1ZB8A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
140
Chain Sequence
b'SLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords organic hydroperoxide resistance protein
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
total genus 34
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb8A02
5FLXD 4JI3C 3JAMD 4B3TC 1IBMC 4DR1C 1TWHI 4NBCA 2UU9C 1WW9A 1Y1WI 3AF6A 2JA8I 3ESWA 2KPIA 4DCTA 4JI5C 1XMQC 4LFCC 1TWFI 1L2FA 1HNZC 4A3EI 3HOZI 4JI7C 1VLAA 2UXCC 4DR3C 1K83I 5IP7I 2YCBA 2E8CA 2JNYA 5A2QD 5FLMI 4X64C 4A3DI 1DL6A 3S1QI 4BXXI 4A3CI 3H0GI 5C4JI 1HNWC 2VUMI 4NXNC 4LF7C 1TWCI 4B3MC 2E8EA 3GTJI 4DV6C 3U50C 1XNQC 1K0RA 1XMOC 2DE5A 4NB9A 1X3ZA 3H3VJ 4X65C 1TWAI 5C4XI 2P3YA 3VB9A 1XNRC 2R93I 4NBHA 1WCMI 4LFBC 4BBSI 1SFOI 3T1YC 2RBLA 1N33C 4DV4C 4LF6C 3IEVA 4A3LI 5LMUC 5IWAC 4DV2C 1J5EC 2F4OA 1I50I 1QWIA 3K7AI 4NBGA 4K0KC 2E2HI 4NOZA 4A93I 4GKKC 4XX2A 3GTQI 4YY3C 2R7ZI 4DR4C 4KHPC 3PO3I 1L1OC 2HJGA 1HR0C 1USPB 4GKJC 4A3MI 4Y7NI 4A3FI 4A3KI 2PT7G 3AF5A 3HOWI 2NVQI 4DUZC 2D7VA 2UUCC 2B63I 2BJOA 1TWGI 2AKLA 2OPLB 4BBRI 4YHHC 3OTOC 1PFTA 3HOXI 1NYEA 4DV5C 2VQEC 1N2FA 4A3JI 4B3RC 1USPA 4DR7C 4OX9C 3GTGI 2NVTI 3S14I 1IBLC 3GTLI 3HOVI 2JMPA 1NUIA 2OPLA 4BY7I 4JI4C 4X62C 2J6AA 3VMGA 2ATWA 3S2DI 1I3QI 3D6WA 4JI0C 2PN2A 4LF5C 4DV1C 4QTTA 1I94C 2EGTA 4DV3C 1MKYA 4JYAC 4MTNA 4DUYC 1TFIA 4NXMC 3I07A 1YUAA 3S16I 3R9XA 3GTMI 3S17I 2UUAC 2K5RA 3GTPI 2XR1A 4DV7C 4JI6C 2ONFA 1QYPA 2R92I 2E8FA 3J81D 3GCFA 3T1HC 1WH9A 2DE6A 3EERA 2DYJA 4B3SC 3FKII 2JA7I 4JV5C 1R9TI 3R9WA 2KZFA 4NBBA 1WF3A 4DCVA 1Y1VI 2JS4A 1RLYA 4A3BI 3PO3S 5IP9I 3CQZI 2JA5I 2VQFC 3I4MI 2DE7A 2YU9I 3VMIA 2ZM6C 3GKQA 1IBKC 1HNXC 3J80D 2UUBC 1UKKA 1JOSA 2CY1A 3S1MI 2ASBA 1N34C 1N32C 4BSZA 4DCSA 2NVYI 3S15I 4NBFA 4X66C 4MH4A 5BR8C 4JI1C 4DV0C 5C3EI 1N36C 4NBEA 3RZOI 5C44I 3GTKI 2JA6I 2HF1A 4JI2C 3HOYI 3CJEA 3M3YI 5CM2M 2CXCA 5IT9D 3GKUA 4DCUA 4DR5C 1PA4A 4LFAC 1RO4A 2E7GA 4Y52I 3GTOI 2F4VC 3VMHA 4X6AI 4LF9C 1LQLA 3S2HI 3RZDI 4LF8C 3HOUI 5LMNC 1HH2P 2JR6A 2UXBC 3Q87A 4NBAA 4NBDA 2F4MA 1X3WA 4BY1I 3IEUA 4DR6C 4A3GI 2UXDC 3S1RI 3GTMS 3LUSA 2E5LC 3S1NI 3I4NI 1FJGC 1KKGA 2HHHC 4NB8A 2NVXI 1ZB8A 1ML8A 2QL8A 4QTUA 1ZB9A 3M4OI 2PK7A 3PO2I 1EGAA 4AQYC 2E2II 4DR2C 4JI8C 4A3II 4LF4C 2E2JI 1Y1VS 1I6HI
chains in the Genus database with same CATH superfamily
4RVOA 2LFUA 4DK1A 2E7ZA 3ETOA 1V25A 2PM9A 2JIQA 2QREB 5FLXD 2E0GA 4DG8A 4JI3C 3JAMD 3HKZA 3CMA1 3CC71 3NYRA 4B3TC 1M902 1IBMC 2WD9A 1VQ51 4DR1C 1TWHI 4NBCA 3LNOA 2UU9C 1RO0A 1WW9A 1Y1WI 3AF6A 3N54B 2JA8I 3ESWA 2IZ3A 5BSUA 3CCUZ 2KPIA 1YI2Z 4FTFA 4PROC 4DCTA 3CXCZ 3CCL1 4JI5C 1KD11 1XMQC 3I55Z 5BUQA 2P02A 4LFCC 1TWFI 1L2FA 1YJN1 4TPSB 3CC21 3NFZA 1HNZC 4RVHA 3J81f 1Q862 1VQM1 4E30A 4A3EI 1WZNA 1M901 3HOZI 3J7A4 3CCJZ 4JI7C 3G4SZ 1VLAA 2UXCC 4DR3C 1M1K2 1K83I 5IP7I 1LCIA 2P2FA 5LCIA 2V7BA 2YCBA 4NDNA 1VQ4Z 2E8CA 5A1GA 4FUTA 4MXUA 2QLVB 2JNYA 5T6BA 2Y4OA 2OTLZ 5AE1A 5A2QD 4R1MA 5FLMI 1Q861 2AYAA 1V26A 4LE5A 5E7QA 2YWCA 4X64C 4GS5A 4A3DI 3A9VA 2GU2A 1DL6A 3S1QI 1Q811 1FDIA 3CCU1 4BXXI 1YI21 4A3CI 1WCJA 3H0GI 5C4JI 2W04A 3F3FC 1P4EC 2VPYA 3I551 1HNWC 1JJ2Z 2VUMI 2P20A 4D4IA 3CQ1A 2QVYX 4NXNC 3CCQ1 2OZKA 1JJ2Y 1XS3A 3CCJ1 4LF7C 2O53A 2V8KA 3G4S1 3JAMb 3NI2A 1TWCI 1P7LA 1Z02A 1K731 3J80b 4B3MC 2CU6A 2V3VA 3FQMA 2NAPA 2E8EA 2QVZX 4BCAA 3GTJI 1Z03A 2JMOA 3CQ2A 1K8A1 1NY8A 4DV6C 3U50C 3L8CA 2P2MA 1XNQC 1K0RA 4PZPA 2OTL1 4ODJA 2DE5A 4NB9A 1MDBA 3CMEZ 1XMOC 1X3ZA 1YIJZ 3H3VJ 1YHQ1 2AYDA 4ZJZA 5ADZA 2BH1X 4RS4A 4X65C 1TWAI 2V45A 5C4XI 1W2BY 3C5EA 4IZ6A 2P3YA 4R1LA 3PBKA 3VB9A 1XNRC 2R93I 2H85A 3DAYA 4RVFA 1RG9A 4NBHA 1WCMI 4LFBC 1N8R2 4BBSI 1MXAA 4MD9A 1SFOI 2MMAB 3T1YC 2RBLA 1VQKZ 3E7WA 1N33C 4DV4C 4LF6C 1VQ91 1RY2A 4BC7A 3IEVA 4A3LI 5LMUC 3D2LA 5IWAC 4DV2C 4I9FA 1J5EC 2M6NA 4BBYA 2P2QA 2F4OA 3E7XA 5IT9b 3T4NB 1I50I 4R0MA 4AYBA 1QWIA 2OTJ1 3CME1 3GPCA 3CW8X 3MZKB 1YJW1 1VQP1 4D57A 3K7AI 4NBGA 4K0KC 2E2HI 4NOZA 4A93I 2NCLA 4GKKC 1S72Z 1VEHA 4XX2A 3GTQI 4YY3C 5A19A 2R7ZI 4DR4C 3GR0A 4KHPC 3PO3I 1L1OC 1BA3A 2HJGA 3LAXA 1HR0C 3OW2Y 1XHJA 4HPVA 1USPB 4GKJC 1KD12 4A3MI 4Y7NI 4A3FI 4A3KI 2KI7B 3P5JB 1XRCA 3CPWZ 1P9NA 1VQK1 1JWHC 3FQQA 2PT7G 1UWDA 2DHMA 3CPWY 3AF5A 3H2TA 3L95X 4G37A 3HOWI 2V8IA 1P4EA 4E2XA 1Q822 4K0BA 2NVQI 1YIT1 4RLFA 5A1IA 4DUZC 2D7VA 5BSVA 2RPRA 2UUCC 2B63I 2BJOA 4ISBA 5D1OA 2RIQA 2W03A 1AA6A 2ZZNA 3SO4A 1TWGI 2AKLA 2OPLB 4BBRI 2Y0SA 4YHHC 3OTOC 5AN9F 1PFTA 1WIIA 2MCQA 1PG3A 3EQ6A 4S1TA 3LGXA 3PESA 5T67A 1Q821 4RLQA 1AMUA 3HOXI 1PU1A 4EWCA 1S721 2QR1B 1GPMA 2M5OA 2OOYB 1Q812 1NYEA 4DV5C 2VQEC 3IMLA 1T5DX 4BC9A 2D1QA 5D1PA 1N2FA 3NPDA 2E9HA 2QW0X 2KDNA 1YUKA 4A3JI 1USPA 2D1SA 4B3RC 4DR7C 4OX9C 1V60A 4PHTA 2M5HA 3GTGI 3I56Z 3CCEZ 3TUFA 2NVTI 3S14I 5BSMA 3MZLB 3NH8A 1K732 4ZLPA 4WS9A 1IBLC 3CCRZ 3GTLI 1NJI2 3A25A 3A9UA 3HOVI 1K8A2 2JMPA 1NUIA 1VQ6Z 2Z51A 3CW9A 2OPLA 4BY7I 4JI4C 4X62C 1KQSY 4HGYA 5FLXb 4E32A 4G1IA 5K8FA 2J6AA 4OXIA 2V8JA 3NH5A 3VMGA 5FLXf 4D56A 2ATWA 4MONA 3DHVA 3S2DI 3JAMf 4E2YA 2DPLA 5KEIA 1I3QI 3J80f 3D6WA 1NJI1 2Q51A 1VQ41 4IR7A 4JI0C 2PN2A 4E33A 3CCVZ 3IPLA 4LF5C 2RT9A 4DV1C 4QTTA 1I94C 1RO2A 2EGTA 4DV3C 3NDJA 5AE3A 1T5HX 2WAQA 2OBVA 5CZXA 1MKYA 4JYAC 1VQLZ 4MTNA 1VQ8Z 3I561 3CCE1 1W2BZ 4DUYC 1TFIA 2K3RA 5BSTA 4NXMC 3I07A 3CD6Z 1YUAA 3S16I 5T8SA 3R9XA 5JRHA 3GTMI 3GR1A 4HH4A 2OO4A 1X0TA 1VQ61 3S17I 1K9M2 4L4QA 2UUAC 3PROC 2LEXA 4RM2A 2K5RA 2VPWA 2WP0C 3GTPI 2XR1A 4DV7C 4JI6C 2PROA 2JIMA 2ZAEB 2ONFA 3IR7A 1Q16A 4WV3A 3TE5B 3DLPX 1QYPA 3VNSA 1MD9A 2R92I 5A2Qb 5K85A 2E8FA 3J81D 2VUGA 2IV2X 3GCFA 4L7IA 1WH9A 3T1HC 4D4GA 1QVGZ 1K9M1 2O4HA 5IT9f 3A26A 1QVGY 3FCCA 1YIJ1 2DE6A 3UX2A 3G71Z 3EERA 1ULTA 1QVFY 2DYJA 4B3SC 3FKII 1VQ81 2JA7I 2JIOA 2D1TA 4RMNA 3TDHB 4JV5C 1R9TI 1YJ9Z 2D1RA 3R9WA 1VQ5Z 3CD61 1QM4A 4MD8A 2KZFA 3NH4A 4NBBA 3OW2Z 3VTNA 1WF3A 2D28C 4DCVA 3IF8A 1Y1VI 2JS4A 5KYTA 3CCLZ 1IB8A 3S82A 4FUQA 1RLYA 2M48A 4A3BI 1VQNZ 3RV2A 3B7WA 2G2KA 3CC2Z 2QVXX 5T8TA 3PO3S 5IP9I 1VQMZ 1VQOZ 3CQZI 2LIYA 4E31A 2VF1A 2JA5I 4KTVA 1FUGA 2VQFC 3I4MI 2DE7A 1Q7Y2 2YU9I 3KIFA 2Y4NA 5BUSA 1M6XC 4RVNA 2GTIA 3VMIA 4RVDA 2VSQA 3KIHA 2QRDB 1MDFA 2ZM6C 3GKQA 3G711 1IBKC 1HNXC 4JM1A 3J80D 3MONA 2UUBC 3BG1B 3QWUA 1UKKA 3CQ3A 5DV9A 1YJ91 4HGZA 3G6EZ 2YADA 5T64A 3CCMZ 1RNIA 1Q7Y1 1JOSA 2Y27A 5H9UA 2CY1A 3S1MI 2ASBA 5CZVA 1N34C 2YWBA 4PUIA 1N32C 4BSZA 4DCSA 2RHBA 2NVYI 3S15I 4NBFA 4GXQA 3CXCY 4MH4A 4X66C 3AY0A 5BR8C 3J81b 4JI1C 1VQN1 4DV0C 4I9GA 5C3EI 2ZZMA 3A4IA 4PUGA 1VQO1 3ETCA 3CCQZ 4DGLA 1N36C 5BSRA 4NBEA 3RZOI 1YJ7A 3TDEA 3VNQA 2Q4ZA 4DQYB 1O93A 2GTHA 5C44I 2P2BA 2HU9A 1KRLA 3UZ0A 2VPZA 4MD7A 2JA6I 3GTKI 2HF1A 3O2EA 4JI2C 1KQSZ 3KXWA 3BG0B 3CCSZ 1KC82 3HOYI 3CJEA 4CL1A 1FDOA 3NDIA 3M3YI 4KTTA 5CM2M 2VPXA 3G6E1 1YHQZ 2CXCA 5IT9D 2D27A 3GKUA 3TQIA 1QXFA 4RV9A 3R44A 4DCUA 3TR3A 4DR5C 1PA4A 1M1K1 3CCM1 2QA4Z 3NYQA 4TNUA 2JIRA 1VQ7Z 4LFAC 3I08A 1XRAA 1RO4A 2QRCB 4RM3A 2E7GA 4Y52I 1O9TA 3G7SA 3GTOI 5KYVA 2F4VC 1KC81 2QKDA 3CC4Z 3VMHA 1Z01A 5LL6f 4X6AI 4LF9C 1LQLA 1ZH1A 1VQ9Z 3S2HI 1O90A 4NH1C 3RZDI 1PG4A 4LF8C 3CCR1 4OYCA 1WJ2A 3IFUA 3HOUI 5LMNC 1HH2P 3IX0A 1MXBA 2JR6A 2UXBC 3Q87A 3F3PC 1X3WA 4NBAA 2F4MA 4NBDA 4BY1I 1O92A 3IEUA 3UEBA 4DR6C 1S7MA 1Y8CA 4A3GI 3RG2A 3CCS1 2OTJZ 3N2QA 2UXDC 2P2JA 2IZ4A 3EEDA 5AE2A 1M6XA 3S1RI 4L2ZA 1YJWZ 1VQPZ 3GTMS 2QEXZ 4DG9A 3LUSA 2R6MA 4E2WA 3K6RA 2E5LC 2QA41 3S1NI 4U5YD 1VQ71 3I4NI 5A2Qf 1FJGC 1KKGA 4NFRA 4MRIA 3CCV1 1NP6A 2P28A 3UX3A 1QVFZ 2HHHC 4NB8A 2NVXI 5BURA 4E2ZA 3CMAZ 1VQL1 3CC41 1ZB8A 2WB1A 2I3CA 1ML8A 3CC7Z 2QL8A 4QTUA 1ZB9A 3M4OI 4GXRA 3FCEA 2PK7A 3VNRA 5D1OB 3PO2I 2JNVA 1YITZ 1EGAA 2MM9A 1RQFA 2VZEA 4AQYC 2E2II 1TH5A 1QF8A 4PUHA 4DR2C 2YX1A 2OOXB 1N8R1 5GTDA 4EATA 3LNVA 1MXCA 4RVGA 4JI8C 4G36A 1YJNZ 5IFIA 2JIPA 4A3II 4LF4C 2E2JI 2QEX1 3UOWA 1FLOA 2KZ0A 1SIWA 1Y1VS 3D9XA 5BSWA 1XRBA 2PMZA 1I6HI 2JUBA
chains in the Genus database with same CATH topology
4RVOA 2LFUA 4DK1A 3ETOA 1V25A 2PM9A 2QREB 5FLXD 2E0GA 4DG8A 4JI3C 3JAMD 3HKZA 3CMA1 3CC71 3NYRA 4B3TC 1M902 1IBMC 2WD9A 1VQ51 4DR1C 1TWHI 4NBCA 2UU9C 1RO0A 1WW9A 1Y1WI 3AF6A 3N54B 2JA8I 3ESWA 2IZ3A 5BSUA 3CCUZ 2KPIA 1YI2Z 4FTFA 4PROC 4DCTA 3CXCZ 3CCL1 4JI5C 1KD11 1XMQC 3I55Z 5BUQA 2P02A 4LFCC 1TWFI 1L2FA 1YJN1 4TPSB 3CC21 3NFZA 1HNZC 4RVHA 3J81f 1Q862 1VQM1 4E30A 4A3EI 1M901 3HOZI 3J7A4 3CCJZ 4JI7C 3G4SZ 1VLAA 2UXCC 4DR3C 1M1K2 1K83I 5IP7I 1LCIA 2P2FA 2V7BA 2YCBA 4NDNA 1VQ4Z 2E8CA 5A1GA 4FUTA 4MXUA 2QLVB 2JNYA 5T6BA 2Y4OA 2OTLZ 5AE1A 5A2QD 4R1MA 5FLMI 1Q861 2AYAA 1V26A 4LE5A 5E7QA 2YWCA 4X64C 4GS5A 4A3DI 3A9VA 2GU2A 1DL6A 3S1QI 1Q811 3CCU1 4BXXI 1YI21 4A3CI 3H0GI 5C4JI 2W04A 3F3FC 3I551 1HNWC 1JJ2Z 2VUMI 2P20A 4D4IA 2QVYX 4NXNC 3CCQ1 2OZKA 1JJ2Y 3CCJ1 4LF7C 2O53A 2V8KA 3G4S1 3JAMb 3NI2A 1TWCI 1P7LA 1Z02A 1K731 3J80b 4B3MC 3FQMA 2E8EA 2QVZX 4BCAA 3GTJI 1Z03A 2JMOA 4DV6C 1K8A1 3U50C 3L8CA 2P2MA 1XNQC 1K0RA 4PZPA 2OTL1 4ODJA 2DE5A 4NB9A 1MDBA 3CMEZ 1XMOC 1X3ZA 1YIJZ 3H3VJ 1YHQ1 4ZJZA 5ADZA 2BH1X 4RS4A 4X65C 1TWAI 5C4XI 1W2BY 3C5EA 4IZ6A 2P3YA 4R1LA 3PBKA 3VB9A 1XNRC 2R93I 2H85A 3DAYA 4RVFA 1RG9A 4NBHA 1WCMI 4LFBC 1N8R2 4BBSI 1MXAA 4MD9A 1SFOI 3T1YC 2RBLA 1VQKZ 3E7WA 1N33C 4DV4C 4LF6C 1VQ91 1RY2A 4BC7A 3IEVA 4A3LI 5LMUC 5IWAC 4DV2C 4I9FA 1J5EC 2M6NA 4BBYA 2P2QA 2F4OA 3E7XA 5IT9b 3T4NB 1I50I 4R0MA 4AYBA 1QWIA 2OTJ1 3CME1 3GPCA 3CW8X 3MZKB 1YJW1 1VQP1 4D57A 3K7AI 4NBGA 4K0KC 2E2HI 4NOZA 4A93I 4GKKC 1S72Z 4XX2A 3GTQI 4YY3C 5A19A 2R7ZI 4DR4C 3GR0A 4KHPC 3PO3I 1L1OC 1BA3A 2HJGA 3LAXA 1HR0C 3OW2Y 4HPVA 1USPB 4GKJC 1KD12 4A3MI 4Y7NI 4A3FI 4A3KI 2KI7B 3P5JB 1XRCA 3CPWZ 1P9NA 1VQK1 1JWHC 3FQQA 2PT7G 3CPWY 3AF5A 3H2TA 3L95X 4G37A 3HOWI 2V8IA 4E2XA 1Q822 4K0BA 2NVQI 1YIT1 4RLFA 5A1IA 4DUZC 2D7VA 5BSVA 2RPRA 2UUCC 2B63I 2BJOA 4ISBA 5D1OA 2RIQA 2W03A 3SO4A 1TWGI 2AKLA 2OPLB 4BBRI 2Y0SA 4YHHC 3OTOC 5AN9F 1PFTA 1WIIA 1PG3A 3EQ6A 4S1TA 3LGXA 3PESA 5T67A 1Q821 4RLQA 1AMUA 3HOXI 4EWCA 1S721 2QR1B 1GPMA 2OOYB 1Q812 1NYEA 4DV5C 2VQEC 3IMLA 1T5DX 4BC9A 2D1QA 5D1PA 1N2FA 3NPDA 2E9HA 2QW0X 1YUKA 4A3JI 1USPA 2D1SA 4B3RC 4DR7C 4OX9C 4PHTA 3GTGI 3I56Z 3CCEZ 3TUFA 2NVTI 3S14I 5BSMA 3MZLB 3NH8A 1K732 4ZLPA 4WS9A 1IBLC 3CCRZ 3GTLI 1NJI2 3A9UA 3HOVI 1K8A2 2JMPA 1NUIA 1VQ6Z 3CW9A 2OPLA 4BY7I 4JI4C 4X62C 1KQSY 4HGYA 5FLXb 4E32A 4G1IA 5K8FA 2J6AA 4OXIA 2V8JA 3NH5A 3VMGA 5FLXf 4D56A 2ATWA 4MONA 3DHVA 3S2DI 3JAMf 4E2YA 2DPLA 5KEIA 1I3QI 3J80f 3D6WA 1NJI1 2Q51A 1VQ41 4IR7A 4JI0C 2PN2A 4E33A 3CCVZ 3IPLA 4LF5C 2RT9A 4DV1C 4QTTA 1I94C 1RO2A 2EGTA 4DV3C 3NDJA 5AE3A 1T5HX 2WAQA 2OBVA 5CZXA 1MKYA 4JYAC 1VQLZ 4MTNA 1VQ8Z 3I561 3CCE1 1W2BZ 4DUYC 1TFIA 2K3RA 5BSTA 4NXMC 3I07A 3CD6Z 1YUAA 3S16I 5T8SA 3R9XA 5JRHA 3GTMI 3GR1A 4HH4A 2OO4A 1X0TA 1VQ61 3S17I 1K9M2 4L4QA 2UUAC 3PROC 4RM2A 2K5RA 2WP0C 3GTPI 2XR1A 4DV7C 4JI6C 2PROA 2ZAEB 2ONFA 4WV3A 3TE5B 3DLPX 1QYPA 3VNSA 1MD9A 2R92I 5A2Qb 5K85A 2E8FA 3J81D 2VUGA 3GCFA 4L7IA 1WH9A 3T1HC 4D4GA 1QVGZ 1K9M1 2O4HA 5IT9f 1QVGY 3FCCA 1YIJ1 2DE6A 3G71Z 3EERA 1ULTA 1QVFY 2DYJA 4B3SC 3FKII 1VQ81 2JA7I 2D1TA 4RMNA 4JV5C 3TDHB 1R9TI 1YJ9Z 2D1RA 3R9WA 1VQ5Z 3CD61 1QM4A 4MD8A 2KZFA 3NH4A 4NBBA 3OW2Z 3VTNA 1WF3A 2D28C 4DCVA 3IF8A 1Y1VI 2JS4A 5KYTA 3CCLZ 3S82A 4FUQA 1RLYA 2M48A 4A3BI 1VQNZ 3RV2A 3B7WA 2G2KA 3CC2Z 2QVXX 5T8TA 3PO3S 5IP9I 1VQMZ 1VQOZ 3CQZI 2LIYA 4E31A 2VF1A 2JA5I 4KTVA 1FUGA 2VQFC 3I4MI 2DE7A 1Q7Y2 2YU9I 3KIFA 2Y4NA 5BUSA 4RVNA 2GTIA 3VMIA 4RVDA 2VSQA 3KIHA 2QRDB 1MDFA 2ZM6C 3GKQA 3G711 1IBKC 1HNXC 4JM1A 3J80D 3MONA 2UUBC 3BG1B 3QWUA 1UKKA 5DV9A 1YJ91 4HGZA 3G6EZ 2YADA 5T64A 3CCMZ 1RNIA 1Q7Y1 1JOSA 2Y27A 5H9UA 2CY1A 3S1MI 2ASBA 5CZVA 1N34C 2YWBA 1N32C 4BSZA 4DCSA 2RHBA 2NVYI 3S15I 4NBFA 4GXQA 3CXCY 4MH4A 4X66C 5BR8C 3J81b 4JI1C 1VQN1 4DV0C 4I9GA 5C3EI 3A4IA 1VQO1 3ETCA 3CCQZ 4DGLA 1N36C 5BSRA 4NBEA 3RZOI 1YJ7A 3TDEA 3VNQA 2Q4ZA 4DQYB 1O93A 2GTHA 5C44I 2P2BA 2HU9A 1KRLA 3UZ0A 3GTKI 4MD7A 2JA6I 2HF1A 4JI2C 1KQSZ 3KXWA 3BG0B 3CCSZ 1KC82 3HOYI 3CJEA 4CL1A 4KTTA 3NDIA 3M3YI 5CM2M 1YHQZ 3G6E1 2CXCA 5IT9D 2D27A 3GKUA 3TQIA 4RV9A 3R44A 4DCUA 4DR5C 1PA4A 1M1K1 3CCM1 2QA4Z 3NYQA 4TNUA 1VQ7Z 4LFAC 3I08A 1XRAA 1RO4A 2QRCB 4RM3A 2E7GA 4Y52I 1O9TA 3G7SA 3GTOI 5KYVA 2F4VC 1KC81 2QKDA 3CC4Z 3VMHA 1Z01A 5LL6f 4X6AI 4LF9C 1LQLA 1ZH1A 1VQ9Z 3S2HI 1O90A 4NH1C 3RZDI 1PG4A 4LF8C 3CCR1 4OYCA 3IFUA 3HOUI 5LMNC 1HH2P 3IX0A 1MXBA 2JR6A 2UXBC 3Q87A 3F3PC 1X3WA 4NBAA 2F4MA 4NBDA 4BY1I 1O92A 3IEUA 4DR6C 1S7MA 4A3GI 3RG2A 3CCS1 2OTJZ 3N2QA 2UXDC 2P2JA 2IZ4A 3EEDA 5AE2A 3S1RI 4L2ZA 1YJWZ 1VQPZ 3GTMS 2QEXZ 4DG9A 3LUSA 2R6MA 4E2WA 2E5LC 2QA41 3S1NI 4U5YD 1VQ71 3I4NI 5A2Qf 1FJGC 1KKGA 4NFRA 4MRIA 3CCV1 1NP6A 2P28A 1QVFZ 2HHHC 4NB8A 2NVXI 5BURA 4E2ZA 3CMAZ 1VQL1 1ZB8A 3CC41 2WB1A 2I3CA 1ML8A 3CC7Z 2QL8A 4QTUA 1ZB9A 3M4OI 4GXRA 3FCEA 2PK7A 3VNRA 5D1OB 3PO2I 1YITZ 1EGAA 1RQFA 2VZEA 4AQYC 2E2II 1QF8A 4DR2C 2OOXB 1N8R1 5GTDA 4EATA 3LNVA 1MXCA 4RVGA 4JI8C 4G36A 1YJNZ 5IFIA 4A3II 4LF4C 2E2JI 2QEX1 3UOWA 1Y1VS 3D9XA 5BSWA 1XRBA 2PMZA 1I6HI 2JUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLX D;  4JI3 C;  3JAM D;  4B3T C;  1IBM C;  4DR1 C;  1TWH I;  4NBC A;  2UU9 C;  1WW9 A;  1Y1W I;  3AF6 A;  2JA8 I;  3ESW A;  2KPI A;  4DCT A;  4JI5 C;  1XMQ C;  4LFC C;  1TWF I;  1L2F A;  1HNZ C;  4A3E I;  3HOZ I;  4JI7 C;  1VLA A;  2UXC C;  4DR3 C;  1K83 I;  5IP7 I;  2YCB A;  2E8C A;  2JNY A;  5A2Q D;  5FLM I;  4X64 C;  4A3D I;  1DL6 A;  3S1Q I;  4BXX I;  4A3C I;  3H0G I;  5C4J I;  1HNW C;  2VUM I;  4NXN C;  4LF7 C;  1TWC I;  4B3M C;  2E8E A;  3GTJ I;  4DV6 C;  3U50 C;  1XNQ C;  1K0R A;  1XMO C;  2DE5 A;  4NB9 A;  1X3Z A;  3H3V J;  4X65 C;  1TWA I;  5C4X I;  2P3Y A;  3VB9 A;  1XNR C;  2R93 I;  4NBH A;  1WCM I;  4LFB C;  4BBS I;  1SFO I;  3T1Y C;  2RBL A;  1N33 C;  4DV4 C;  4LF6 C;  3IEV A;  4A3L I;  5LMU C;  5IWA C;  4DV2 C;  1J5E C;  2F4O A;  1I50 I;  1QWI A;  3K7A I;  4NBG A;  4K0K C;  2E2H I;  4NOZ A;  4A93 I;  4GKK C;  4XX2 A;  3GTQ I;  4YY3 C;  2R7Z I;  4DR4 C;  4KHP C;  3PO3 I;  1L1O C;  2HJG A;  1HR0 C;  1USP B;  4GKJ C;  4A3M I;  4Y7N I;  4A3F I;  4A3K I;  2PT7 G;  3AF5 A;  3HOW I;  2NVQ I;  4DUZ C;  2D7V A;  2UUC C;  2B63 I;  2BJO A;  1TWG I;  2AKL A;  2OPL B;  4BBR I;  4YHH C;  3OTO C;  1PFT A;  3HOX I;  1NYE A;  4DV5 C;  2VQE C;  1N2F A;  4A3J I;  4B3R C;  1USP A;  4DR7 C;  4OX9 C;  3GTG I;  2NVT I;  3S14 I;  1IBL C;  3GTL I;  3HOV I;  2JMP A;  1NUI A;  2OPL A;  4BY7 I;  4JI4 C;  4X62 C;  2J6A A;  3VMG A;  2ATW A;  3S2D I;  1I3Q I;  3D6W A;  4JI0 C;  2PN2 A;  4LF5 C;  4DV1 C;  4QTT A;  1I94 C;  2EGT A;  4DV3 C;  1MKY A;  4JYA C;  4MTN A;  4DUY C;  1TFI A;  4NXM C;  3I07 A;  1YUA A;  3S16 I;  3R9X A;  3GTM I;  3S17 I;  2UUA C;  2K5R A;  3GTP I;  2XR1 A;  4DV7 C;  4JI6 C;  2ONF A;  1QYP A;  2R92 I;  2E8F A;  3J81 D;  3GCF A;  3T1H C;  1WH9 A;  2DE6 A;  3EER A;  2DYJ A;  4B3S C;  3FKI I;  2JA7 I;  4JV5 C;  1R9T I;  3R9W A;  2KZF A;  4NBB A;  1WF3 A;  4DCV A;  1Y1V I;  2JS4 A;  1RLY A;  4A3B I;  3PO3 S;  5IP9 I;  3CQZ I;  2JA5 I;  2VQF C;  3I4M I;  2DE7 A;  2YU9 I;  3VMI A;  2ZM6 C;  3GKQ A;  1IBK C;  1HNX C;  3J80 D;  2UUB C;  1UKK A;  1JOS A;  2CY1 A;  3S1M I;  2ASB A;  1N34 C;  1N32 C;  4BSZ A;  4DCS A;  2NVY I;  3S15 I;  4NBF A;  4X66 C;  4MH4 A;  5BR8 C;  4JI1 C;  4DV0 C;  5C3E I;  1N36 C;  4NBE A;  3RZO I;  5C44 I;  3GTK I;  2JA6 I;  2HF1 A;  4JI2 C;  3HOY I;  3CJE A;  3M3Y I;  5CM2 M;  2CXC A;  5IT9 D;  3GKU A;  4DCU A;  4DR5 C;  1PA4 A;  4LFA C;  1RO4 A;  2E7G A;  4Y52 I;  3GTO I;  2F4V C;  3VMH A;  4X6A I;  4LF9 C;  1LQL A;  3S2H I;  3RZD I;  4LF8 C;  3HOU I;  5LMN C;  1HH2 P;  2JR6 A;  2UXB C;  3Q87 A;  4NBA A;  4NBD A;  2F4M A;  1X3W A;  4BY1 I;  3IEU A;  4DR6 C;  4A3G I;  2UXD C;  3S1R I;  3GTM S;  3LUS A;  2E5L C;  3S1N I;  3I4N I;  1FJG C;  1KKG A;  2HHH C;  4NB8 A;  2NVX I;  1ZB8 A;  1ML8 A;  2QL8 A;  4QTU A;  1ZB9 A;  3M4O I;  2PK7 A;  3PO2 I;  1EGA A;  4AQY C;  2E2I I;  4DR2 C;  4JI8 C;  4A3I I;  4LF4 C;  2E2J I;  1Y1V S;  1I6H I; 
#chains in the Genus database with same CATH topology
 4RVO A;  2LFU A;  4DK1 A;  2E7Z A;  3ETO A;  1V25 A;  2PM9 A;  2JIQ A;  2QRE B;  5FLX D;  2E0G A;  4DG8 A;  4JI3 C;  3JAM D;  3HKZ A;  3CMA 1;  3CC7 1;  3NYR A;  4B3T C;  1M90 2;  1IBM C;  2WD9 A;  1VQ5 1;  4DR1 C;  1TWH I;  4NBC A;  3LNO A;  2UU9 C;  1RO0 A;  1WW9 A;  1Y1W I;  3AF6 A;  3N54 B;  2JA8 I;  3ESW A;  2IZ3 A;  5BSU A;  3CCU Z;  2KPI A;  1YI2 Z;  4FTF A;  4PRO C;  4DCT A;  3CXC Z;  3CCL 1;  4JI5 C;  1KD1 1;  1XMQ C;  3I55 Z;  5BUQ A;  2P02 A;  4LFC C;  1TWF I;  1L2F A;  1YJN 1;  4TPS B;  3CC2 1;  3NFZ A;  1HNZ C;  4RVH A;  3J81 f;  1Q86 2;  1VQM 1;  4E30 A;  4A3E I;  1WZN A;  1M90 1;  3HOZ I;  3J7A 4;  3CCJ Z;  4JI7 C;  3G4S Z;  1VLA A;  2UXC C;  4DR3 C;  1M1K 2;  1K83 I;  5IP7 I;  1LCI A;  2P2F A;  5LCI A;  2V7B A;  2YCB A;  4NDN A;  1VQ4 Z;  2E8C A;  5A1G A;  4FUT A;  4MXU A;  2QLV B;  2JNY A;  5T6B A;  2Y4O A;  2OTL Z;  5AE1 A;  5A2Q D;  4R1M A;  5FLM I;  1Q86 1;  2AYA A;  1V26 A;  4LE5 A;  5E7Q A;  2YWC A;  4X64 C;  4GS5 A;  4A3D I;  3A9V A;  2GU2 A;  1DL6 A;  3S1Q I;  1Q81 1;  1FDI A;  3CCU 1;  4BXX I;  1YI2 1;  4A3C I;  1WCJ A;  3H0G I;  5C4J I;  2W04 A;  3F3F C;  1P4E C;  2VPY A;  3I55 1;  1HNW C;  1JJ2 Z;  2VUM I;  2P20 A;  4D4I A;  3CQ1 A;  2QVY X;  4NXN C;  3CCQ 1;  2OZK A;  1JJ2 Y;  1XS3 A;  3CCJ 1;  4LF7 C;  2O53 A;  2V8K A;  3G4S 1;  3JAM b;  3NI2 A;  1TWC I;  1P7L A;  1Z02 A;  1K73 1;  3J80 b;  4B3M C;  2CU6 A;  2V3V A;  3FQM A;  2NAP A;  2E8E A;  2QVZ X;  4BCA A;  3GTJ I;  1Z03 A;  2JMO A;  3CQ2 A;  1K8A 1;  1NY8 A;  4DV6 C;  3U50 C;  3L8C A;  2P2M A;  1XNQ C;  1K0R A;  4PZP A;  2OTL 1;  4ODJ A;  2DE5 A;  4NB9 A;  1MDB A;  3CME Z;  1XMO C;  1X3Z A;  1YIJ Z;  3H3V J;  1YHQ 1;  2AYD A;  4ZJZ A;  5ADZ A;  2BH1 X;  4RS4 A;  4X65 C;  1TWA I;  2V45 A;  5C4X I;  1W2B Y;  3C5E A;  4IZ6 A;  2P3Y A;  4R1L A;  3PBK A;  3VB9 A;  1XNR C;  2R93 I;  2H85 A;  3DAY A;  4RVF A;  1RG9 A;  4NBH A;  1WCM I;  4LFB C;  1N8R 2;  4BBS I;  1MXA A;  4MD9 A;  1SFO I;  2MMA B;  3T1Y C;  2RBL A;  1VQK Z;  3E7W A;  1N33 C;  4DV4 C;  4LF6 C;  1VQ9 1;  1RY2 A;  4BC7 A;  3IEV A;  4A3L I;  5LMU C;  3D2L A;  5IWA C;  4DV2 C;  4I9F A;  1J5E C;  2M6N A;  4BBY A;  2P2Q A;  2F4O A;  3E7X A;  5IT9 b;  3T4N B;  1I50 I;  4R0M A;  4AYB A;  1QWI A;  2OTJ 1;  3CME 1;  3GPC A;  3CW8 X;  3MZK B;  1YJW 1;  1VQP 1;  4D57 A;  3K7A I;  4NBG A;  4K0K C;  2E2H I;  4NOZ A;  4A93 I;  2NCL A;  4GKK C;  1S72 Z;  1VEH A;  4XX2 A;  3GTQ I;  4YY3 C;  5A19 A;  2R7Z I;  4DR4 C;  3GR0 A;  4KHP C;  3PO3 I;  1L1O C;  1BA3 A;  2HJG A;  3LAX A;  1HR0 C;  3OW2 Y;  1XHJ A;  4HPV A;  1USP B;  4GKJ C;  1KD1 2;  4A3M I;  4Y7N I;  4A3F I;  4A3K I;  2KI7 B;  3P5J B;  1XRC A;  3CPW Z;  1P9N A;  1VQK 1;  1JWH C;  3FQQ A;  2PT7 G;  1UWD A;  2DHM A;  3CPW Y;  3AF5 A;  3H2T A;  3L95 X;  4G37 A;  3HOW I;  2V8I A;  1P4E A;  4E2X A;  1Q82 2;  4K0B A;  2NVQ I;  1YIT 1;  4RLF A;  5A1I A;  4DUZ C;  2D7V A;  5BSV A;  2RPR A;  2UUC C;  2B63 I;  2BJO A;  4ISB A;  5D1O A;  2RIQ A;  2W03 A;  1AA6 A;  2ZZN A;  3SO4 A;  1TWG I;  2AKL A;  2OPL B;  4BBR I;  2Y0S A;  4YHH C;  3OTO C;  5AN9 F;  1PFT A;  1WII A;  2MCQ A;  1PG3 A;  3EQ6 A;  4S1T A;  3LGX A;  3PES A;  5T67 A;  1Q82 1;  4RLQ A;  1AMU A;  3HOX I;  1PU1 A;  4EWC A;  1S72 1;  2QR1 B;  1GPM A;  2M5O A;  2OOY B;  1Q81 2;  1NYE A;  4DV5 C;  2VQE C;  3IML A;  1T5D X;  4BC9 A;  2D1Q A;  5D1P A;  1N2F A;  3NPD A;  2E9H A;  2QW0 X;  2KDN A;  1YUK A;  4A3J I;  1USP A;  2D1S A;  4B3R C;  4DR7 C;  4OX9 C;  1V60 A;  4PHT A;  2M5H A;  3GTG I;  3I56 Z;  3CCE Z;  3TUF A;  2NVT I;  3S14 I;  5BSM A;  3MZL B;  3NH8 A;  1K73 2;  4ZLP A;  4WS9 A;  1IBL C;  3CCR Z;  3GTL I;  1NJI 2;  3A25 A;  3A9U A;  3HOV I;  1K8A 2;  2JMP A;  1NUI A;  1VQ6 Z;  2Z51 A;  3CW9 A;  2OPL A;  4BY7 I;  4JI4 C;  4X62 C;  1KQS Y;  4HGY A;  5FLX b;  4E32 A;  4G1I A;  5K8F A;  2J6A A;  4OXI A;  2V8J A;  3NH5 A;  3VMG A;  5FLX f;  4D56 A;  2ATW A;  4MON A;  3DHV A;  3S2D I;  3JAM f;  4E2Y A;  2DPL A;  5KEI A;  1I3Q I;  3J80 f;  3D6W A;  1NJI 1;  2Q51 A;  1VQ4 1;  4IR7 A;  4JI0 C;  2PN2 A;  4E33 A;  3CCV Z;  3IPL A;  4LF5 C;  2RT9 A;  4DV1 C;  4QTT A;  1I94 C;  1RO2 A;  2EGT A;  4DV3 C;  3NDJ A;  5AE3 A;  1T5H X;  2WAQ A;  2OBV A;  5CZX A;  1MKY A;  4JYA C;  1VQL Z;  4MTN A;  1VQ8 Z;  3I56 1;  3CCE 1;  1W2B Z;  4DUY C;  1TFI A;  2K3R A;  5BST A;  4NXM C;  3I07 A;  3CD6 Z;  1YUA A;  3S16 I;  5T8S A;  3R9X A;  5JRH A;  3GTM I;  3GR1 A;  4HH4 A;  2OO4 A;  1X0T A;  1VQ6 1;  3S17 I;  1K9M 2;  4L4Q A;  2UUA C;  3PRO C;  2LEX A;  4RM2 A;  2K5R A;  2VPW A;  2WP0 C;  3GTP I;  2XR1 A;  4DV7 C;  4JI6 C;  2PRO A;  2JIM A;  2ZAE B;  2ONF A;  3IR7 A;  1Q16 A;  4WV3 A;  3TE5 B;  3DLP X;  1QYP A;  3VNS A;  1MD9 A;  2R92 I;  5A2Q b;  5K85 A;  2E8F A;  3J81 D;  2VUG A;  2IV2 X;  3GCF A;  4L7I A;  1WH9 A;  3T1H C;  4D4G A;  1QVG Z;  1K9M 1;  2O4H A;  5IT9 f;  3A26 A;  1QVG Y;  3FCC A;  1YIJ 1;  2DE6 A;  3UX2 A;  3G71 Z;  3EER A;  1ULT A;  1QVF Y;  2DYJ A;  4B3S C;  3FKI I;  1VQ8 1;  2JA7 I;  2JIO A;  2D1T A;  4RMN A;  3TDH B;  4JV5 C;  1R9T I;  1YJ9 Z;  2D1R A;  3R9W A;  1VQ5 Z;  3CD6 1;  1QM4 A;  4MD8 A;  2KZF A;  3NH4 A;  4NBB A;  3OW2 Z;  3VTN A;  1WF3 A;  2D28 C;  4DCV A;  3IF8 A;  1Y1V I;  2JS4 A;  5KYT A;  3CCL Z;  1IB8 A;  3S82 A;  4FUQ A;  1RLY A;  2M48 A;  4A3B I;  1VQN Z;  3RV2 A;  3B7W A;  2G2K A;  3CC2 Z;  2QVX X;  5T8T A;  3PO3 S;  5IP9 I;  1VQM Z;  1VQO Z;  3CQZ I;  2LIY A;  4E31 A;  2VF1 A;  2JA5 I;  4KTV A;  1FUG A;  2VQF C;  3I4M I;  2DE7 A;  1Q7Y 2;  2YU9 I;  3KIF A;  2Y4N A;  5BUS A;  1M6X C;  4RVN A;  2GTI A;  3VMI A;  4RVD A;  2VSQ A;  3KIH A;  2QRD B;  1MDF A;  2ZM6 C;  3GKQ A;  3G71 1;  1IBK C;  1HNX C;  4JM1 A;  3J80 D;  3MON A;  2UUB C;  3BG1 B;  3QWU A;  1UKK A;  3CQ3 A;  5DV9 A;  1YJ9 1;  4HGZ A;  3G6E Z;  2YAD A;  5T64 A;  3CCM Z;  1RNI A;  1Q7Y 1;  1JOS A;  2Y27 A;  5H9U A;  2CY1 A;  3S1M I;  2ASB A;  5CZV A;  1N34 C;  2YWB A;  4PUI A;  1N32 C;  4BSZ A;  4DCS A;  2RHB A;  2NVY I;  3S15 I;  4NBF A;  4GXQ A;  3CXC Y;  4MH4 A;  4X66 C;  3AY0 A;  5BR8 C;  3J81 b;  4JI1 C;  1VQN 1;  4DV0 C;  4I9G A;  5C3E I;  2ZZM A;  3A4I A;  4PUG A;  1VQO 1;  3ETC A;  3CCQ Z;  4DGL A;  1N36 C;  5BSR A;  4NBE A;  3RZO I;  1YJ7 A;  3TDE A;  3VNQ A;  2Q4Z A;  4DQY B;  1O93 A;  2GTH A;  5C44 I;  2P2B A;  2HU9 A;  1KRL A;  3UZ0 A;  2VPZ A;  4MD7 A;  2JA6 I;  3GTK I;  2HF1 A;  3O2E A;  4JI2 C;  1KQS Z;  3KXW A;  3BG0 B;  3CCS Z;  1KC8 2;  3HOY I;  3CJE A;  4CL1 A;  1FDO A;  3NDI A;  3M3Y I;  4KTT A;  5CM2 M;  2VPX A;  3G6E 1;  1YHQ Z;  2CXC A;  5IT9 D;  2D27 A;  3GKU A;  3TQI A;  1QXF A;  4RV9 A;  3R44 A;  4DCU A;  3TR3 A;  4DR5 C;  1PA4 A;  1M1K 1;  3CCM 1;  2QA4 Z;  3NYQ A;  4TNU A;  2JIR A;  1VQ7 Z;  4LFA C;  3I08 A;  1XRA A;  1RO4 A;  2QRC B;  4RM3 A;  2E7G A;  4Y52 I;  1O9T A;  3G7S A;  3GTO I;  5KYV A;  2F4V C;  1KC8 1;  2QKD A;  3CC4 Z;  3VMH A;  1Z01 A;  5LL6 f;  4X6A I;  4LF9 C;  1LQL A;  1ZH1 A;  1VQ9 Z;  3S2H I;  1O90 A;  4NH1 C;  3RZD I;  1PG4 A;  4LF8 C;  3CCR 1;  4OYC A;  1WJ2 A;  3IFU A;  3HOU I;  5LMN C;  1HH2 P;  3IX0 A;  1MXB A;  2JR6 A;  2UXB C;  3Q87 A;  3F3P C;  1X3W A;  4NBA A;  2F4M A;  4NBD A;  4BY1 I;  1O92 A;  3IEU A;  3UEB A;  4DR6 C;  1S7M A;  1Y8C A;  4A3G I;  3RG2 A;  3CCS 1;  2OTJ Z;  3N2Q A;  2UXD C;  2P2J A;  2IZ4 A;  3EED A;  5AE2 A;  1M6X A;  3S1R I;  4L2Z A;  1YJW Z;  1VQP Z;  3GTM S;  2QEX Z;  4DG9 A;  3LUS A;  2R6M A;  4E2W A;  3K6R A;  2E5L C;  2QA4 1;  3S1N I;  4U5Y D;  1VQ7 1;  3I4N I;  5A2Q f;  1FJG C;  1KKG A;  4NFR A;  4MRI A;  3CCV 1;  1NP6 A;  2P28 A;  3UX3 A;  1QVF Z;  2HHH C;  4NB8 A;  2NVX I;  5BUR A;  4E2Z A;  3CMA Z;  1VQL 1;  3CC4 1;  1ZB8 A;  2WB1 A;  2I3C A;  1ML8 A;  3CC7 Z;  2QL8 A;  4QTU A;  1ZB9 A;  3M4O I;  4GXR A;  3FCE A;  2PK7 A;  3VNR A;  5D1O B;  3PO2 I;  2JNV A;  1YIT Z;  1EGA A;  2MM9 A;  1RQF A;  2VZE A;  4AQY C;  2E2I I;  1TH5 A;  1QF8 A;  4PUH A;  4DR2 C;  2YX1 A;  2OOX B;  1N8R 1;  5GTD A;  4EAT A;  3LNV A;  1MXC A;  4RVG A;  4JI8 C;  4G36 A;  1YJN Z;  5IFI A;  2JIP A;  4A3I I;  4LF4 C;  2E2J I;  2QEX 1;  3UOW A;  1FLO A;  2KZ0 A;  1SIW A;  1Y1V S;  3D9X A;  5BSW A;  1XRB A;  2PMZ A;  1I6H I;  2JUB A; 
#chains in the Genus database with same CATH homology
 4RVO A;  2LFU A;  4DK1 A;  3ETO A;  1V25 A;  2PM9 A;  2QRE B;  5FLX D;  2E0G A;  4DG8 A;  4JI3 C;  3JAM D;  3HKZ A;  3CMA 1;  3CC7 1;  3NYR A;  4B3T C;  1M90 2;  1IBM C;  2WD9 A;  1VQ5 1;  4DR1 C;  1TWH I;  4NBC A;  2UU9 C;  1RO0 A;  1WW9 A;  1Y1W I;  3AF6 A;  3N54 B;  2JA8 I;  3ESW A;  2IZ3 A;  5BSU A;  3CCU Z;  2KPI A;  1YI2 Z;  4FTF A;  4PRO C;  4DCT A;  3CXC Z;  3CCL 1;  4JI5 C;  1KD1 1;  1XMQ C;  3I55 Z;  5BUQ A;  2P02 A;  4LFC C;  1TWF I;  1L2F A;  1YJN 1;  4TPS B;  3CC2 1;  3NFZ A;  1HNZ C;  4RVH A;  3J81 f;  1Q86 2;  1VQM 1;  4E30 A;  4A3E I;  1M90 1;  3HOZ I;  3J7A 4;  3CCJ Z;  4JI7 C;  3G4S Z;  1VLA A;  2UXC C;  4DR3 C;  1M1K 2;  1K83 I;  5IP7 I;  1LCI A;  2P2F A;  2V7B A;  2YCB A;  4NDN A;  1VQ4 Z;  2E8C A;  5A1G A;  4FUT A;  4MXU A;  2QLV B;  2JNY A;  5T6B A;  2Y4O A;  2OTL Z;  5AE1 A;  5A2Q D;  4R1M A;  5FLM I;  1Q86 1;  2AYA A;  1V26 A;  4LE5 A;  5E7Q A;  2YWC A;  4X64 C;  4GS5 A;  4A3D I;  3A9V A;  2GU2 A;  1DL6 A;  3S1Q I;  1Q81 1;  3CCU 1;  4BXX I;  1YI2 1;  4A3C I;  3H0G I;  5C4J I;  2W04 A;  3F3F C;  3I55 1;  1HNW C;  1JJ2 Z;  2VUM I;  2P20 A;  4D4I A;  2QVY X;  4NXN C;  3CCQ 1;  2OZK A;  1JJ2 Y;  3CCJ 1;  4LF7 C;  2O53 A;  2V8K A;  3G4S 1;  3JAM b;  3NI2 A;  1TWC I;  1P7L A;  1Z02 A;  1K73 1;  3J80 b;  4B3M C;  3FQM A;  2E8E A;  2QVZ X;  4BCA A;  3GTJ I;  1Z03 A;  2JMO A;  4DV6 C;  1K8A 1;  3U50 C;  3L8C A;  2P2M A;  1XNQ C;  1K0R A;  4PZP A;  2OTL 1;  4ODJ A;  2DE5 A;  4NB9 A;  1MDB A;  3CME Z;  1XMO C;  1X3Z A;  1YIJ Z;  3H3V J;  1YHQ 1;  4ZJZ A;  5ADZ A;  2BH1 X;  4RS4 A;  4X65 C;  1TWA I;  5C4X I;  1W2B Y;  3C5E A;  4IZ6 A;  2P3Y A;  4R1L A;  3PBK A;  3VB9 A;  1XNR C;  2R93 I;  2H85 A;  3DAY A;  4RVF A;  1RG9 A;  4NBH A;  1WCM I;  4LFB C;  1N8R 2;  4BBS I;  1MXA A;  4MD9 A;  1SFO I;  3T1Y C;  2RBL A;  1VQK Z;  3E7W A;  1N33 C;  4DV4 C;  4LF6 C;  1VQ9 1;  1RY2 A;  4BC7 A;  3IEV A;  4A3L I;  5LMU C;  5IWA C;  4DV2 C;  4I9F A;  1J5E C;  2M6N A;  4BBY A;  2P2Q A;  2F4O A;  3E7X A;  5IT9 b;  3T4N B;  1I50 I;  4R0M A;  4AYB A;  1QWI A;  2OTJ 1;  3CME 1;  3GPC A;  3CW8 X;  3MZK B;  1YJW 1;  1VQP 1;  4D57 A;  3K7A I;  4NBG A;  4K0K C;  2E2H I;  4NOZ A;  4A93 I;  4GKK C;  1S72 Z;  4XX2 A;  3GTQ I;  4YY3 C;  5A19 A;  2R7Z I;  4DR4 C;  3GR0 A;  4KHP C;  3PO3 I;  1L1O C;  1BA3 A;  2HJG A;  3LAX A;  1HR0 C;  3OW2 Y;  4HPV A;  1USP B;  4GKJ C;  1KD1 2;  4A3M I;  4Y7N I;  4A3F I;  4A3K I;  2KI7 B;  3P5J B;  1XRC A;  3CPW Z;  1P9N A;  1VQK 1;  1JWH C;  3FQQ A;  2PT7 G;  3CPW Y;  3AF5 A;  3H2T A;  3L95 X;  4G37 A;  3HOW I;  2V8I A;  4E2X A;  1Q82 2;  4K0B A;  2NVQ I;  1YIT 1;  4RLF A;  5A1I A;  4DUZ C;  2D7V A;  5BSV A;  2RPR A;  2UUC C;  2B63 I;  2BJO A;  4ISB A;  5D1O A;  2RIQ A;  2W03 A;  3SO4 A;  1TWG I;  2AKL A;  2OPL B;  4BBR I;  2Y0S A;  4YHH C;  3OTO C;  5AN9 F;  1PFT A;  1WII A;  1PG3 A;  3EQ6 A;  4S1T A;  3LGX A;  3PES A;  5T67 A;  1Q82 1;  4RLQ A;  1AMU A;  3HOX I;  4EWC A;  1S72 1;  2QR1 B;  1GPM A;  2OOY B;  1Q81 2;  1NYE A;  4DV5 C;  2VQE C;  3IML A;  1T5D X;  4BC9 A;  2D1Q A;  5D1P A;  1N2F A;  3NPD A;  2E9H A;  2QW0 X;  1YUK A;  4A3J I;  1USP A;  2D1S A;  4B3R C;  4DR7 C;  4OX9 C;  4PHT A;  3GTG I;  3I56 Z;  3CCE Z;  3TUF A;  2NVT I;  3S14 I;  5BSM A;  3MZL B;  3NH8 A;  1K73 2;  4ZLP A;  4WS9 A;  1IBL C;  3CCR Z;  3GTL I;  1NJI 2;  3A9U A;  3HOV I;  1K8A 2;  2JMP A;  1NUI A;  1VQ6 Z;  3CW9 A;  2OPL A;  4BY7 I;  4JI4 C;  4X62 C;  1KQS Y;  4HGY A;  5FLX b;  4E32 A;  4G1I A;  5K8F A;  2J6A A;  4OXI A;  2V8J A;  3NH5 A;  3VMG A;  5FLX f;  4D56 A;  2ATW A;  4MON A;  3DHV A;  3S2D I;  3JAM f;  4E2Y A;  2DPL A;  5KEI A;  1I3Q I;  3J80 f;  3D6W A;  1NJI 1;  2Q51 A;  1VQ4 1;  4IR7 A;  4JI0 C;  2PN2 A;  4E33 A;  3CCV Z;  3IPL A;  4LF5 C;  2RT9 A;  4DV1 C;  4QTT A;  1I94 C;  1RO2 A;  2EGT A;  4DV3 C;  3NDJ A;  5AE3 A;  1T5H X;  2WAQ A;  2OBV A;  5CZX A;  1MKY A;  4JYA C;  1VQL Z;  4MTN A;  1VQ8 Z;  3I56 1;  3CCE 1;  1W2B Z;  4DUY C;  1TFI A;  2K3R A;  5BST A;  4NXM C;  3I07 A;  3CD6 Z;  1YUA A;  3S16 I;  5T8S A;  3R9X A;  5JRH A;  3GTM I;  3GR1 A;  4HH4 A;  2OO4 A;  1X0T A;  1VQ6 1;  3S17 I;  1K9M 2;  4L4Q A;  2UUA C;  3PRO C;  4RM2 A;  2K5R A;  2WP0 C;  3GTP I;  2XR1 A;  4DV7 C;  4JI6 C;  2PRO A;  2ZAE B;  2ONF A;  4WV3 A;  3TE5 B;  3DLP X;  1QYP A;  3VNS A;  1MD9 A;  2R92 I;  5A2Q b;  5K85 A;  2E8F A;  3J81 D;  2VUG A;  3GCF A;  4L7I A;  1WH9 A;  3T1H C;  4D4G A;  1QVG Z;  1K9M 1;  2O4H A;  5IT9 f;  1QVG Y;  3FCC A;  1YIJ 1;  2DE6 A;  3G71 Z;  3EER A;  1ULT A;  1QVF Y;  2DYJ A;  4B3S C;  3FKI I;  1VQ8 1;  2JA7 I;  2D1T A;  4RMN A;  4JV5 C;  3TDH B;  1R9T I;  1YJ9 Z;  2D1R A;  3R9W A;  1VQ5 Z;  3CD6 1;  1QM4 A;  4MD8 A;  2KZF A;  3NH4 A;  4NBB A;  3OW2 Z;  3VTN A;  1WF3 A;  2D28 C;  4DCV A;  3IF8 A;  1Y1V I;  2JS4 A;  5KYT A;  3CCL Z;  3S82 A;  4FUQ A;  1RLY A;  2M48 A;  4A3B I;  1VQN Z;  3RV2 A;  3B7W A;  2G2K A;  3CC2 Z;  2QVX X;  5T8T A;  3PO3 S;  5IP9 I;  1VQM Z;  1VQO Z;  3CQZ I;  2LIY A;  4E31 A;  2VF1 A;  2JA5 I;  4KTV A;  1FUG A;  2VQF C;  3I4M I;  2DE7 A;  1Q7Y 2;  2YU9 I;  3KIF A;  2Y4N A;  5BUS A;  4RVN A;  2GTI A;  3VMI A;  4RVD A;  2VSQ A;  3KIH A;  2QRD B;  1MDF A;  2ZM6 C;  3GKQ A;  3G71 1;  1IBK C;  1HNX C;  4JM1 A;  3J80 D;  3MON A;  2UUB C;  3BG1 B;  3QWU A;  1UKK A;  5DV9 A;  1YJ9 1;  4HGZ A;  3G6E Z;  2YAD A;  5T64 A;  3CCM Z;  1RNI A;  1Q7Y 1;  1JOS A;  2Y27 A;  5H9U A;  2CY1 A;  3S1M I;  2ASB A;  5CZV A;  1N34 C;  2YWB A;  1N32 C;  4BSZ A;  4DCS A;  2RHB A;  2NVY I;  3S15 I;  4NBF A;  4GXQ A;  3CXC Y;  4MH4 A;  4X66 C;  5BR8 C;  3J81 b;  4JI1 C;  1VQN 1;  4DV0 C;  4I9G A;  5C3E I;  3A4I A;  1VQO 1;  3ETC A;  3CCQ Z;  4DGL A;  1N36 C;  5BSR A;  4NBE A;  3RZO I;  1YJ7 A;  3TDE A;  3VNQ A;  2Q4Z A;  4DQY B;  1O93 A;  2GTH A;  5C44 I;  2P2B A;  2HU9 A;  1KRL A;  3UZ0 A;  3GTK I;  4MD7 A;  2JA6 I;  2HF1 A;  4JI2 C;  1KQS Z;  3KXW A;  3BG0 B;  3CCS Z;  1KC8 2;  3HOY I;  3CJE A;  4CL1 A;  4KTT A;  3NDI A;  3M3Y I;  5CM2 M;  1YHQ Z;  3G6E 1;  2CXC A;  5IT9 D;  2D27 A;  3GKU A;  3TQI A;  4RV9 A;  3R44 A;  4DCU A;  4DR5 C;  1PA4 A;  1M1K 1;  3CCM 1;  2QA4 Z;  3NYQ A;  4TNU A;  1VQ7 Z;  4LFA C;  3I08 A;  1XRA A;  1RO4 A;  2QRC B;  4RM3 A;  2E7G A;  4Y52 I;  1O9T A;  3G7S A;  3GTO I;  5KYV A;  2F4V C;  1KC8 1;  2QKD A;  3CC4 Z;  3VMH A;  1Z01 A;  5LL6 f;  4X6A I;  4LF9 C;  1LQL A;  1ZH1 A;  1VQ9 Z;  3S2H I;  1O90 A;  4NH1 C;  3RZD I;  1PG4 A;  4LF8 C;  3CCR 1;  4OYC A;  3IFU A;  3HOU I;  5LMN C;  1HH2 P;  3IX0 A;  1MXB A;  2JR6 A;  2UXB C;  3Q87 A;  3F3P C;  1X3W A;  4NBA A;  2F4M A;  4NBD A;  4BY1 I;  1O92 A;  3IEU A;  4DR6 C;  1S7M A;  4A3G I;  3RG2 A;  3CCS 1;  2OTJ Z;  3N2Q A;  2UXD C;  2P2J A;  2IZ4 A;  3EED A;  5AE2 A;  3S1R I;  4L2Z A;  1YJW Z;  1VQP Z;  3GTM S;  2QEX Z;  4DG9 A;  3LUS A;  2R6M A;  4E2W A;  2E5L C;  2QA4 1;  3S1N I;  4U5Y D;  1VQ7 1;  3I4N I;  5A2Q f;  1FJG C;  1KKG A;  4NFR A;  4MRI A;  3CCV 1;  1NP6 A;  2P28 A;  1QVF Z;  2HHH C;  4NB8 A;  2NVX I;  5BUR A;  4E2Z A;  3CMA Z;  1VQL 1;  1ZB8 A;  3CC4 1;  2WB1 A;  2I3C A;  1ML8 A;  3CC7 Z;  2QL8 A;  4QTU A;  1ZB9 A;  3M4O I;  4GXR A;  3FCE A;  2PK7 A;  3VNR A;  5D1O B;  3PO2 I;  1YIT Z;  1EGA A;  1RQF A;  2VZE A;  4AQY C;  2E2I I;  1QF8 A;  4DR2 C;  2OOX B;  1N8R 1;  5GTD A;  4EAT A;  3LNV A;  1MXC A;  4RVG A;  4JI8 C;  4G36 A;  1YJN Z;  5IFI A;  4A3I I;  4LF4 C;  2E2J I;  2QEX 1;  3UOW A;  1Y1V S;  3D9X A;  5BSW A;  1XRB A;  2PMZ A;  1I6H I;  2JUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...