A 2E8CA 1X3ZA 4X6AI 4JI8C 1YUKA 4DGLA 2WD9A 1YIT1 1HH2P 2JA5I 4E31A 4JYAC 4BBYA 4DV5C 3CC7Z 4JI0C 4E30A 4MD7A 5A2Qf 1PU1A 2KI7B 3CXCZ 4DR6C 3CQZI 3G6EZ 1Q862 3EEDA 3S15I 3VNSA 1VQ7Z 2E8FA 2E9HA 2DPLA 4JI2C 4R1MA 3GTOI 3NH4A 1V26A 2B63I 3KIHA 3M3YI 1XHJA 4PHTA 4X64C 4D4GA 3CCEZ 2P2JA 4NDNA 3OW2Y 3CCS1 1M6XC 3A25A 2WB1A 3L8CA 3C5EA 3S1NI 4DCVA 4YY3C 3NYRA 1O92A 1VEHA 3CQ1A 3UX2A 2PM9A 2R7ZI 4GXRA 1FDIA 1K8A1 1KD12 2LIYA 2BJOA 3CCQ1 2GTHA 3R44A 3DAYA 5BSTA 4A3CI 2JIRA 4B3SC 4RVDA 2DYJA 3FCEA 1RO4A 2QKDA 3R9XA 1X3WA 2IV2X 1P4EA 5C4XI 4E32A 3CC71 3S1QI 4L2ZA 2HU9A 3AF6A 1YJ7A 4RVNA 2PROA 1NYEA 1YJ91 1NJI1 3CW8X 3S82A 1N8R1 2JS4A 3G6E1 4Y52I 2Y0SA 1VQ71 4DCSA 1I3QI 1KQSZ 2PK7A 4G1IA 1WJ2A 3JAMb 1YI2Z 2P28A 4DCUA 2V8IA 3CCUZ 1Q861 2QEXZ 3CCE1 1M902 4LF9C 3CJEA 4KTVA 2Q4ZA 1RQFA 4A93I 3OTOC 3DLPX 3GR0A 1TWGI 1NP6A 2AYAA 1YUAA 3GTJI 2R92I 2VF1A 4MXUA 1IB8A 5A2QD 3VMGA 3GKQA 2VUMI 1M6XA 4OX9C 5KEIA 1KD11 1IBKC 3IMLA 5BSVA 4MD8A 3T1HC 3UZ0A 2P20A 2EGTA 5DV9A 3BG0B 3A26A 2I3CA 2F4VC 4A3BI 4DR7C 3HOUI 5BUSA 4JI5C 1VQ4Z 4L4QA 1Q16A 1WCJA 4L7IA 3ESWA 2KDNA 2NVXI 3CCR1 3G7SA 4ZJZA 4HGZA 1JJ2Y 2M5OA 4D56A 3RG2A 4RV9A 3CCVZ 4OYCA 1I6HI 3PO3I 1O93A 3K7AI 2RHBA 3GTPI 1J5EC 3NDJA 2NVYI 1FLOA 2V8KA 1MXCA 2GU2A 1KC81 3IEUA 1YHQ1 1M1K1 4LF7C 1RG9A 2KPIA 5FLXb 3EERA 5T64A 2HJGA 1QM4A 1AMUA 1K9M2 4IZ6A 4DG8A 3CPWZ 1XRCA 5BSMA 4A3KI 3Q87A 3S2DI 4BBSI 2O4HA 2E2HI 1MDFA 2JNVA 2IZ4A 4KTTA 2QR1B 3MZKB 5C44I 4R1LA 1GPMA 4XX2A 3UOWA 3A9UA 3MONA 3CCSZ 3CCV1 1QYPA 3LUSA 1IBMC 1VQKZ 3CD61 2JIPA 2QW0X 4DV0C 3K6RA 2HHHC 5KYTA 1FJGC 1ZH1A 2D1TA 2LEXA 2KZ0A 4A3MI 3O2EA 1V60A 5T8TA 4ODJA 5BSWA 4Y7NI 1MKYA 4LF5C 1VQL1 1UWDA 4JM1A 3CCM1 1NY8A 4PUIA 1QF8A 3JAMf 4RVGA 3I4MI 3TR3A 3ETCA 2ZAEB 3IR7A 3B7WA 4LE5A 1MXAA 3G4SZ 1Y8CA 3J80b 3G711 1YJ9Z 1QVGY 2Y27A 3KXWA 4BBRI 2OOYB 4RVOA 3OW2Z 4RLFA 5T6BA 2RIQA 1L1OC 4DG9A 2ZM6C 3CCJ1 3CMA1 4RLQA 4RS4A 1AA6A 3UX3A 4DUYC 2VQFC 3IF8A 1JWHC 5CZVA 5BSRA 4RVHA 4GXQA 2R93I 4D57A 2W04A 3TUFA 1VQK1 3IFUA 4BC9A 2ZZNA 2UUBC 4MTNA 4DR3C 3PESA 4JV5C 4NB9A 2JUBA 1K732 1YJN1 1VQOZ 1Q811 4WV3A 1TWCI 3I08A 2F4OA 4NBCA 4TPSB 4EWCA 4NFRA 3NPDA 5IP9I 1FDOA 5LL6f 5BSUA 2Z51A 1VQP1 1HNZC 3NYQA 1QVFY 2YU9I 3S1MI 4DV4C 1P9NA 2QVXX 1QWIA 2D1QA 2GTIA 3GR1A 3GPCA 3G4S1 4DUZC 2M6NA 1HR0C 2M5HA 4DR5C 2UXDC 3RZOI 3CCRZ 2Y4OA 4K0BA 1S7MA 1Q7Y2 5FLXf 3PO3S 1HNXC 5A19A 1VQO1 2VPZA 2YADA 3GTLI 1YJW1 3TDEA 3JAMD 1Y1VI 3GTMI 4LF4C 1YHQZ 4A3GI 5H9UA 2E2II 2E7ZA 4DV6C 1Y1WI 5K85A 2V3VA 4AQYC 1TFIA 3BG1B 2QREB 3T1YC 1JJ2Z 4E2ZA 2P2MA 3RZDI 3J81f 1RLYA 3CCL1 4GKJC 3QWUA 4ZLPA 1N36C 2DE5A 5FLMI 5KYVA 4NBDA 4NXMC 4B3TC 1S72Z 1TH5A 2VUGA 3KIFA 4QTUA 1XMOC 4RVFA 1VQ51 3H3VJ 1O9TA 2UUCC 5JRHA 1TWAI 3CD6Z 3MZLB 2OO4A 3A4IA 3VTNA 3D9XA 5CZXA 1N32C 2QA4Z 1M901 4HH4A 1VLAA 2NVTI 2OZKA 1Q822 3FKII 2IZ3A 5IP7I 2OTL1 4LFAC 3R9WA 4E2YA 3HOVI 3NFZA 3I07A 1N33C 4PROC 3LNOA 5T8SA 2VPXA 3J80f 4WS9A 3LGXA 1EGAA 1VQLZ 2CXCA 2E8EA 4X65C 4NBHA 3CCMZ 1BA3A 1SFOI 3S14I 1YIJ1 1VQ81 4EATA 2HF1A 4ISBA 4R0MA 1I94C 4KHPC 3G71Z 2P2BA 3D2LA 4NOZA 3CME1 3F3PC 2E7GA 2WP0C 3N54B 4DCTA 5FLXD 2JA6I 3CCJZ 3CMAZ 2G2KA 1S721 2JA7I 1K0RA 2MCQA 4BCAA 1HNWC 2PN2A 2YWBA 2J6AA 1Z01A 2R6MA 4GS5A 2O53A 2P2FA 3N2QA 4OXIA 3VNRA 4S1TA 3U50C 4X66C 2ASBA 2RBLA 1W2BY 1YJNZ 2D7VA 2QA41 4HGYA 4NB8A 2JR6A 3I551 4YHHC 4AYBA 1K83I 3GTGI 1N34C 4FTFA 3J81D 3H2TA 5IT9b 4D4IA 1QVGZ 1Q821 1VQPZ 5AE3A 4HPVA 4LFBC 2QVYX 1VQ91 2NVQI 1ZB9A 4DR2C 3D6WA 4U5YD 4NBEA 2W03A 2PMZA 2ATWA 4E2WA 1K9M1 1N2FA 2YX1A 5BR8C 2P3YA 3UEBA 1K8A2 4BY7I 2E0GA 2H85A 3HOXI 2QVZX 3HKZA 1WH9A 1WW9A 2RT9A 2OTJ1 3A9VA 4QTTA 2RPRA 2DE7A 4NH1C 5AE2A 4K0KC 3F3FC 2V8JA 4NBGA 1NUIA 4CL1A 1VQ61 3HOYI 4BSZA 2UXCC 3J80D 5ADZA 1NJI2 1N8R2 1XRAA 2E2JI 3PROC 1YJWZ 1QVFZ 4LF6C 4MRIA 1ZB8A 2YCBA 3GTQI 2BH1X 2LFUA 5LMUC 1XNRC 3I561 4PUGA 1MDBA 1Y1VS 4LFCC 1WIIA 3TE5B 1TWHI 2V45A 3GTMS 3J7A4 2P02A 1FUGA 4E2XA 2VZEA 4BC7A 4GKKC 2AKLA 2JNYA 2YWCA 3SO4A 4FUTA 4JI7C 5LMNC 3CXCY 2JA8I 4B3MC 4JI6C 4A3II 5BURA 4DV3C 5AE1A 3T4NB 3CCLZ 5IFIA 1VQN1 1V25A 1RNIA 3HOWI 3M4OI 1XRBA 3CQ3A 2D27A 1PFTA 3NH5A 4NXNC 1QXFA 4TNUA 1RO2A 3DHVA 3FCCA 5GTDA 4A3DI 3PO2I 4DV1C 1VQ5Z 3S17I 2D1SA 4RM3A 2ZZMA 3LAXA 3IPLA 2DE6A 3ETOA 4BXXI
chains in the Genus database with same CATH topology
1Z02A 5C3EI 2QL8A 2OPLA 5E7QA 4A3EI 3TDHB 2OTLZ 2CY1A 5D1OA 1Z03A 3HOZI 2F4MA 3FQQA 1K731 3NI2A 3S16I 2VSQA 1P7LA 4NBAA 2UU9C 3I4NI 1VQ8Z 1YIJZ 5A2Qb 1MD9A 3IX0A 1MXBA 2M48A 3CW9A 1WCMI 2WAQA 1USPA 3CMEZ 4IR7A 4JI4C 3EQ6A 1KC82 1KQSY 2OBVA 4DV2C 1PG4A 4RM2A 1M1K2 3E7XA 3PBKA 4PZPA 1JOSA 4A3LI 5T67A 2V7BA 2QLVB 1LQLA 4DR1C 1ML8A 3VB9A 1KKGA 4DQYB 2OPLB 3GCFA 1Q7Y1 5IT9f 3NH8A 2ONFA 4E33A 5D1OB 5A1GA 3I55Z 1VQMZ 3AF5A 3TQIA 5BUQA 3GTKI 3H0GI 3CC2Z 1VQ9Z 5D1PA 4G37A 1YI21 4NBBA 2D28C 1USPB 3CCU1 4X62C 2QEX1 2UXBC 1RY2A 4G36A 4MD9A 2JMOA 2E5LC 2K3RA 2OTJZ 3E7WA 3L95X 3CC4Z 2D1RA 4I9FA 1W2BZ 1PG3A 2QRCB 1T5HX 1WF3A 5CM2M 1VQ6Z 2JMPA 4MONA 3IEVA 1IBLC 2OOXB 4A3FI 1DL6A 4A3JI 4NBFA 1YITZ 4DR4C 1UKKA 5C4JI 2Y4NA 3FQMA 2UUAC 2K5RA 4BY1I 4JI1C 3LNVA 1VQM1 1L2FA 4MH4A 3S1RI 5IWAC 1XNQC 3I56Z 1VQ41 1TWFI 2XR1A 4LF8C 1R9TI 2Q51A 5A1IA 3CPWY 1XMQC 3CC21 2P2QA 1KRLA 4I9GA 4DK1A 1PA4A 3J81b 3VNQA 2VQEC 1LCIA 4FUQA 4JI3C 1Q812 1I50I 4DV7C 3NDIA 1X0TA 3VMIA 2KZFA 4RMNA 3RV2A 3VMHA 1VQNZ 3S2HI 5IT9D 3P5JB 3GKUA 5K8FA 3CC41 1O90A 1T5DX 2PT7G 3CCQZ 1ULTA 4B3RC 2QRDB 5AN9F 1RO0A 2E8CA 1X3ZA 4X6AI 4JI8C 1YUKA 4DGLA 2WD9A 1YIT1 1HH2P 2JA5I 4E31A 4BBYA 4DV5C 3CC7Z 4JI0C 4E30A 4MD7A 5A2Qf 2KI7B 3CXCZ 4DR6C 3CQZI 3G6EZ 1Q862 3EEDA 3S15I 3VNSA 1VQ7Z 2E8FA 2E9HA 2DPLA 4JI2C 4R1MA 3GTOI 3NH4A 1V26A 2B63I 3KIHA 3M3YI 4PHTA 4X64C 4D4GA 3CCEZ 2P2JA 4NDNA 3OW2Y 3CCS1 2WB1A 3L8CA 3C5EA 3S1NI 4DCVA 4YY3C 3NYRA 1O92A 2PM9A 2R7ZI 4GXRA 1KD12 1K8A1 2LIYA 2BJOA 3CCQ1 2GTHA 3R44A 3DAYA 5BSTA 4A3CI 4B3SC 4RVDA 2DYJA 3FCEA 1RO4A 2QKDA 3R9XA 1X3WA 5C4XI 4E32A 3CC71 3S1QI 4L2ZA 2HU9A 3AF6A 1YJ7A 4RVNA 2PROA 1NYEA 1YJ91 1NJI1 3CW8X 3S82A 1N8R1 2JS4A 3G6E1 4Y52I 2Y0SA 1VQ71 4DCSA 1I3QI 1KQSZ 2PK7A 4G1IA 3JAMb 1YI2Z 2P28A 4DCUA 2V8IA 3CCUZ 1Q861 2QEXZ 3CCE1 1M902 4LF9C 3CJEA 4KTVA 2Q4ZA 1RQFA 4A93I 3OTOC 3DLPX 3GR0A 1TWGI 1NP6A 2AYAA 1YUAA 3GTJI 2R92I 2VF1A 4MXUA 5A2QD 3VMGA 3GKQA 2VUMI 4OX9C 5KEIA 1KD11 1IBKC 3IMLA 5BSVA 4MD8A 3T1HC 3UZ0A 2P20A 2EGTA 5DV9A 3BG0B 4DR7C 2I3CA 2F4VC 4A3BI 3HOUI 5BUSA 4JI5C 1VQ4Z 4L4QA 4L7IA 3ESWA 2NVXI 3CCR1 3G7SA 4ZJZA 4HGZA 1JJ2Y 4D56A 3RG2A 4RV9A 3CCVZ 4OYCA 1I6HI 3PO3I 1O93A 3K7AI 2RHBA 3GTPI 1J5EC 3NDJA 2NVYI 2V8KA 1MXCA 2GU2A 1KC81 3IEUA 1YHQ1 1M1K1 4LF7C 1RG9A 2KPIA 5FLXb 3EERA 5T64A 2HJGA 1QM4A 1K9M2 4IZ6A 4DG8A 3CPWZ 1XRCA 5BSMA 4A3KI 3Q87A 3S2DI 4BBSI 2O4HA 2E2HI 1MDFA 2IZ4A 4KTTA 2QR1B 3MZKB 5C44I 4R1LA 1GPMA 4XX2A 3UOWA 3A9UA 3MONA 3CCSZ 3CCV1 1QYPA 3LUSA 1IBMC 1VQKZ 3CD61 2QW0X 4DV0C 1FJGC 2HHHC 5KYTA 1ZH1A 2D1TA 4A3MI 5T8TA 5BSWA 4ODJA 4Y7NI 1MKYA 4LF5C 1VQL1 4JM1A 3CCM1 1QF8A 3JAMf 4RVGA 3I4MI 4JYAC 3ETCA 2ZAEB 4LE5A 3B7WA 1AMUA 1MXAA 3G4SZ 3J80b 1YJ9Z 3G711 1QVGY 2Y27A 3KXWA 4BBRI 2OOYB 4RVOA 3OW2Z 4RLFA 5T6BA 2RIQA 1L1OC 4DG9A 2ZM6C 3CCJ1 3CMA1 4RLQA 4RS4A 4DUYC 2VQFC 3IF8A 1JWHC 5CZVA 5BSRA 4RVHA 4GXQA 2R93I 4D57A 2W04A 3TUFA 1VQK1 3IFUA 4BC9A 2UUBC 4MTNA 4DR3C 3PESA 4JV5C 4NB9A 2JUBA 1K732 1YJN1 1VQOZ 1Q811 4WV3A 1TWCI 3I08A 2F4OA 4NBCA 4TPSB 4EWCA 4NFRA 3NPDA 5IP9I 5LL6f 5BSUA 1VQP1 1HNZC 3NYQA 1QVFY 2YU9I 3S1MI 4DV4C 1P9NA 2QVXX 1QWIA 2D1QA 2GTIA 3GR1A 3GPCA 3G4S1 4DUZC 2M6NA 1HR0C 4DR5C 2UXDC 3RZOI 3CCRZ 2Y4OA 4K0BA 1S7MA 1Q7Y2 5FLXf 3PO3S 1HNXC 5A19A 1VQO1 2YADA 3GTLI 1YJW1 3TDEA 3JAMD 1Y1VI 3GTMI 4LF4C 1YHQZ 4A3GI 5H9UA 2E2II 4DV6C 1Y1WI 5K85A 4AQYC 1TFIA 3BG1B 2QREB 3T1YC 1JJ2Z 4E2ZA 2P2MA 3RZDI 3J81f 1RLYA 3CCL1 4GKJC 3QWUA 4ZLPA 1N36C 2DE5A 5FLMI 5KYVA 4NBDA 4NXMC 4B3TC 1S72Z 2VUGA 3KIFA 4QTUA 1XMOC 1VQ51 4RVFA 3H3VJ 1O9TA 2UUCC 5JRHA 1TWAI 3CD6Z 3MZLB 2OO4A 3A4IA 3VTNA 3D9XA 5CZXA 1N32C 2QA4Z 1M901 4HH4A 1VLAA 2NVTI 2OZKA 1Q822 3FKII 2IZ3A 5IP7I 2OTL1 4LFAC 3R9WA 4E2YA 3HOVI 3NFZA 3I07A 1N33C 4PROC 5T8SA 3J80f 4WS9A 3LGXA 1EGAA 1VQLZ 2CXCA 2E8EA 4X65C 4NBHA 3CCMZ 1BA3A 1SFOI 3S14I 1YIJ1 1VQ81 4EATA 2HF1A 4ISBA 4R0MA 1I94C 4KHPC 3G71Z 2P2BA 3CME1 4NOZA 3F3PC 2E7GA 2WP0C 3N54B 4DCTA 5FLXD 2JA6I 3CCJZ 3CMAZ 2G2KA 1S721 2JA7I 1K0RA 4BCAA 1HNWC 2PN2A 2YWBA 2J6AA 1Z01A 2R6MA 4GS5A 2O53A 2P2FA 3N2QA 4OXIA 3VNRA 4S1TA 3U50C 4X66C 2ASBA 2RBLA 1W2BY 1YJNZ 2D7VA 2QA41 4HGYA 4NB8A 2JR6A 3I551 4YHHC 4AYBA 1K83I 3GTGI 1N34C 4FTFA 3J81D 3H2TA 5IT9b 4D4IA 1QVGZ 1Q821 1VQPZ 5AE3A 4HPVA 4LFBC 2QVYX 1VQ91 2NVQI 1ZB9A 4DR2C 3D6WA 4U5YD 4NBEA 2W03A 2PMZA 2ATWA 4E2WA 1K9M1 1N2FA 5BR8C 2P3YA 1K8A2 4BY7I 2E0GA 2H85A 3HOXI 2QVZX 3HKZA 1WH9A 1WW9A 2RT9A 2OTJ1 3A9VA 4QTTA 2RPRA 2DE7A 4NH1C 5AE2A 4K0KC 3F3FC 2V8JA 4NBGA 1NUIA 4CL1A 1VQ61 3HOYI 4BSZA 2UXCC 3J80D 5ADZA 1NJI2 1N8R2 1XRAA 2E2JI 3PROC 1YJWZ 1QVFZ 4LF6C 4MRIA 1ZB8A 2YCBA 3GTQI 2BH1X 2LFUA 5LMUC 1XNRC 3I561 1MDBA 1Y1VS 4LFCC 1WIIA 3TE5B 1TWHI 3GTMS 3J7A4 2P02A 1FUGA 4E2XA 2VZEA 4BC7A 4GKKC 2AKLA 2JNYA 2YWCA 3SO4A 4FUTA 4JI7C 5LMNC 3CXCY 2JA8I 4B3MC 4JI6C 4A3II 5BURA 4DV3C 5AE1A 3T4NB 3CCLZ 5IFIA 1VQN1 1V25A 1RNIA 3HOWI 3M4OI 1XRBA 2D27A 1PFTA 3NH5A 4NXNC 3DHVA 4TNUA 1RO2A 3FCCA 5GTDA 4A3DI 3PO2I 4DV1C 1VQ5Z 3S17I 2D1SA 4RM3A 3LAXA 3IPLA 2DE6A 3ETOA 4BXXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E I;  2QL8 A;  2OPL A;  4A3E I;  2CY1 A;  3HOZ I;  2F4M A;  3S16 I;  4NBA A;  2UU9 C;  3I4N I;  1WCM I;  4JI4 C;  1USP A;  4DV2 C;  1JOS A;  4A3L I;  1LQL A;  4DR1 C;  1ML8 A;  3VB9 A;  1KKG A;  2OPL B;  3GCF A;  2ONF A;  3AF5 A;  3GTK I;  3H0G I;  4NBB A;  1USP B;  4X62 C;  2UXB C;  2E5L C;  1WF3 A;  2JMP A;  5CM2 M;  3IEV A;  1IBL C;  4A3F I;  1DL6 A;  4A3J I;  4NBF A;  4DR4 C;  1UKK A;  5C4J I;  2UUA C;  2K5R A;  4BY1 I;  4JI1 C;  1L2F A;  4MH4 A;  3S1R I;  5IWA C;  1XNQ C;  1TWF I;  2XR1 A;  4LF8 C;  1R9T I;  1XMQ C;  2VQE C;  1PA4 A;  4JI3 C;  4DV7 C;  1I50 I;  3VMI A;  2KZF A;  3VMH A;  3S2H I;  5IT9 D;  3GKU A;  2PT7 G;  4B3R C;  2E8C A;  1X3Z A;  4X6A I;  4JI8 C;  1HH2 P;  2JA5 I;  4DV5 C;  4JI0 C;  4DR6 C;  3CQZ I;  3S15 I;  2E8F A;  4JI2 C;  3GTO I;  2B63 I;  3M3Y I;  4X64 C;  3S1N I;  4DCV A;  4YY3 C;  2R7Z I;  2BJO A;  4A3C I;  4B3S C;  2DYJ A;  1RO4 A;  3R9X A;  1X3W A;  5C4X I;  3AF6 A;  3S1Q I;  1NYE A;  2JS4 A;  4Y52 I;  4DCS A;  1I3Q I;  2PK7 A;  4DCU A;  4LF9 C;  3CJE A;  4A93 I;  3OTO C;  1TWG I;  1YUA A;  3GTJ I;  2R92 I;  5A2Q D;  3VMG A;  3GKQ A;  2VUM I;  4OX9 C;  1IBK C;  3T1H C;  2EGT A;  4DR7 C;  2F4V C;  4A3B I;  3HOU I;  4JI5 C;  3ESW A;  2NVX I;  1I6H I;  3PO3 I;  3K7A I;  3GTP I;  1J5E C;  2NVY I;  3IEU A;  4LF7 C;  2KPI A;  3EER A;  2HJG A;  4A3K I;  3Q87 A;  3S2D I;  4BBS I;  2E2H I;  5C44 I;  4XX2 A;  1QYP A;  3LUS A;  1IBM C;  4DV0 C;  1FJG C;  2HHH C;  4A3M I;  4Y7N I;  1MKY A;  4LF5 C;  3I4M I;  4JYA C;  4BBR I;  1L1O C;  2ZM6 C;  4DUY C;  2VQF C;  2R93 I;  2UUB C;  4MTN A;  4DR3 C;  4JV5 C;  4NB9 A;  1TWC I;  2F4O A;  4NBC A;  5IP9 I;  1HNZ C;  3S1M I;  2YU9 I;  4DV4 C;  1QWI A;  4DUZ C;  1HR0 C;  4DR5 C;  2UXD C;  3RZO I;  3PO3 S;  1HNX C;  3GTL I;  3JAM D;  1Y1V I;  3GTM I;  4LF4 C;  4A3G I;  2E2I I;  4DV6 C;  1Y1W I;  4AQY C;  1TFI A;  3T1Y C;  3RZD I;  1RLY A;  4GKJ C;  1N36 C;  2DE5 A;  5FLM I;  4NBD A;  4NXM C;  4B3T C;  1XMO C;  4QTU A;  3H3V J;  2UUC C;  1TWA I;  1N32 C;  1VLA A;  2NVT I;  4LFA C;  3R9W A;  3FKI I;  5IP7 I;  3HOV I;  3I07 A;  1N33 C;  1EGA A;  2CXC A;  2E8E A;  4X65 C;  4NBH A;  1SFO I;  3S14 I;  4KHP C;  2HF1 A;  1I94 C;  4NOZ A;  2E7G A;  5FLX D;  4DCT A;  2JA6 I;  2JA7 I;  1K0R A;  1HNW C;  2PN2 A;  2J6A A;  3U50 C;  4X66 C;  2ASB A;  2RBL A;  2D7V A;  4NB8 A;  2JR6 A;  4YHH C;  1K83 I;  3GTG I;  1N34 C;  3J81 D;  4LFB C;  2NVQ I;  1ZB9 A;  4DR2 C;  3D6W A;  4NBE A;  2ATW A;  1N2F A;  5BR8 C;  2P3Y A;  4BY7 I;  3HOX I;  1WH9 A;  1WW9 A;  4QTT A;  2DE7 A;  4K0K C;  4NBG A;  1NUI A;  3HOY I;  4BSZ A;  2UXC C;  3J80 D;  2E2J I;  4LF6 C;  1ZB8 A;  2YCB A;  3GTQ I;  5LMU C;  1XNR C;  1Y1V S;  4LFC C;  3GTM S;  1TWH I;  4GKK C;  2AKL A;  2JNY A;  4JI7 C;  5LMN C;  4B3M C;  2JA8 I;  4JI6 C;  4A3I I;  4DV3 C;  3HOW I;  3M4O I;  1PFT A;  4NXN C;  4A3D I;  3PO2 I;  4DV1 C;  3S17 I;  2DE6 A;  4BXX I; 
#chains in the Genus database with same CATH topology
 1Z02 A;  5C3E I;  2QL8 A;  2OPL A;  5E7Q A;  4A3E I;  3TDH B;  2OTL Z;  2CY1 A;  5D1O A;  1Z03 A;  3HOZ I;  2F4M A;  3FQQ A;  1K73 1;  2JIM A;  3NI2 A;  2CU6 A;  3S16 I;  2VSQ A;  1P7L A;  4NBA A;  2UU9 C;  3I4N I;  1VQ8 Z;  1YIJ Z;  5A2Q b;  1MD9 A;  3IX0 A;  1MXB A;  2M48 A;  3CW9 A;  1WCM I;  2WAQ A;  1USP A;  3CME Z;  4IR7 A;  4JI4 C;  3EQ6 A;  1KC8 2;  1KQS Y;  2OBV A;  4DV2 C;  1PG4 A;  4RM2 A;  1M1K 2;  3E7X A;  3PBK A;  4PZP A;  1JOS A;  4A3L I;  5T67 A;  2V7B A;  2QLV B;  1LQL A;  2VPY A;  4DR1 C;  1ML8 A;  3VB9 A;  1KKG A;  4DQY B;  2OPL B;  3GCF A;  1Q7Y 1;  5IT9 f;  3NH8 A;  2ONF A;  4E33 A;  2DHM A;  5D1O B;  3AY0 A;  5A1G A;  3I55 Z;  1VQM Z;  3AF5 A;  3TQI A;  5BUQ A;  1WZN A;  3H0G I;  3GTK I;  3CC2 Z;  1VQ9 Z;  5D1P A;  4G37 A;  1YI2 1;  4NBB A;  2D28 C;  1USP B;  3CCU 1;  4X62 C;  2VPW A;  2QEX 1;  2UXB C;  2NAP A;  1RY2 A;  2NCL A;  4G36 A;  4MD9 A;  2JMO A;  2E5L C;  2K3R A;  2OTJ Z;  3E7W A;  3L95 X;  2JIQ A;  1SIW A;  3CC4 Z;  2D1R A;  2MMA B;  1W2B Z;  4I9F A;  1PG3 A;  2QRC B;  2JIO A;  5LCI A;  1T5H X;  1WF3 A;  5CM2 M;  1VQ6 Z;  2JMP A;  4MON A;  2MM9 A;  3IEV A;  1IBL C;  2OOX B;  4A3F I;  1DL6 A;  4A3J I;  4NBF A;  1YIT Z;  4DR4 C;  1UKK A;  5C4J I;  2Y4N A;  3FQM A;  2UUA C;  2K5R A;  4BY1 I;  1XS3 A;  4JI1 C;  3LNV A;  1VQM 1;  1L2F A;  4MH4 A;  3S1R I;  5IWA C;  1XNQ C;  3I56 Z;  1VQ4 1;  1TWF I;  2XR1 A;  4LF8 C;  1R9T I;  2Q51 A;  4PUH A;  2AYD A;  3CPW Y;  5A1I A;  1XMQ C;  3CC2 1;  2P2Q A;  1KRL A;  4I9G A;  4DK1 A;  1PA4 A;  3J81 b;  3VNQ A;  2VQE C;  1LCI A;  4FUQ A;  4JI3 C;  1Q81 2;  1I50 I;  4DV7 C;  3NDI A;  1X0T A;  3VMI A;  2KZF A;  4RMN A;  3RV2 A;  3VMH A;  1VQN Z;  3S2H I;  5IT9 D;  3P5J B;  3GKU A;  1P4E C;  5K8F A;  3CC4 1;  1O90 A;  1T5D X;  2PT7 G;  3CCQ Z;  1ULT A;  4B3R C;  2QRD B;  5AN9 F;  3CQ2 A;  1RO0 A;  2E8C A;  1X3Z A;  4X6A I;  4JI8 C;  1YUK A;  4DGL A;  2WD9 A;  1YIT 1;  1HH2 P;  2JA5 I;  4E31 A;  4JYA C;  4BBY A;  4DV5 C;  3CC7 Z;  4JI0 C;  4E30 A;  4MD7 A;  5A2Q f;  1PU1 A;  2KI7 B;  3CXC Z;  4DR6 C;  3CQZ I;  3G6E Z;  1Q86 2;  3EED A;  3S15 I;  3VNS A;  1VQ7 Z;  2E8F A;  2E9H A;  2DPL A;  4JI2 C;  4R1M A;  3GTO I;  3NH4 A;  1V26 A;  2B63 I;  3KIH A;  3M3Y I;  1XHJ A;  4PHT A;  4X64 C;  4D4G A;  3CCE Z;  2P2J A;  4NDN A;  3OW2 Y;  3CCS 1;  1M6X C;  3A25 A;  2WB1 A;  3L8C A;  3C5E A;  3S1N I;  4DCV A;  4YY3 C;  3NYR A;  1O92 A;  1VEH A;  3CQ1 A;  3UX2 A;  2PM9 A;  2R7Z I;  4GXR A;  1FDI A;  1K8A 1;  1KD1 2;  2LIY A;  2BJO A;  3CCQ 1;  2GTH A;  3R44 A;  3DAY A;  5BST A;  4A3C I;  2JIR A;  4B3S C;  4RVD A;  2DYJ A;  3FCE A;  1RO4 A;  2QKD A;  3R9X A;  1X3W A;  2IV2 X;  1P4E A;  5C4X I;  4E32 A;  3CC7 1;  3S1Q I;  4L2Z A;  2HU9 A;  3AF6 A;  1YJ7 A;  4RVN A;  2PRO A;  1NYE A;  1YJ9 1;  1NJI 1;  3CW8 X;  3S82 A;  1N8R 1;  2JS4 A;  3G6E 1;  4Y52 I;  2Y0S A;  1VQ7 1;  4DCS A;  1I3Q I;  1KQS Z;  2PK7 A;  4G1I A;  1WJ2 A;  3JAM b;  1YI2 Z;  2P28 A;  4DCU A;  2V8I A;  3CCU Z;  1Q86 1;  2QEX Z;  3CCE 1;  1M90 2;  4LF9 C;  3CJE A;  4KTV A;  2Q4Z A;  1RQF A;  4A93 I;  3OTO C;  3DLP X;  3GR0 A;  1TWG I;  1NP6 A;  2AYA A;  1YUA A;  3GTJ I;  2R92 I;  2VF1 A;  4MXU A;  1IB8 A;  5A2Q D;  3VMG A;  3GKQ A;  2VUM I;  1M6X A;  4OX9 C;  5KEI A;  1KD1 1;  1IBK C;  3IML A;  5BSV A;  4MD8 A;  3T1H C;  3UZ0 A;  2P20 A;  2EGT A;  5DV9 A;  3BG0 B;  3A26 A;  2I3C A;  2F4V C;  4A3B I;  4DR7 C;  3HOU I;  5BUS A;  4JI5 C;  1VQ4 Z;  4L4Q A;  1Q16 A;  1WCJ A;  4L7I A;  3ESW A;  2KDN A;  2NVX I;  3CCR 1;  3G7S A;  4ZJZ A;  4HGZ A;  1JJ2 Y;  2M5O A;  4D56 A;  3RG2 A;  4RV9 A;  3CCV Z;  4OYC A;  1I6H I;  3PO3 I;  1O93 A;  3K7A I;  2RHB A;  3GTP I;  1J5E C;  3NDJ A;  2NVY I;  1FLO A;  2V8K A;  1MXC A;  2GU2 A;  1KC8 1;  3IEU A;  1YHQ 1;  1M1K 1;  4LF7 C;  1RG9 A;  2KPI A;  5FLX b;  3EER A;  5T64 A;  2HJG A;  1QM4 A;  1AMU A;  1K9M 2;  4IZ6 A;  4DG8 A;  3CPW Z;  1XRC A;  5BSM A;  4A3K I;  3Q87 A;  3S2D I;  4BBS I;  2O4H A;  2E2H I;  1MDF A;  2JNV A;  2IZ4 A;  4KTT A;  2QR1 B;  3MZK B;  5C44 I;  4R1L A;  1GPM A;  4XX2 A;  3UOW A;  3A9U A;  3MON A;  3CCS Z;  3CCV 1;  1QYP A;  3LUS A;  1IBM C;  1VQK Z;  3CD6 1;  2JIP A;  2QW0 X;  4DV0 C;  3K6R A;  2HHH C;  5KYT A;  1FJG C;  1ZH1 A;  2D1T A;  2LEX A;  2KZ0 A;  4A3M I;  3O2E A;  1V60 A;  5T8T A;  4ODJ A;  5BSW A;  4Y7N I;  1MKY A;  4LF5 C;  1VQL 1;  1UWD A;  4JM1 A;  3CCM 1;  1NY8 A;  4PUI A;  1QF8 A;  3JAM f;  4RVG A;  3I4M I;  3TR3 A;  3ETC A;  2ZAE B;  3IR7 A;  3B7W A;  4LE5 A;  1MXA A;  3G4S Z;  1Y8C A;  3J80 b;  3G71 1;  1YJ9 Z;  1QVG Y;  2Y27 A;  3KXW A;  4BBR I;  2OOY B;  4RVO A;  3OW2 Z;  4RLF A;  5T6B A;  2RIQ A;  1L1O C;  4DG9 A;  2ZM6 C;  3CCJ 1;  3CMA 1;  4RLQ A;  4RS4 A;  1AA6 A;  3UX3 A;  4DUY C;  2VQF C;  3IF8 A;  1JWH C;  5CZV A;  5BSR A;  4RVH A;  4GXQ A;  2R93 I;  4D57 A;  2W04 A;  3TUF A;  1VQK 1;  3IFU A;  4BC9 A;  2ZZN A;  2UUB C;  4MTN A;  4DR3 C;  3PES A;  4JV5 C;  4NB9 A;  2JUB A;  1K73 2;  1YJN 1;  1VQO Z;  1Q81 1;  4WV3 A;  1TWC I;  3I08 A;  2F4O A;  4NBC A;  4TPS B;  4EWC A;  4NFR A;  3NPD A;  5IP9 I;  1FDO A;  5LL6 f;  5BSU A;  2Z51 A;  1VQP 1;  1HNZ C;  3NYQ A;  1QVF Y;  2YU9 I;  3S1M I;  4DV4 C;  1P9N A;  2QVX X;  1QWI A;  2D1Q A;  2GTI A;  3GR1 A;  3GPC A;  3G4S 1;  4DUZ C;  2M6N A;  1HR0 C;  2M5H A;  4DR5 C;  2UXD C;  3RZO I;  3CCR Z;  2Y4O A;  4K0B A;  1S7M A;  1Q7Y 2;  5FLX f;  3PO3 S;  1HNX C;  5A19 A;  1VQO 1;  2VPZ A;  2YAD A;  3GTL I;  1YJW 1;  3TDE A;  3JAM D;  1Y1V I;  3GTM I;  4LF4 C;  1YHQ Z;  4A3G I;  5H9U A;  2E2I I;  2E7Z A;  4DV6 C;  1Y1W I;  5K85 A;  2V3V A;  4AQY C;  1TFI A;  3BG1 B;  2QRE B;  3T1Y C;  1JJ2 Z;  4E2Z A;  2P2M A;  3RZD I;  3J81 f;  1RLY A;  3CCL 1;  4GKJ C;  3QWU A;  4ZLP A;  1N36 C;  2DE5 A;  5FLM I;  5KYV A;  4NBD A;  4NXM C;  4B3T C;  1S72 Z;  1TH5 A;  2VUG A;  3KIF A;  4QTU A;  1XMO C;  4RVF A;  1VQ5 1;  3H3V J;  1O9T A;  2UUC C;  5JRH A;  1TWA I;  3CD6 Z;  3MZL B;  2OO4 A;  3A4I A;  3VTN A;  3D9X A;  5CZX A;  1N32 C;  2QA4 Z;  1M90 1;  4HH4 A;  1VLA A;  2NVT I;  2OZK A;  1Q82 2;  3FKI I;  2IZ3 A;  5IP7 I;  2OTL 1;  4LFA C;  3R9W A;  4E2Y A;  3HOV I;  3NFZ A;  3I07 A;  1N33 C;  4PRO C;  3LNO A;  5T8S A;  2VPX A;  3J80 f;  4WS9 A;  3LGX A;  1EGA A;  1VQL Z;  2CXC A;  2E8E A;  4X65 C;  4NBH A;  3CCM Z;  1BA3 A;  1SFO I;  3S14 I;  1YIJ 1;  1VQ8 1;  4EAT A;  2HF1 A;  4ISB A;  4R0M A;  1I94 C;  4KHP C;  3G71 Z;  2P2B A;  3D2L A;  4NOZ A;  3CME 1;  3F3P C;  2E7G A;  2WP0 C;  3N54 B;  4DCT A;  5FLX D;  2JA6 I;  3CCJ Z;  3CMA Z;  2G2K A;  1S72 1;  2JA7 I;  1K0R A;  2MCQ A;  4BCA A;  1HNW C;  2PN2 A;  2YWB A;  2J6A A;  1Z01 A;  2R6M A;  4GS5 A;  2O53 A;  2P2F A;  3N2Q A;  4OXI A;  3VNR A;  4S1T A;  3U50 C;  4X66 C;  2ASB A;  2RBL A;  1W2B Y;  1YJN Z;  2D7V A;  2QA4 1;  4HGY A;  4NB8 A;  2JR6 A;  3I55 1;  4YHH C;  4AYB A;  1K83 I;  3GTG I;  1N34 C;  4FTF A;  3J81 D;  3H2T A;  5IT9 b;  4D4I A;  1QVG Z;  1Q82 1;  1VQP Z;  5AE3 A;  4HPV A;  4LFB C;  2QVY X;  1VQ9 1;  2NVQ I;  1ZB9 A;  4DR2 C;  3D6W A;  4U5Y D;  4NBE A;  2W03 A;  2PMZ A;  2ATW A;  4E2W A;  1K9M 1;  1N2F A;  2YX1 A;  5BR8 C;  2P3Y A;  3UEB A;  1K8A 2;  4BY7 I;  2E0G A;  2H85 A;  3HOX I;  2QVZ X;  3HKZ A;  1WH9 A;  1WW9 A;  2RT9 A;  2OTJ 1;  3A9V A;  4QTT A;  2RPR A;  2DE7 A;  4NH1 C;  5AE2 A;  4K0K C;  3F3F C;  2V8J A;  4NBG A;  1NUI A;  4CL1 A;  1VQ6 1;  3HOY I;  4BSZ A;  2UXC C;  3J80 D;  5ADZ A;  1NJI 2;  1N8R 2;  1XRA A;  2E2J I;  3PRO C;  1YJW Z;  1QVF Z;  4LF6 C;  4MRI A;  1ZB8 A;  2YCB A;  3GTQ I;  2BH1 X;  2LFU A;  5LMU C;  1XNR C;  3I56 1;  4PUG A;  1MDB A;  1Y1V S;  4LFC C;  1WII A;  3TE5 B;  1TWH I;  2V45 A;  3GTM S;  3J7A 4;  2P02 A;  1FUG A;  4E2X A;  2VZE A;  4BC7 A;  4GKK C;  2AKL A;  2JNY A;  2YWC A;  3SO4 A;  4FUT A;  4JI7 C;  5LMN C;  3CXC Y;  2JA8 I;  4B3M C;  4JI6 C;  4A3I I;  5BUR A;  4DV3 C;  5AE1 A;  3T4N B;  3CCL Z;  5IFI A;  1VQN 1;  1V25 A;  1RNI A;  3HOW I;  3M4O I;  1XRB A;  3CQ3 A;  2D27 A;  1PFT A;  3NH5 A;  4NXN C;  1QXF A;  4TNU A;  1RO2 A;  3DHV A;  3FCC A;  5GTD A;  4A3D I;  3PO2 I;  4DV1 C;  1VQ5 Z;  3S17 I;  2D1S A;  4RM3 A;  2ZZM A;  3LAX A;  3IPL A;  2DE6 A;  3ETO A;  4BXX I; 
#chains in the Genus database with same CATH homology
 1Z02 A;  5C3E I;  2QL8 A;  2OPL A;  5E7Q A;  4A3E I;  3TDH B;  2OTL Z;  2CY1 A;  5D1O A;  1Z03 A;  3HOZ I;  2F4M A;  3FQQ A;  1K73 1;  3NI2 A;  3S16 I;  2VSQ A;  1P7L A;  4NBA A;  2UU9 C;  3I4N I;  1VQ8 Z;  1YIJ Z;  5A2Q b;  1MD9 A;  3IX0 A;  1MXB A;  2M48 A;  3CW9 A;  1WCM I;  2WAQ A;  1USP A;  3CME Z;  4IR7 A;  4JI4 C;  3EQ6 A;  1KC8 2;  1KQS Y;  2OBV A;  4DV2 C;  1PG4 A;  4RM2 A;  1M1K 2;  3E7X A;  3PBK A;  4PZP A;  1JOS A;  4A3L I;  5T67 A;  2V7B A;  2QLV B;  1LQL A;  4DR1 C;  1ML8 A;  3VB9 A;  1KKG A;  4DQY B;  2OPL B;  3GCF A;  1Q7Y 1;  5IT9 f;  3NH8 A;  2ONF A;  4E33 A;  5D1O B;  5A1G A;  3I55 Z;  1VQM Z;  3AF5 A;  3TQI A;  5BUQ A;  3GTK I;  3H0G I;  3CC2 Z;  1VQ9 Z;  5D1P A;  4G37 A;  1YI2 1;  4NBB A;  2D28 C;  1USP B;  3CCU 1;  4X62 C;  2QEX 1;  2UXB C;  1RY2 A;  4G36 A;  4MD9 A;  2JMO A;  2E5L C;  2K3R A;  2OTJ Z;  3E7W A;  3L95 X;  3CC4 Z;  2D1R A;  4I9F A;  1W2B Z;  1PG3 A;  2QRC B;  1T5H X;  1WF3 A;  5CM2 M;  1VQ6 Z;  2JMP A;  4MON A;  3IEV A;  1IBL C;  2OOX B;  4A3F I;  1DL6 A;  4A3J I;  4NBF A;  1YIT Z;  4DR4 C;  1UKK A;  5C4J I;  2Y4N A;  3FQM A;  2UUA C;  2K5R A;  4BY1 I;  4JI1 C;  3LNV A;  1VQM 1;  1L2F A;  4MH4 A;  3S1R I;  5IWA C;  1XNQ C;  3I56 Z;  1VQ4 1;  1TWF I;  2XR1 A;  4LF8 C;  1R9T I;  2Q51 A;  5A1I A;  3CPW Y;  1XMQ C;  3CC2 1;  2P2Q A;  1KRL A;  4I9G A;  4DK1 A;  1PA4 A;  3J81 b;  3VNQ A;  2VQE C;  1LCI A;  4FUQ A;  4JI3 C;  1Q81 2;  1I50 I;  4DV7 C;  3NDI A;  1X0T A;  3VMI A;  2KZF A;  4RMN A;  3RV2 A;  3VMH A;  1VQN Z;  3S2H I;  5IT9 D;  3P5J B;  3GKU A;  5K8F A;  3CC4 1;  1O90 A;  1T5D X;  2PT7 G;  3CCQ Z;  1ULT A;  4B3R C;  2QRD B;  5AN9 F;  1RO0 A;  2E8C A;  1X3Z A;  4X6A I;  4JI8 C;  1YUK A;  4DGL A;  2WD9 A;  1YIT 1;  1HH2 P;  2JA5 I;  4E31 A;  4BBY A;  4DV5 C;  3CC7 Z;  4JI0 C;  4E30 A;  4MD7 A;  5A2Q f;  2KI7 B;  3CXC Z;  4DR6 C;  3CQZ I;  3G6E Z;  1Q86 2;  3EED A;  3S15 I;  3VNS A;  1VQ7 Z;  2E8F A;  2E9H A;  2DPL A;  4JI2 C;  4R1M A;  3GTO I;  3NH4 A;  1V26 A;  2B63 I;  3KIH A;  3M3Y I;  4PHT A;  4X64 C;  4D4G A;  3CCE Z;  2P2J A;  4NDN A;  3OW2 Y;  3CCS 1;  2WB1 A;  3L8C A;  3C5E A;  3S1N I;  4DCV A;  4YY3 C;  3NYR A;  1O92 A;  2PM9 A;  2R7Z I;  4GXR A;  1KD1 2;  1K8A 1;  2LIY A;  2BJO A;  3CCQ 1;  2GTH A;  3R44 A;  3DAY A;  5BST A;  4A3C I;  4B3S C;  4RVD A;  2DYJ A;  3FCE A;  1RO4 A;  2QKD A;  3R9X A;  1X3W A;  5C4X I;  4E32 A;  3CC7 1;  3S1Q I;  4L2Z A;  2HU9 A;  3AF6 A;  1YJ7 A;  4RVN A;  2PRO A;  1NYE A;  1YJ9 1;  1NJI 1;  3CW8 X;  3S82 A;  1N8R 1;  2JS4 A;  3G6E 1;  4Y52 I;  2Y0S A;  1VQ7 1;  4DCS A;  1I3Q I;  1KQS Z;  2PK7 A;  4G1I A;  3JAM b;  1YI2 Z;  2P28 A;  4DCU A;  2V8I A;  3CCU Z;  1Q86 1;  2QEX Z;  3CCE 1;  1M90 2;  4LF9 C;  3CJE A;  4KTV A;  2Q4Z A;  1RQF A;  4A93 I;  3OTO C;  3DLP X;  3GR0 A;  1TWG I;  1NP6 A;  2AYA A;  1YUA A;  3GTJ I;  2R92 I;  2VF1 A;  4MXU A;  5A2Q D;  3VMG A;  3GKQ A;  2VUM I;  4OX9 C;  5KEI A;  1KD1 1;  1IBK C;  3IML A;  5BSV A;  4MD8 A;  3T1H C;  3UZ0 A;  2P20 A;  2EGT A;  5DV9 A;  3BG0 B;  4DR7 C;  2I3C A;  2F4V C;  4A3B I;  3HOU I;  5BUS A;  4JI5 C;  1VQ4 Z;  4L4Q A;  4L7I A;  3ESW A;  2NVX I;  3CCR 1;  3G7S A;  4ZJZ A;  4HGZ A;  1JJ2 Y;  4D56 A;  3RG2 A;  4RV9 A;  3CCV Z;  4OYC A;  1I6H I;  3PO3 I;  1O93 A;  3K7A I;  2RHB A;  3GTP I;  1J5E C;  3NDJ A;  2NVY I;  2V8K A;  1MXC A;  2GU2 A;  1KC8 1;  3IEU A;  1YHQ 1;  1M1K 1;  4LF7 C;  1RG9 A;  2KPI A;  5FLX b;  3EER A;  5T64 A;  2HJG A;  1QM4 A;  1K9M 2;  4IZ6 A;  4DG8 A;  3CPW Z;  1XRC A;  5BSM A;  4A3K I;  3Q87 A;  3S2D I;  4BBS I;  2O4H A;  2E2H I;  1MDF A;  2IZ4 A;  4KTT A;  2QR1 B;  3MZK B;  5C44 I;  4R1L A;  1GPM A;  4XX2 A;  3UOW A;  3A9U A;  3MON A;  3CCS Z;  3CCV 1;  1QYP A;  3LUS A;  1IBM C;  1VQK Z;  3CD6 1;  2QW0 X;  4DV0 C;  1FJG C;  2HHH C;  5KYT A;  1ZH1 A;  2D1T A;  4A3M I;  5T8T A;  5BSW A;  4ODJ A;  4Y7N I;  1MKY A;  4LF5 C;  1VQL 1;  4JM1 A;  3CCM 1;  1QF8 A;  3JAM f;  4RVG A;  3I4M I;  4JYA C;  3ETC A;  2ZAE B;  4LE5 A;  3B7W A;  1AMU A;  1MXA A;  3G4S Z;  3J80 b;  1YJ9 Z;  3G71 1;  1QVG Y;  2Y27 A;  3KXW A;  4BBR I;  2OOY B;  4RVO A;  3OW2 Z;  4RLF A;  5T6B A;  2RIQ A;  1L1O C;  4DG9 A;  2ZM6 C;  3CCJ 1;  3CMA 1;  4RLQ A;  4RS4 A;  4DUY C;  2VQF C;  3IF8 A;  1JWH C;  5CZV A;  5BSR A;  4RVH A;  4GXQ A;  2R93 I;  4D57 A;  2W04 A;  3TUF A;  1VQK 1;  3IFU A;  4BC9 A;  2UUB C;  4MTN A;  4DR3 C;  3PES A;  4JV5 C;  4NB9 A;  2JUB A;  1K73 2;  1YJN 1;  1VQO Z;  1Q81 1;  4WV3 A;  1TWC I;  3I08 A;  2F4O A;  4NBC A;  4TPS B;  4EWC A;  4NFR A;  3NPD A;  5IP9 I;  5LL6 f;  5BSU A;  1VQP 1;  1HNZ C;  3NYQ A;  1QVF Y;  2YU9 I;  3S1M I;  4DV4 C;  1P9N A;  2QVX X;  1QWI A;  2D1Q A;  2GTI A;  3GR1 A;  3GPC A;  3G4S 1;  4DUZ C;  2M6N A;  1HR0 C;  4DR5 C;  2UXD C;  3RZO I;  3CCR Z;  2Y4O A;  4K0B A;  1S7M A;  1Q7Y 2;  5FLX f;  3PO3 S;  1HNX C;  5A19 A;  1VQO 1;  2YAD A;  3GTL I;  1YJW 1;  3TDE A;  3JAM D;  1Y1V I;  3GTM I;  4LF4 C;  1YHQ Z;  4A3G I;  5H9U A;  2E2I I;  4DV6 C;  1Y1W I;  5K85 A;  4AQY C;  1TFI A;  3BG1 B;  2QRE B;  3T1Y C;  1JJ2 Z;  4E2Z A;  2P2M A;  3RZD I;  3J81 f;  1RLY A;  3CCL 1;  4GKJ C;  3QWU A;  4ZLP A;  1N36 C;  2DE5 A;  5FLM I;  5KYV A;  4NBD A;  4NXM C;  4B3T C;  1S72 Z;  2VUG A;  3KIF A;  4QTU A;  1XMO C;  1VQ5 1;  4RVF A;  3H3V J;  1O9T A;  2UUC C;  5JRH A;  1TWA I;  3CD6 Z;  3MZL B;  2OO4 A;  3A4I A;  3VTN A;  3D9X A;  5CZX A;  1N32 C;  2QA4 Z;  1M90 1;  4HH4 A;  1VLA A;  2NVT I;  2OZK A;  1Q82 2;  3FKI I;  2IZ3 A;  5IP7 I;  2OTL 1;  4LFA C;  3R9W A;  4E2Y A;  3HOV I;  3NFZ A;  3I07 A;  1N33 C;  4PRO C;  5T8S A;  3J80 f;  4WS9 A;  3LGX A;  1EGA A;  1VQL Z;  2CXC A;  2E8E A;  4X65 C;  4NBH A;  3CCM Z;  1BA3 A;  1SFO I;  3S14 I;  1YIJ 1;  1VQ8 1;  4EAT A;  2HF1 A;  4ISB A;  4R0M A;  1I94 C;  4KHP C;  3G71 Z;  2P2B A;  3CME 1;  4NOZ A;  3F3P C;  2E7G A;  2WP0 C;  3N54 B;  4DCT A;  5FLX D;  2JA6 I;  3CCJ Z;  3CMA Z;  2G2K A;  1S72 1;  2JA7 I;  1K0R A;  4BCA A;  1HNW C;  2PN2 A;  2YWB A;  2J6A A;  1Z01 A;  2R6M A;  4GS5 A;  2O53 A;  2P2F A;  3N2Q A;  4OXI A;  3VNR A;  4S1T A;  3U50 C;  4X66 C;  2ASB A;  2RBL A;  1W2B Y;  1YJN Z;  2D7V A;  2QA4 1;  4HGY A;  4NB8 A;  2JR6 A;  3I55 1;  4YHH C;  4AYB A;  1K83 I;  3GTG I;  1N34 C;  4FTF A;  3J81 D;  3H2T A;  5IT9 b;  4D4I A;  1QVG Z;  1Q82 1;  1VQP Z;  5AE3 A;  4HPV A;  4LFB C;  2QVY X;  1VQ9 1;  2NVQ I;  1ZB9 A;  4DR2 C;  3D6W A;  4U5Y D;  4NBE A;  2W03 A;  2PMZ A;  2ATW A;  4E2W A;  1K9M 1;  1N2F A;  5BR8 C;  2P3Y A;  1K8A 2;  4BY7 I;  2E0G A;  2H85 A;  3HOX I;  2QVZ X;  3HKZ A;  1WH9 A;  1WW9 A;  2RT9 A;  2OTJ 1;  3A9V A;  4QTT A;  2RPR A;  2DE7 A;  4NH1 C;  5AE2 A;  4K0K C;  3F3F C;  2V8J A;  4NBG A;  1NUI A;  4CL1 A;  1VQ6 1;  3HOY I;  4BSZ A;  2UXC C;  3J80 D;  5ADZ A;  1NJI 2;  1N8R 2;  1XRA A;  2E2J I;  3PRO C;  1YJW Z;  1QVF Z;  4LF6 C;  4MRI A;  1ZB8 A;  2YCB A;  3GTQ I;  2BH1 X;  2LFU A;  5LMU C;  1XNR C;  3I56 1;  1MDB A;  1Y1V S;  4LFC C;  1WII A;  3TE5 B;  1TWH I;  3GTM S;  3J7A 4;  2P02 A;  1FUG A;  4E2X A;  2VZE A;  4BC7 A;  4GKK C;  2AKL A;  2JNY A;  2YWC A;  3SO4 A;  4FUT A;  4JI7 C;  5LMN C;  3CXC Y;  2JA8 I;  4B3M C;  4JI6 C;  4A3I I;  5BUR A;  4DV3 C;  5AE1 A;  3T4N B;  3CCL Z;  5IFI A;  1VQN 1;  1V25 A;  1RNI A;  3HOW I;  3M4O I;  1XRB A;  2D27 A;  1PFT A;  3NH5 A;  4NXN C;  3DHV A;  4TNU A;  1RO2 A;  3FCC A;  5GTD A;  4A3D I;  3PO2 I;  4DV1 C;  1VQ5 Z;  3S17 I;  2D1S A;  4RM3 A;  3LAX A;  3IPL A;  2DE6 A;  3ETO A;  4BXX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...