1ZB8A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
140
Chain Sequence
SLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
molecule keywords organic hydroperoxide resistance protein
total genus 34
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb8A02
5IP7I 2R92I 1DL6A 3GTJI 4JI0C 1X3WA 1ML8A 1YUAA 2BJOA 2YU9I 2JMPA 3VMHA 4DUZC 1NYEA 2KPIA 3GKQA 4JI8C 1X3ZA 1IBKC 1IBLC 2E2II 3H3VJ 4BY7I 3R9WA 1NUIA 1EGAA 1SFOI 4DUYC 4LFCC 2ONFA 1XMOC 3GTPI 5FLXD 4LF6C 3CJEA 4DR7C 1Y1WI 3GKUA 3PO3S 1I6HI 2ZM6C 1N33C 3HOZI 4A3DI 1Y1VS 3AF6A 3ESWA 5FLMI 1K0RA 2P3YA 4NBEA 1WCMI 4BY1I 2NVXI 4X66C 4DCVA 1J5EC 1N32C 3Q87A 2HF1A 2DE5A 3S1NI 4B3MC 4JV5C 1Y1VI 4A3JI 4A3GI 4Y7NI 2ASBA 2E2JI 3HOWI 4LF7C 4QTUA 2JA5I 3IEUA 2R93I 4DV1C 4JI4C 1QYPA 3HOXI 3VMGA 3GTGI 4NB9A 1TWAI 4BBRI 3RZDI 1WF3A 2NVTI 2HJGA 5C44I 5CM2M 4NBCA 4DCTA 4NBFA 3S1QI 4A3KI 3D6WA 2CY1A 5LMNC 2NVYI 1XMQC 5C4XI 2JA8I 1RO4A 3VMIA 1TWGI 4NBAA 3M3YI 4DV3C 4KHPC 4X64C 5A2QD 1TWFI 2UUCC 2KZFA 1JOSA 3R9XA 4DCSA 3GCFA 2E8EA 1HNZC 2PN2A 1PA4A 1HR0C 1USPA 2F4MA 4B3TC 3RZOI 4DR1C 1L1OC 4DV6C 4NXNC 2ATWA 3GTLI 4Y52I 4A3MI 3S2DI 5C4JI 1HH2P 4DV7C 1I94C 1UKKA 4DR4C 1R9TI 1QWIA 3I4MI 1TWCI 4X6AI 3J81D 4LFBC 2OPLB 3GTMS 4B3SC 4DCUA 2JNYA 4DR5C 1FJGC 3S1RI 2UXCC 1I50I 4DV2C 4B3RC 3K7AI 3PO3I 2DYJA 2VQFC 3HOUI 2E8CA 2DE7A 5LMUC 1N2FA 4LF4C 2YCBA 2J6AA 4NBGA 2R7ZI 1HNWC 4A3II 5C3EI 3JAMD 3S16I 2VUMI 4MH4A 4YHHC 1KKGA 3EERA 4A3FI 4LFAC 1LQLA 4DR3C 2F4VC 1TFIA 3HOVI 1XNQC 3HOYI 1WH9A 4NXMC 2XR1A 2UUBC 2EGTA 3IEVA 1K83I 2DE6A 4XX2A 2B63I 1USPB 3M4OI 4GKJC 2HHHC 4DR2C 3FKII 1ZB8A 3I4NI 3OTOC 4NBBA 4LF9C 4NB8A 3GTQI 2UUAC 3S14I 2E8FA 4DV4C 4LF8C 2E7GA 3H0GI 2OPLA 3T1YC 2UXBC 2JR6A 1ZB9A 1WW9A 2K5RA 4NBHA 5IP9I 4JI5C 4NOZA 4QTTA 3T1HC 4A3LI 4DV0C 4JI1C 4DR6C 3S17I 2PK7A 4BXXI 1VLAA 3GTOI 2JA6I 2CXCA 1N36C 4OX9C 3S15I 4NBDA 4A3BI 1RLYA 2JA7I 4A93I 3U50C 3I07A 4A3CI 2D7VA 3S1MI 3LUSA 2JS4A 2E2HI 1TWHI 3AF5A 2NVQI 4JI3C 4X62C 2VQEC 2RBLA 4LF5C 1XNRC 4JYAC 1N34C 5IWAC 1PFTA 1MKYA 2E5LC 4JI2C 2AKLA 2QL8A 3S2HI 4JI7C 2F4OA 3GTMI 1IBMC 1HNXC 2PT7G 4DV5C 4A3EI 4BBSI 3J80D 3GTKI 4AQYC 1I3QI 4K0KC 3CQZI 4BSZA 5BR8C 4YY3C 4X65C 5IT9D 4MTNA 4JI6C 3VB9A 3PO2I 4GKKC 2UU9C 2UXDC 1L2FA
chains in the Genus database with same CATH superfamily
1GPMA 2PROA 3EQ6A 4GS5A 3R44A 3CCEZ 3NH4A 4JI8C 1RO2A 1X3ZA 1VQOZ 3H3VJ 1NUIA 4PUHA 2Q4ZA 1EGAA 1SFOI 2JIMA 2VUGA 4DUYC 4LFCC 1RQFA 2QRDB 3GTPI 4LF6C 3CJEA 4DR7C 3PO3S 1I6HI 1O93A 3G4SZ 1N33C 5A2Qb 1Y1VS 2ZAEB 4RVHA 3UX3A 2P3YA 3VNQA 1LCIA 4BY1I 1J5EC 5IT9f 1VQ61 1K9M2 3NI2A 3S1NI 3CCV1 4PUGA 1QVFZ 2OZKA 4A3GI 5AE2A 2E2JI 3TDEA 4LF7C 5BSUA 4QTUA 1VQPZ 1RG9A 2LEXA 2QA41 4DV1C 1QYPA 4PROC 2OTL1 4NB9A 1WF3A 1Q822 5CM2M 5IT9b 2YADA 2NVYI 2YX1A 3JAMf 4E31A 1VQ5Z 1XRAA 3GR1A 4KHPC 3KIFA 1TWFI 3I561 3G7SA 5LCIA 2K3RA 3J81f 4AYBA 1PA4A 1USPA 2OTJZ 2Y4OA 3GTLI 3G711 4A3MI 1HH2P 3NPDA 1R9TI 3I4MI 4LFBC 3JAMb 4RMNA 3S1RI 1I50I 1Q7Y2 3K7AI 4MXUA 1S721 1V25A 2DYJA 2WD9A 5LMUC 1N2FA 3CCRZ 2M6NA 2YCBA 1YI2Z 3GR0A 1XS3A 4OYCA 3S16I 1YJ7A 4MH4A 3IX0A 1P4EA 2ZZMA 4LFAC 3CC71 3CME1 3HOYI 2OBVA 4D4IA 2DE6A 1VQ71 1VQNZ 1KRLA 1USPB 2JIPA 1PG3A 3TDHB 2KI7B 5FLXb 1KQSY 3J7A4 1ZB8A 3I4NI 4ZJZA 4NB8A 3C5EA 3SO4A 4DV4C 4LF8C 2E7GA 3T1YC 1P9NA 1QM4A 1WW9A 4NBHA 4MONA 2NAPA 2VSQA 3G4S1 3OW2Z 1FLOA 1MDBA 4DV0C 4JI1C 5IFIA 4DR6C 2V8IA 3S17I 1VLAA 2WAQA 2QVXX 4ISBA 2P2FA 1YJ91 4A3BI 1RLYA 3CQ1A 1RO0A 3D9XA 2JIOA 2JS4A 1YI21 5T67A 2QKDA 5BSVA 5T8SA 1M6XA 5IWAC 3FCEA 2E5LC 3NDJA 1XRBA 4R1MA 3CW8X 1YJN1 2F4OA 3GTMI 5BSMA 3BG0B 4DV5C 4AQYC 3CQZI 3F3FC 4BSZA 2PM9A 3K6RA 3UOWA 5BR8C 4YY3C 4MTNA 1YJW1 2R92I 3GTJI 1AA6A 3QWUA 1KC81 2JMPA 3VMHA 4HGZA 1ZH1A 1SIWA 2E7ZA 3GKQA 4DQYB 4NH1C 1P4EC 4GXRA 4G1IA 2E2II 1KD11 1PU1A 3A9UA 1XMOC 3IMLA 1Y1WI 3GKUA 2ZM6C 3HOZI 2D28C 1TH5A 5ADZA 1K0RA 4NBEA 1N32C 4EWCA 3CMEZ 1KD12 3IR7A 3Q87A 4RV9A 4OXIA 4JV5C 3TR3A 3CCQ1 1YJNZ 3CC4Z 3CC21 5E7QA 2JA5I 3IEUA 4WV3A 3GTGI 2R6MA 1VQMZ 3PESA 5CZVA 4BCAA 1TWAI 3NDIA 4DCTA 1YJWZ 3CXCY 4NBCA 4NBFA 4U5YD 3IF8A 2W04A 5C4XI 2I3CA 5D1OB 3M3YI 4NBAA 4DV3C 3IFUA 1P7LA 5A2QD 2UUCC 2KZFA 2V8JA 3LNOA 4DCSA 5BSTA 4B3TC 4D57A 2F4MA 1L1OC 5C4JI 3CCVZ 4TPSB 4PUIA 1TWCI 5AN9F 3CCS1 2OPLB 4E2YA 2H85A 2JNYA 1VQ81 2D1SA 4L2ZA 1W2BZ 2UXCC 2QA4Z 2DHMA 4JM1A 1YIJZ 3HOUI 2E8CA 2DE7A 3CQ2A 2R7ZI 1ULTA 1XRCA 3VNSA 3CC2Z 5C3EI 3LGXA 1VQ51 1KKGA 3UZ0A 5D1OA 2F4VC 1TFIA 4NDNA 1VQM1 4DGLA 4RLFA 2UUBC 1K83I 3M4OI 4XX2A 2B63I 2OTJ1 4I9GA 2E0GA 4GKJC 4MD9A 2M5OA 2HHHC 4DR2C 2P20A 3OTOC 2RT9A 4IR7A 3DAYA 2JR6A 2IZ3A 4RVOA 4RS4A 3AY0A 4JI5C 4BC9A 4QTTA 4R0MA 3NYRA 2KDNA 3FQQA 4E2WA 2P2BA 1VQ91 3N2QA 4L4QA 3GTOI 1N36C 3CCQZ 3S15I 4OX9C 3CC41 1QF8A 2V3VA 2JA7I 3CD61 5DV9A 5A2Qf 4JI3C 2ZZNA 3CMA1 2LFUA 3UEBA 4JYAC 1K8A1 3CCM1 3CCE1 3S2HI 3GPCA 4JI7C 1IBMC 4A3EI 4E32A 4K0KC 1JJ2Y 1VQO1 4PHTA 4X65C 3KXWA 5IT9D 3PO2I 4GKKC 2UU9C 2VPYA 2IV2X 1DL6A 4JI0C 2LIYA 2V45A 1ML8A 2YU9I 5T64A 4DUZC 1QXFA 3CPWY 1Q821 3I55Z 2KPIA 1YUKA 2JMOA 5T6BA 1VQ8Z 3P5JB 1IBKC 3J81b 1M1K2 1IBLC 1M902 4RLQA 3L95X 5A19A 3NYQA 2ONFA 2VPWA 5T8TA 4DG8A 1VQP1 1Z03A 1N8R2 1AMUA 5FLMI 3RG2A 4DCVA 1WCMI 3CPWZ 4X66C 3HKZA 2DE5A 4B3MC 5CZXA 2E9HA 1WIIA 2ASBA 1FDIA 2RPRA 4D56A 3NH8A 3HOWI 2CU6A 5GTDA 1Y8CA 4HGYA 1WZNA 2M48A 2R93I 2QVZX 2V7BA 4JI4C 3HOXI 1VQ41 3FCCA 1Q862 4BBRI 2QEX1 3RZDI 3KIHA 1K9M1 3O2EA 4DV6C 2RIQA 4A3KI 3D6WA 5LMNC 5AE3A 4KTVA 3L8CA 1XMQC 1RO4A 3VMIA 1TWGI 2P2MA 4HPVA 4IZ6A 4D4GA 1JOSA 3R9XA 1HR0C 1Q861 3EEDA 3RZOI 4NXNC 1FDOA 4DV7C 2QR1B 1MDFA 1WJ2A 1I94C 4K0BA 3CMAZ 3E7WA 4DR4C 2WB1A 4X6AI 3CCJ1 3CC7Z 3GTMS 2P2JA 3J80f 3CCUZ 1FJGC 1T5DX 4DR5C 4RVFA 1N8R1 2D1TA 2NCLA 5AE1A 4B3RC 1MXCA 4LE5A 1UWDA 3I56Z 1Q16A 3NFZA 4LF4C 1V26A 3T4NB 2GU2A 2D1QA 4NBGA 1YHQ1 2VPXA 3TUFA 2BH1X 4RM3A 1JJ2Z 3JAMD 4PZPA 2VUMI 3EERA 4A3FI 1LQLA 1NY8A 3ETCA 4DR3C 3J80b 1VQ4Z 1KQSZ 1XNQC 2P02A 1T5HX 1WH9A 4NXMC 2XR1A 3A25A 2QEXZ 3I551 1BA3A 1NP6A 1FUGA 3CCR1 3FKII 2GTIA 4NBBA 2JUBA 2UUAC 4KTTA 3H0GI 2OPLA 3PBKA 3N54B 3ETOA 2K5RA 3UX2A 2GTHA 1O90A 2OOYB 4NOZA 2Q51A 4RVGA 2D1RA 3T1HC 1Q7Y1 4A3LI 1VQ7Z 5H9UA 3I08A 4E2XA 2PK7A 2VPZA 4CL1A 4BXXI 3FQMA 3CCU1 3F3PC 2D27A 2KZ0A 3OW2Y 2CXCA 4DG9A 1PG4A 2G2KA 2P28A 3U50C 2D7VA 3S1MI 3MZLB 2E2HI 1YHQZ 1TWHI 1XHJA 4G36A 2VQEC 4LF5C 3DLPX 1PFTA 2M5HA 4RVDA 2AYAA 2QL8A 2P2QA 4DK1A 3MONA 1KC82 1HNXC 1MXAA 2PT7G 3J80D 4RM2A 3A26A 3GTKI 1I3QI 2QVYX 3IPLA 1YJ9Z 3DHVA 1RY2A 1VQ6Z 1V60A 5FLXf 4JI6C 2YWCA 5IP7I 4FTFA 1W2BY 2PMZA 1X3WA 1YUAA 2BJOA 2YWBA 1NYEA 5KYTA 1Z02A 2MMAB 2VZEA 3VTNA 2AYDA 2QREB 4BY7I 3R9WA 4MRIA 4BC7A 5KEIA 4TNUA 2QW0X 4GXQA 5FLXD 5A1GA 4A3DI 5K85A 3AF6A 3ESWA 1NJI1 1VQKZ 3BG1B 3CXCZ 2NVXI 5LL6f 2DPLA 4EATA 3NH5A 2O4HA 2HF1A 3CCL1 1Y1VI 1RNIA 4A3JI 4Y7NI 2IZ4A 1QVGZ 4E33A 3S82A 1S72Z 3VMGA 1MXBA 2NVTI 2HJGA 5C44I 1IB8A 3S1QI 2CY1A 3CCSZ 1K731 2JA8I 3A9VA 5BUQA 1M901 4X64C 4E30A 4FUTA 3B7WA 3GCFA 2E8EA 4HH4A 2JNVA 2PN2A 4BBYA 1VQN1 5A1IA 1HNZC 4DR1C 3G6E1 2ATWA 2JIQA 4Y52I 1YITZ 2HU9A 3S2DI 1NJI2 2WP0C 5BSWA 1UKKA 1QWIA 4ODJA 4RVNA 3J81D 4B3SC 4R1LA 4DCUA 2OO4A 5BUSA 5KYVA 4DV2C 2W03A 2QRCB 3PO3I 2VQFC 2Z51A 3VNRA 2O53A 2J6AA 1HNWC 1Q811 4A3II 2RHBA 4ZLPA 4YHHC 1M6XC 4E2ZA 4L7IA 5K8FA 2Y4NA 2V8KA 3D2LA 3H2TA 3HOVI 1WCJA 1VQLZ 4I9FA 2JIRA 3A4IA 2EGTA 3PROC 3IEVA 1VQ9Z 1YIJ1 2OOXB 1QVFY 3LAXA 3MZKB 3CQ3A 1O9TA 1MD9A 4LF9C 3GTQI 3CW9A 3CCJZ 3S14I 2E8FA 1K732 3CD6Z 5JRHA 4MD7A 2UXBC 1ZB9A 4S1TA 4NFRA 1M1K1 5IP9I 3G6EZ 1QVGY 1JWHC 1YIT1 1VQK1 3CCMZ 4G37A 4WS9A 3E7XA 2MM9A 1S7MA 2JA6I 3CCLZ 1Q812 5BURA 4NBDA 2VF1A 1VEHA 4A93I 3G71Z 2Y27A 3I07A 4A3CI 3LUSA 3AF5A 3LNVA 1XNRC 2NVQI 1O92A 5BSRA 4X62C 2RBLA 1N34C 1Z01A 4FUQA 5D1PA 3TE5B 1MKYA 4JI2C 2AKLA 2MCQA 2QLVB 4BBSI 1VQL1 1X0TA 4MD8A 2Y0SA 3RV2A 3VB9A 2OTLZ 1K8A2 2UXDC 3TQIA 1L2FA
chains in the Genus database with same CATH topology
1GPMA 2PROA 3EQ6A 4GS5A 3R44A 3CCEZ 3NH4A 4JI8C 1RO2A 1X3ZA 1VQOZ 3H3VJ 1NUIA 2Q4ZA 1EGAA 1SFOI 2VUGA 4DUYC 4LFCC 1RQFA 2QRDB 3GTPI 4LF6C 3CJEA 4DR7C 3PO3S 1I6HI 1O93A 3G4SZ 1N33C 5A2Qb 1Y1VS 2ZAEB 4RVHA 1J5EC 2P3YA 3VNQA 1LCIA 4BY1I 5IT9f 1VQ61 1K9M2 3NI2A 3S1NI 3CCV1 1QVFZ 2OZKA 4A3GI 5AE2A 2E2JI 3TDEA 4LF7C 5BSUA 4QTUA 1VQPZ 1RG9A 2QA41 4DV1C 1QYPA 4PROC 2OTL1 4NB9A 1WF3A 1Q822 5CM2M 5IT9b 2YADA 2NVYI 3JAMf 4E31A 1VQ5Z 1XRAA 3GR1A 4KHPC 3KIFA 1TWFI 3I561 3G7SA 2K3RA 3J81f 4AYBA 1PA4A 1USPA 2OTJZ 2Y4OA 3GTLI 3G711 4A3MI 1HH2P 3NPDA 1R9TI 3I4MI 4LFBC 3JAMb 4RMNA 3S1RI 1I50I 1Q7Y2 3K7AI 4MXUA 1S721 1V25A 2DYJA 2WD9A 5LMUC 1N2FA 3CCRZ 2M6NA 2YCBA 1YI2Z 3GR0A 4OYCA 3S16I 1YJ7A 4MH4A 3IX0A 4LFAC 3CC71 3CME1 3HOYI 2OBVA 4D4IA 2DE6A 1VQ71 1VQNZ 1KRLA 1USPB 1PG3A 3TDHB 2KI7B 5FLXb 1KQSY 3J7A4 1ZB8A 3I4NI 4ZJZA 4NB8A 3C5EA 3SO4A 4DV4C 4LF8C 2E7GA 3T1YC 1P9NA 1QM4A 1WW9A 4NBHA 4MONA 2VSQA 3G4S1 3OW2Z 1MDBA 4DV0C 4JI1C 5IFIA 4DR6C 2V8IA 3S17I 1VLAA 2WAQA 2QVXX 4ISBA 2P2FA 1YJ91 4A3BI 1RLYA 1RO0A 3D9XA 2JS4A 1YI21 5T67A 2QKDA 5BSVA 5T8SA 5IWAC 3FCEA 2E5LC 3NDJA 1XRBA 4R1MA 3CW8X 1YJN1 2F4OA 3GTMI 5BSMA 3BG0B 4DV5C 4AQYC 3CQZI 3F3FC 4BSZA 2PM9A 5BR8C 3UOWA 4YY3C 4MTNA 1YJW1 2R92I 3GTJI 3QWUA 1KC81 2JMPA 3VMHA 4HGZA 1ZH1A 3GKQA 4DQYB 4NH1C 4GXRA 4G1IA 2E2II 1KD11 3A9UA 1XMOC 3IMLA 1Y1WI 3GKUA 2ZM6C 3HOZI 2D28C 5ADZA 1K0RA 4NBEA 1N32C 4EWCA 3CMEZ 1KD12 3Q87A 4RV9A 4OXIA 4JV5C 3CCQ1 1YJNZ 3CC4Z 3CC21 5E7QA 2JA5I 3IEUA 4WV3A 3GTGI 2R6MA 1VQMZ 3PESA 5CZVA 4BCAA 1TWAI 3NDIA 4DCTA 1YJWZ 3CXCY 4NBCA 4NBFA 4U5YD 3IF8A 2W04A 5C4XI 2I3CA 5D1OB 3M3YI 4NBAA 4DV3C 3IFUA 1P7LA 5A2QD 2UUCC 2KZFA 2V8JA 4DCSA 4B3TC 5BSTA 4D57A 2F4MA 1L1OC 5C4JI 3CCVZ 4TPSB 1TWCI 5AN9F 3CCS1 2OPLB 4E2YA 2H85A 2JNYA 1VQ81 2D1SA 4L2ZA 1W2BZ 2UXCC 2QA4Z 4JM1A 1YIJZ 3HOUI 2E8CA 2DE7A 2R7ZI 1ULTA 1XRCA 3VNSA 3CC2Z 5C3EI 3LGXA 1VQ51 1KKGA 3UZ0A 5D1OA 2F4VC 1TFIA 4NDNA 1VQM1 4DGLA 4RLFA 2UUBC 1K83I 3M4OI 4XX2A 2B63I 2OTJ1 4I9GA 2E0GA 4GKJC 4MD9A 2HHHC 4DR2C 2P20A 3OTOC 2RT9A 4IR7A 3DAYA 2JR6A 2IZ3A 4RVOA 4RS4A 4JI5C 4BC9A 4QTTA 4R0MA 3NYRA 3FQQA 4E2WA 2P2BA 1VQ91 3N2QA 4L4QA 3GTOI 1N36C 3CCQZ 3S15I 4OX9C 3CC41 1QF8A 2JA7I 3CD61 5DV9A 5A2Qf 4JI3C 3CMA1 2LFUA 4JYAC 1K8A1 3CCM1 3CCE1 3S2HI 3GPCA 4JI7C 1IBMC 4A3EI 4E32A 4K0KC 1JJ2Y 1VQO1 4PHTA 4X65C 3KXWA 5IT9D 3PO2I 4GKKC 2UU9C 1DL6A 4JI0C 2LIYA 1ML8A 2YU9I 5T64A 4DUZC 3CPWY 1Q821 3I55Z 2KPIA 1YUKA 2JMOA 5T6BA 1VQ8Z 3P5JB 1IBKC 3J81b 1M1K2 1IBLC 1M902 4RLQA 3L95X 5A19A 3NYQA 2ONFA 5T8TA 4DG8A 1VQP1 1Z03A 1N8R2 1AMUA 5FLMI 3RG2A 4DCVA 1WCMI 3CPWZ 4X66C 3HKZA 2DE5A 4B3MC 5CZXA 2E9HA 1WIIA 2ASBA 2RPRA 4D56A 3NH8A 3HOWI 5GTDA 4HGYA 2V7BA 2M48A 2R93I 2QVZX 4JI4C 3HOXI 1VQ41 3FCCA 1Q862 4BBRI 2QEX1 3RZDI 3KIHA 1K9M1 4DV6C 2RIQA 4A3KI 3D6WA 5LMNC 5AE3A 4KTVA 3L8CA 1XMQC 1RO4A 3VMIA 1TWGI 2P2MA 4HPVA 4IZ6A 4D4GA 1JOSA 3R9XA 1HR0C 1Q861 3EEDA 3RZOI 4NXNC 4DV7C 2QR1B 1MDFA 1I94C 4K0BA 3CMAZ 3E7WA 4DR4C 2WB1A 4X6AI 3CCJ1 3CC7Z 3GTMS 2P2JA 3J80f 3CCUZ 1FJGC 1T5DX 4DR5C 4RVFA 1N8R1 2D1TA 5AE1A 4B3RC 1MXCA 4LE5A 3I56Z 3NFZA 4LF4C 1V26A 3T4NB 2GU2A 2D1QA 4NBGA 1YHQ1 3TUFA 2BH1X 4RM3A 1JJ2Z 3JAMD 4PZPA 2VUMI 3EERA 4A3FI 1LQLA 3ETCA 4DR3C 3J80b 1VQ4Z 1KQSZ 1XNQC 2P02A 1T5HX 1WH9A 4NXMC 2XR1A 2QEXZ 3I551 1BA3A 1NP6A 1FUGA 3CCR1 3FKII 2GTIA 4NBBA 2JUBA 2UUAC 4KTTA 3H0GI 2OPLA 3PBKA 3N54B 3ETOA 2K5RA 2GTHA 1O90A 2OOYB 4NOZA 2Q51A 4RVGA 2D1RA 3T1HC 1Q7Y1 4A3LI 1VQ7Z 5H9UA 3I08A 4E2XA 2PK7A 4CL1A 4BXXI 3FQMA 3CCU1 3F3PC 2D27A 3OW2Y 2CXCA 4DG9A 1PG4A 2G2KA 2P28A 3U50C 2D7VA 3S1MI 3MZLB 2E2HI 1YHQZ 1TWHI 2VQEC 4G36A 4LF5C 3DLPX 1PFTA 4RVDA 2AYAA 2QL8A 2P2QA 4DK1A 3MONA 1KC82 1HNXC 1MXAA 2PT7G 3J80D 4RM2A 3GTKI 1I3QI 2QVYX 3IPLA 1YJ9Z 3DHVA 1RY2A 1VQ6Z 5FLXf 4JI6C 2YWCA 5IP7I 4FTFA 1W2BY 2PMZA 1X3WA 1YUAA 2BJOA 2YWBA 1NYEA 5KYTA 1Z02A 2VZEA 3VTNA 2QREB 4BY7I 3R9WA 4MRIA 4BC7A 5KEIA 4TNUA 2QW0X 4GXQA 5FLXD 5A1GA 4A3DI 5K85A 3AF6A 3ESWA 1NJI1 1VQKZ 3BG1B 3CXCZ 2NVXI 5LL6f 2DPLA 4EATA 3NH5A 2O4HA 2HF1A 3CCL1 1Y1VI 1RNIA 4A3JI 4Y7NI 2IZ4A 1QVGZ 4E33A 3S82A 1S72Z 3VMGA 1MXBA 2NVTI 2HJGA 5C44I 3S1QI 2CY1A 3CCSZ 1K731 2JA8I 3A9VA 5BUQA 1M901 4X64C 4E30A 4FUTA 3B7WA 3GCFA 2E8EA 4HH4A 2PN2A 4BBYA 5A1IA 1VQN1 1HNZC 4DR1C 3G6E1 2ATWA 4Y52I 1YITZ 2HU9A 3S2DI 1NJI2 2WP0C 5BSWA 1UKKA 1QWIA 4ODJA 4RVNA 3J81D 4B3SC 4R1LA 4DCUA 2OO4A 5BUSA 5KYVA 4DV2C 2W03A 2QRCB 3PO3I 2VQFC 3VNRA 2O53A 2J6AA 1HNWC 1Q811 4A3II 2RHBA 4ZLPA 4YHHC 4E2ZA 4L7IA 5K8FA 2Y4NA 2V8KA 3H2TA 3HOVI 4I9FA 1VQLZ 3A4IA 2EGTA 3PROC 3IEVA 1VQ9Z 1YIJ1 2OOXB 1QVFY 3LAXA 3MZKB 1O9TA 1MD9A 4LF9C 3GTQI 3CW9A 3CCJZ 3S14I 2E8FA 1K732 3CD6Z 5JRHA 4MD7A 2UXBC 1ZB9A 4S1TA 4NFRA 1M1K1 5IP9I 1QVGY 3G6EZ 1JWHC 1YIT1 1VQK1 3CCMZ 4G37A 4WS9A 3E7XA 1S7MA 2JA6I 3CCLZ 1Q812 5BURA 4NBDA 2VF1A 4A93I 3G71Z 2Y27A 3I07A 4A3CI 3LUSA 3AF5A 3LNVA 1XNRC 2NVQI 1O92A 5BSRA 4X62C 2RBLA 1N34C 1Z01A 4FUQA 5D1PA 3TE5B 1MKYA 4JI2C 2AKLA 2QLVB 4BBSI 1VQL1 1X0TA 4MD8A 2Y0SA 3RV2A 3VB9A 2OTLZ 1K8A2 2UXDC 3TQIA 1L2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 I;  2R92 I;  1DL6 A;  3GTJ I;  4JI0 C;  1X3W A;  1ML8 A;  1YUA A;  2BJO A;  2YU9 I;  2JMP A;  3VMH A;  4DUZ C;  1NYE A;  2KPI A;  3GKQ A;  4JI8 C;  1X3Z A;  1IBK C;  1IBL C;  2E2I I;  3H3V J;  4BY7 I;  3R9W A;  1NUI A;  1EGA A;  1SFO I;  4DUY C;  4LFC C;  2ONF A;  1XMO C;  3GTP I;  5FLX D;  4LF6 C;  3CJE A;  4DR7 C;  1Y1W I;  3GKU A;  3PO3 S;  1I6H I;  2ZM6 C;  1N33 C;  3HOZ I;  4A3D I;  1Y1V S;  3AF6 A;  3ESW A;  5FLM I;  1K0R A;  2P3Y A;  4NBE A;  1WCM I;  4BY1 I;  2NVX I;  4X66 C;  4DCV A;  1J5E C;  1N32 C;  3Q87 A;  2HF1 A;  2DE5 A;  3S1N I;  4B3M C;  4JV5 C;  1Y1V I;  4A3J I;  4A3G I;  4Y7N I;  2ASB A;  2E2J I;  3HOW I;  4LF7 C;  4QTU A;  2JA5 I;  3IEU A;  2R93 I;  4DV1 C;  4JI4 C;  1QYP A;  3HOX I;  3VMG A;  3GTG I;  4NB9 A;  1TWA I;  4BBR I;  3RZD I;  1WF3 A;  2NVT I;  2HJG A;  5C44 I;  5CM2 M;  4NBC A;  4DCT A;  4NBF A;  3S1Q I;  4A3K I;  3D6W A;  2CY1 A;  5LMN C;  2NVY I;  1XMQ C;  5C4X I;  2JA8 I;  1RO4 A;  3VMI A;  1TWG I;  4NBA A;  3M3Y I;  4DV3 C;  4KHP C;  4X64 C;  5A2Q D;  1TWF I;  2UUC C;  2KZF A;  1JOS A;  3R9X A;  4DCS A;  3GCF A;  2E8E A;  1HNZ C;  2PN2 A;  1PA4 A;  1HR0 C;  1USP A;  2F4M A;  4B3T C;  3RZO I;  4DR1 C;  1L1O C;  4DV6 C;  4NXN C;  2ATW A;  3GTL I;  4Y52 I;  4A3M I;  3S2D I;  5C4J I;  1HH2 P;  4DV7 C;  1I94 C;  1UKK A;  4DR4 C;  1R9T I;  1QWI A;  3I4M I;  1TWC I;  4X6A I;  3J81 D;  4LFB C;  2OPL B;  3GTM S;  4B3S C;  4DCU A;  2JNY A;  4DR5 C;  1FJG C;  3S1R I;  2UXC C;  1I50 I;  4DV2 C;  4B3R C;  3K7A I;  3PO3 I;  2DYJ A;  2VQF C;  3HOU I;  2E8C A;  2DE7 A;  5LMU C;  1N2F A;  4LF4 C;  2YCB A;  2J6A A;  4NBG A;  2R7Z I;  1HNW C;  4A3I I;  5C3E I;  3JAM D;  3S16 I;  2VUM I;  4MH4 A;  4YHH C;  1KKG A;  3EER A;  4A3F I;  4LFA C;  1LQL A;  4DR3 C;  2F4V C;  1TFI A;  3HOV I;  1XNQ C;  3HOY I;  1WH9 A;  4NXM C;  2XR1 A;  2UUB C;  2EGT A;  3IEV A;  1K83 I;  2DE6 A;  4XX2 A;  2B63 I;  1USP B;  3M4O I;  4GKJ C;  2HHH C;  4DR2 C;  3FKI I;  1ZB8 A;  3I4N I;  3OTO C;  4NBB A;  4LF9 C;  4NB8 A;  3GTQ I;  2UUA C;  3S14 I;  2E8F A;  4DV4 C;  4LF8 C;  2E7G A;  3H0G I;  2OPL A;  3T1Y C;  2UXB C;  2JR6 A;  1ZB9 A;  1WW9 A;  2K5R A;  4NBH A;  5IP9 I;  4JI5 C;  4NOZ A;  4QTT A;  3T1H C;  4A3L I;  4DV0 C;  4JI1 C;  4DR6 C;  3S17 I;  2PK7 A;  4BXX I;  1VLA A;  3GTO I;  2JA6 I;  2CXC A;  1N36 C;  4OX9 C;  3S15 I;  4NBD A;  4A3B I;  1RLY A;  2JA7 I;  4A93 I;  3U50 C;  3I07 A;  4A3C I;  2D7V A;  3S1M I;  3LUS A;  2JS4 A;  2E2H I;  1TWH I;  3AF5 A;  2NVQ I;  4JI3 C;  4X62 C;  2VQE C;  2RBL A;  4LF5 C;  1XNR C;  4JYA C;  1N34 C;  5IWA C;  1PFT A;  1MKY A;  2E5L C;  4JI2 C;  2AKL A;  2QL8 A;  3S2H I;  4JI7 C;  2F4O A;  3GTM I;  1IBM C;  1HNX C;  2PT7 G;  4DV5 C;  4A3E I;  4BBS I;  3J80 D;  3GTK I;  4AQY C;  1I3Q I;  4K0K C;  3CQZ I;  4BSZ A;  5BR8 C;  4YY3 C;  4X65 C;  5IT9 D;  4MTN A;  4JI6 C;  3VB9 A;  3PO2 I;  4GKK C;  2UU9 C;  2UXD C;  1L2F A; 
#chains in the Genus database with same CATH topology
 1GPM A;  2PRO A;  3EQ6 A;  4GS5 A;  3R44 A;  3CCE Z;  3NH4 A;  4JI8 C;  1RO2 A;  1X3Z A;  1VQO Z;  3H3V J;  1NUI A;  4PUH A;  2Q4Z A;  1EGA A;  1SFO I;  2JIM A;  2VUG A;  4DUY C;  4LFC C;  1RQF A;  2QRD B;  3GTP I;  4LF6 C;  3CJE A;  4DR7 C;  3PO3 S;  1I6H I;  1O93 A;  3G4S Z;  1N33 C;  5A2Q b;  1Y1V S;  2ZAE B;  4RVH A;  3UX3 A;  2P3Y A;  3VNQ A;  1LCI A;  4BY1 I;  1J5E C;  5IT9 f;  1VQ6 1;  1K9M 2;  3NI2 A;  3S1N I;  3CCV 1;  4PUG A;  1QVF Z;  2OZK A;  4A3G I;  5AE2 A;  2E2J I;  3TDE A;  4LF7 C;  5BSU A;  4QTU A;  1VQP Z;  1RG9 A;  2LEX A;  2QA4 1;  4DV1 C;  1QYP A;  4PRO C;  2OTL 1;  4NB9 A;  1WF3 A;  1Q82 2;  5CM2 M;  5IT9 b;  2YAD A;  2NVY I;  2YX1 A;  3JAM f;  4E31 A;  1VQ5 Z;  1XRA A;  3GR1 A;  4KHP C;  3KIF A;  1TWF I;  3I56 1;  3G7S A;  5LCI A;  2K3R A;  3J81 f;  4AYB A;  1PA4 A;  1USP A;  2OTJ Z;  2Y4O A;  3GTL I;  3G71 1;  4A3M I;  1HH2 P;  3NPD A;  1R9T I;  3I4M I;  4LFB C;  3JAM b;  4RMN A;  3S1R I;  1I50 I;  1Q7Y 2;  3K7A I;  4MXU A;  1S72 1;  1V25 A;  2DYJ A;  2WD9 A;  5LMU C;  1N2F A;  3CCR Z;  2M6N A;  2YCB A;  1YI2 Z;  3GR0 A;  1XS3 A;  4OYC A;  3S16 I;  1YJ7 A;  4MH4 A;  3IX0 A;  1P4E A;  2ZZM A;  4LFA C;  3CC7 1;  3CME 1;  3HOY I;  2OBV A;  4D4I A;  2DE6 A;  1VQ7 1;  1VQN Z;  1KRL A;  1USP B;  2JIP A;  1PG3 A;  3TDH B;  2KI7 B;  5FLX b;  1KQS Y;  3J7A 4;  1ZB8 A;  3I4N I;  4ZJZ A;  4NB8 A;  3C5E A;  3SO4 A;  4DV4 C;  4LF8 C;  2E7G A;  3T1Y C;  1P9N A;  1QM4 A;  1WW9 A;  4NBH A;  4MON A;  2NAP A;  2VSQ A;  3G4S 1;  3OW2 Z;  1FLO A;  1MDB A;  4DV0 C;  4JI1 C;  5IFI A;  4DR6 C;  2V8I A;  3S17 I;  1VLA A;  2WAQ A;  2QVX X;  4ISB A;  2P2F A;  1YJ9 1;  4A3B I;  1RLY A;  3CQ1 A;  1RO0 A;  3D9X A;  2JIO A;  2JS4 A;  1YI2 1;  5T67 A;  2QKD A;  5BSV A;  5T8S A;  1M6X A;  5IWA C;  3FCE A;  2E5L C;  3NDJ A;  1XRB A;  4R1M A;  3CW8 X;  1YJN 1;  2F4O A;  3GTM I;  5BSM A;  3BG0 B;  4DV5 C;  4AQY C;  3CQZ I;  3F3F C;  4BSZ A;  2PM9 A;  3K6R A;  3UOW A;  5BR8 C;  4YY3 C;  4MTN A;  1YJW 1;  2R92 I;  3GTJ I;  1AA6 A;  3QWU A;  1KC8 1;  2JMP A;  3VMH A;  4HGZ A;  1ZH1 A;  1SIW A;  2E7Z A;  3GKQ A;  4DQY B;  4NH1 C;  1P4E C;  4GXR A;  4G1I A;  2E2I I;  1KD1 1;  1PU1 A;  3A9U A;  1XMO C;  3IML A;  1Y1W I;  3GKU A;  2ZM6 C;  3HOZ I;  2D28 C;  1TH5 A;  5ADZ A;  1K0R A;  4NBE A;  1N32 C;  4EWC A;  3CME Z;  1KD1 2;  3IR7 A;  3Q87 A;  4RV9 A;  4OXI A;  4JV5 C;  3TR3 A;  3CCQ 1;  1YJN Z;  3CC4 Z;  3CC2 1;  5E7Q A;  2JA5 I;  3IEU A;  4WV3 A;  3GTG I;  2R6M A;  1VQM Z;  3PES A;  5CZV A;  4BCA A;  1TWA I;  3NDI A;  4DCT A;  1YJW Z;  3CXC Y;  4NBC A;  4NBF A;  4U5Y D;  3IF8 A;  2W04 A;  5C4X I;  2I3C A;  5D1O B;  3M3Y I;  4NBA A;  4DV3 C;  3IFU A;  1P7L A;  5A2Q D;  2UUC C;  2KZF A;  2V8J A;  3LNO A;  4DCS A;  5BST A;  4B3T C;  4D57 A;  2F4M A;  1L1O C;  5C4J I;  3CCV Z;  4TPS B;  4PUI A;  1TWC I;  5AN9 F;  3CCS 1;  2OPL B;  4E2Y A;  2H85 A;  2JNY A;  1VQ8 1;  2D1S A;  4L2Z A;  1W2B Z;  2UXC C;  2QA4 Z;  2DHM A;  4JM1 A;  1YIJ Z;  3HOU I;  2E8C A;  2DE7 A;  3CQ2 A;  2R7Z I;  1ULT A;  1XRC A;  3VNS A;  3CC2 Z;  5C3E I;  3LGX A;  1VQ5 1;  1KKG A;  3UZ0 A;  5D1O A;  2F4V C;  1TFI A;  4NDN A;  1VQM 1;  4DGL A;  4RLF A;  2UUB C;  1K83 I;  3M4O I;  4XX2 A;  2B63 I;  2OTJ 1;  4I9G A;  2E0G A;  4GKJ C;  4MD9 A;  2M5O A;  2HHH C;  4DR2 C;  2P20 A;  3OTO C;  2RT9 A;  4IR7 A;  3DAY A;  2JR6 A;  2IZ3 A;  4RVO A;  4RS4 A;  3AY0 A;  4JI5 C;  4BC9 A;  4QTT A;  4R0M A;  3NYR A;  2KDN A;  3FQQ A;  4E2W A;  2P2B A;  1VQ9 1;  3N2Q A;  4L4Q A;  3GTO I;  1N36 C;  3CCQ Z;  3S15 I;  4OX9 C;  3CC4 1;  1QF8 A;  2V3V A;  2JA7 I;  3CD6 1;  5DV9 A;  5A2Q f;  4JI3 C;  2ZZN A;  3CMA 1;  2LFU A;  3UEB A;  4JYA C;  1K8A 1;  3CCM 1;  3CCE 1;  3S2H I;  3GPC A;  4JI7 C;  1IBM C;  4A3E I;  4E32 A;  4K0K C;  1JJ2 Y;  1VQO 1;  4PHT A;  4X65 C;  3KXW A;  5IT9 D;  3PO2 I;  4GKK C;  2UU9 C;  2VPY A;  2IV2 X;  1DL6 A;  4JI0 C;  2LIY A;  2V45 A;  1ML8 A;  2YU9 I;  5T64 A;  4DUZ C;  1QXF A;  3CPW Y;  1Q82 1;  3I55 Z;  2KPI A;  1YUK A;  2JMO A;  5T6B A;  1VQ8 Z;  3P5J B;  1IBK C;  3J81 b;  1M1K 2;  1IBL C;  1M90 2;  4RLQ A;  3L95 X;  5A19 A;  3NYQ A;  2ONF A;  2VPW A;  5T8T A;  4DG8 A;  1VQP 1;  1Z03 A;  1N8R 2;  1AMU A;  5FLM I;  3RG2 A;  4DCV A;  1WCM I;  3CPW Z;  4X66 C;  3HKZ A;  2DE5 A;  4B3M C;  5CZX A;  2E9H A;  1WII A;  2ASB A;  1FDI A;  2RPR A;  4D56 A;  3NH8 A;  3HOW I;  2CU6 A;  5GTD A;  1Y8C A;  4HGY A;  1WZN A;  2M48 A;  2R93 I;  2QVZ X;  2V7B A;  4JI4 C;  3HOX I;  1VQ4 1;  3FCC A;  1Q86 2;  4BBR I;  2QEX 1;  3RZD I;  3KIH A;  1K9M 1;  3O2E A;  4DV6 C;  2RIQ A;  4A3K I;  3D6W A;  5LMN C;  5AE3 A;  4KTV A;  3L8C A;  1XMQ C;  1RO4 A;  3VMI A;  1TWG I;  2P2M A;  4HPV A;  4IZ6 A;  4D4G A;  1JOS A;  3R9X A;  1HR0 C;  1Q86 1;  3EED A;  3RZO I;  4NXN C;  1FDO A;  4DV7 C;  2QR1 B;  1MDF A;  1WJ2 A;  1I94 C;  4K0B A;  3CMA Z;  3E7W A;  4DR4 C;  2WB1 A;  4X6A I;  3CCJ 1;  3CC7 Z;  3GTM S;  2P2J A;  3J80 f;  3CCU Z;  1FJG C;  1T5D X;  4DR5 C;  4RVF A;  1N8R 1;  2D1T A;  2NCL A;  5AE1 A;  4B3R C;  1MXC A;  4LE5 A;  1UWD A;  3I56 Z;  1Q16 A;  3NFZ A;  4LF4 C;  1V26 A;  3T4N B;  2GU2 A;  2D1Q A;  4NBG A;  1YHQ 1;  2VPX A;  3TUF A;  2BH1 X;  4RM3 A;  1JJ2 Z;  3JAM D;  4PZP A;  2VUM I;  3EER A;  4A3F I;  1LQL A;  1NY8 A;  3ETC A;  4DR3 C;  3J80 b;  1VQ4 Z;  1KQS Z;  1XNQ C;  2P02 A;  1T5H X;  1WH9 A;  4NXM C;  2XR1 A;  3A25 A;  2QEX Z;  3I55 1;  1BA3 A;  1NP6 A;  1FUG A;  3CCR 1;  3FKI I;  2GTI A;  4NBB A;  2JUB A;  2UUA C;  4KTT A;  3H0G I;  2OPL A;  3PBK A;  3N54 B;  3ETO A;  2K5R A;  3UX2 A;  2GTH A;  1O90 A;  2OOY B;  4NOZ A;  2Q51 A;  4RVG A;  2D1R A;  3T1H C;  1Q7Y 1;  4A3L I;  1VQ7 Z;  5H9U A;  3I08 A;  4E2X A;  2PK7 A;  2VPZ A;  4CL1 A;  4BXX I;  3FQM A;  3CCU 1;  3F3P C;  2D27 A;  2KZ0 A;  3OW2 Y;  2CXC A;  4DG9 A;  1PG4 A;  2G2K A;  2P28 A;  3U50 C;  2D7V A;  3S1M I;  3MZL B;  2E2H I;  1YHQ Z;  1TWH I;  1XHJ A;  4G36 A;  2VQE C;  4LF5 C;  3DLP X;  1PFT A;  2M5H A;  4RVD A;  2AYA A;  2QL8 A;  2P2Q A;  4DK1 A;  3MON A;  1KC8 2;  1HNX C;  1MXA A;  2PT7 G;  3J80 D;  4RM2 A;  3A26 A;  3GTK I;  1I3Q I;  2QVY X;  3IPL A;  1YJ9 Z;  3DHV A;  1RY2 A;  1VQ6 Z;  1V60 A;  5FLX f;  4JI6 C;  2YWC A;  5IP7 I;  4FTF A;  1W2B Y;  2PMZ A;  1X3W A;  1YUA A;  2BJO A;  2YWB A;  1NYE A;  5KYT A;  1Z02 A;  2MMA B;  2VZE A;  3VTN A;  2AYD A;  2QRE B;  4BY7 I;  3R9W A;  4MRI A;  4BC7 A;  5KEI A;  4TNU A;  2QW0 X;  4GXQ A;  5FLX D;  5A1G A;  4A3D I;  5K85 A;  3AF6 A;  3ESW A;  1NJI 1;  1VQK Z;  3BG1 B;  3CXC Z;  2NVX I;  5LL6 f;  2DPL A;  4EAT A;  3NH5 A;  2O4H A;  2HF1 A;  3CCL 1;  1Y1V I;  1RNI A;  4A3J I;  4Y7N I;  2IZ4 A;  1QVG Z;  4E33 A;  3S82 A;  1S72 Z;  3VMG A;  1MXB A;  2NVT I;  2HJG A;  5C44 I;  1IB8 A;  3S1Q I;  2CY1 A;  3CCS Z;  1K73 1;  2JA8 I;  3A9V A;  5BUQ A;  1M90 1;  4X64 C;  4E30 A;  4FUT A;  3B7W A;  3GCF A;  2E8E A;  4HH4 A;  2JNV A;  2PN2 A;  4BBY A;  1VQN 1;  5A1I A;  1HNZ C;  4DR1 C;  3G6E 1;  2ATW A;  2JIQ A;  4Y52 I;  1YIT Z;  2HU9 A;  3S2D I;  1NJI 2;  2WP0 C;  5BSW A;  1UKK A;  1QWI A;  4ODJ A;  4RVN A;  3J81 D;  4B3S C;  4R1L A;  4DCU A;  2OO4 A;  5BUS A;  5KYV A;  4DV2 C;  2W03 A;  2QRC B;  3PO3 I;  2VQF C;  2Z51 A;  3VNR A;  2O53 A;  2J6A A;  1HNW C;  1Q81 1;  4A3I I;  2RHB A;  4ZLP A;  4YHH C;  1M6X C;  4E2Z A;  4L7I A;  5K8F A;  2Y4N A;  2V8K A;  3D2L A;  3H2T A;  3HOV I;  1WCJ A;  1VQL Z;  4I9F A;  2JIR A;  3A4I A;  2EGT A;  3PRO C;  3IEV A;  1VQ9 Z;  1YIJ 1;  2OOX B;  1QVF Y;  3LAX A;  3MZK B;  3CQ3 A;  1O9T A;  1MD9 A;  4LF9 C;  3GTQ I;  3CW9 A;  3CCJ Z;  3S14 I;  2E8F A;  1K73 2;  3CD6 Z;  5JRH A;  4MD7 A;  2UXB C;  1ZB9 A;  4S1T A;  4NFR A;  1M1K 1;  5IP9 I;  3G6E Z;  1QVG Y;  1JWH C;  1YIT 1;  1VQK 1;  3CCM Z;  4G37 A;  4WS9 A;  3E7X A;  2MM9 A;  1S7M A;  2JA6 I;  3CCL Z;  1Q81 2;  5BUR A;  4NBD A;  2VF1 A;  1VEH A;  4A93 I;  3G71 Z;  2Y27 A;  3I07 A;  4A3C I;  3LUS A;  3AF5 A;  3LNV A;  1XNR C;  2NVQ I;  1O92 A;  5BSR A;  4X62 C;  2RBL A;  1N34 C;  1Z01 A;  4FUQ A;  5D1P A;  3TE5 B;  1MKY A;  4JI2 C;  2AKL A;  2MCQ A;  2QLV B;  4BBS I;  1VQL 1;  1X0T A;  4MD8 A;  2Y0S A;  3RV2 A;  3VB9 A;  2OTL Z;  1K8A 2;  2UXD C;  3TQI A;  1L2F A; 
#chains in the Genus database with same CATH homology
 1GPM A;  2PRO A;  3EQ6 A;  4GS5 A;  3R44 A;  3CCE Z;  3NH4 A;  4JI8 C;  1RO2 A;  1X3Z A;  1VQO Z;  3H3V J;  1NUI A;  2Q4Z A;  1EGA A;  1SFO I;  2VUG A;  4DUY C;  4LFC C;  1RQF A;  2QRD B;  3GTP I;  4LF6 C;  3CJE A;  4DR7 C;  3PO3 S;  1I6H I;  1O93 A;  3G4S Z;  1N33 C;  5A2Q b;  1Y1V S;  2ZAE B;  4RVH A;  1J5E C;  2P3Y A;  3VNQ A;  1LCI A;  4BY1 I;  5IT9 f;  1VQ6 1;  1K9M 2;  3NI2 A;  3S1N I;  3CCV 1;  1QVF Z;  2OZK A;  4A3G I;  5AE2 A;  2E2J I;  3TDE A;  4LF7 C;  5BSU A;  4QTU A;  1VQP Z;  1RG9 A;  2QA4 1;  4DV1 C;  1QYP A;  4PRO C;  2OTL 1;  4NB9 A;  1WF3 A;  1Q82 2;  5CM2 M;  5IT9 b;  2YAD A;  2NVY I;  3JAM f;  4E31 A;  1VQ5 Z;  1XRA A;  3GR1 A;  4KHP C;  3KIF A;  1TWF I;  3I56 1;  3G7S A;  2K3R A;  3J81 f;  4AYB A;  1PA4 A;  1USP A;  2OTJ Z;  2Y4O A;  3GTL I;  3G71 1;  4A3M I;  1HH2 P;  3NPD A;  1R9T I;  3I4M I;  4LFB C;  3JAM b;  4RMN A;  3S1R I;  1I50 I;  1Q7Y 2;  3K7A I;  4MXU A;  1S72 1;  1V25 A;  2DYJ A;  2WD9 A;  5LMU C;  1N2F A;  3CCR Z;  2M6N A;  2YCB A;  1YI2 Z;  3GR0 A;  4OYC A;  3S16 I;  1YJ7 A;  4MH4 A;  3IX0 A;  4LFA C;  3CC7 1;  3CME 1;  3HOY I;  2OBV A;  4D4I A;  2DE6 A;  1VQ7 1;  1VQN Z;  1KRL A;  1USP B;  1PG3 A;  3TDH B;  2KI7 B;  5FLX b;  1KQS Y;  3J7A 4;  1ZB8 A;  3I4N I;  4ZJZ A;  4NB8 A;  3C5E A;  3SO4 A;  4DV4 C;  4LF8 C;  2E7G A;  3T1Y C;  1P9N A;  1QM4 A;  1WW9 A;  4NBH A;  4MON A;  2VSQ A;  3G4S 1;  3OW2 Z;  1MDB A;  4DV0 C;  4JI1 C;  5IFI A;  4DR6 C;  2V8I A;  3S17 I;  1VLA A;  2WAQ A;  2QVX X;  4ISB A;  2P2F A;  1YJ9 1;  4A3B I;  1RLY A;  1RO0 A;  3D9X A;  2JS4 A;  1YI2 1;  5T67 A;  2QKD A;  5BSV A;  5T8S A;  5IWA C;  3FCE A;  2E5L C;  3NDJ A;  1XRB A;  4R1M A;  3CW8 X;  1YJN 1;  2F4O A;  3GTM I;  5BSM A;  3BG0 B;  4DV5 C;  4AQY C;  3CQZ I;  3F3F C;  4BSZ A;  2PM9 A;  5BR8 C;  3UOW A;  4YY3 C;  4MTN A;  1YJW 1;  2R92 I;  3GTJ I;  3QWU A;  1KC8 1;  2JMP A;  3VMH A;  4HGZ A;  1ZH1 A;  3GKQ A;  4DQY B;  4NH1 C;  4GXR A;  4G1I A;  2E2I I;  1KD1 1;  3A9U A;  1XMO C;  3IML A;  1Y1W I;  3GKU A;  2ZM6 C;  3HOZ I;  2D28 C;  5ADZ A;  1K0R A;  4NBE A;  1N32 C;  4EWC A;  3CME Z;  1KD1 2;  3Q87 A;  4RV9 A;  4OXI A;  4JV5 C;  3CCQ 1;  1YJN Z;  3CC4 Z;  3CC2 1;  5E7Q A;  2JA5 I;  3IEU A;  4WV3 A;  3GTG I;  2R6M A;  1VQM Z;  3PES A;  5CZV A;  4BCA A;  1TWA I;  3NDI A;  4DCT A;  1YJW Z;  3CXC Y;  4NBC A;  4NBF A;  4U5Y D;  3IF8 A;  2W04 A;  5C4X I;  2I3C A;  5D1O B;  3M3Y I;  4NBA A;  4DV3 C;  3IFU A;  1P7L A;  5A2Q D;  2UUC C;  2KZF A;  2V8J A;  4DCS A;  4B3T C;  5BST A;  4D57 A;  2F4M A;  1L1O C;  5C4J I;  3CCV Z;  4TPS B;  1TWC I;  5AN9 F;  3CCS 1;  2OPL B;  4E2Y A;  2H85 A;  2JNY A;  1VQ8 1;  2D1S A;  4L2Z A;  1W2B Z;  2UXC C;  2QA4 Z;  4JM1 A;  1YIJ Z;  3HOU I;  2E8C A;  2DE7 A;  2R7Z I;  1ULT A;  1XRC A;  3VNS A;  3CC2 Z;  5C3E I;  3LGX A;  1VQ5 1;  1KKG A;  3UZ0 A;  5D1O A;  2F4V C;  1TFI A;  4NDN A;  1VQM 1;  4DGL A;  4RLF A;  2UUB C;  1K83 I;  3M4O I;  4XX2 A;  2B63 I;  2OTJ 1;  4I9G A;  2E0G A;  4GKJ C;  4MD9 A;  2HHH C;  4DR2 C;  2P20 A;  3OTO C;  2RT9 A;  4IR7 A;  3DAY A;  2JR6 A;  2IZ3 A;  4RVO A;  4RS4 A;  4JI5 C;  4BC9 A;  4QTT A;  4R0M A;  3NYR A;  3FQQ A;  4E2W A;  2P2B A;  1VQ9 1;  3N2Q A;  4L4Q A;  3GTO I;  1N36 C;  3CCQ Z;  3S15 I;  4OX9 C;  3CC4 1;  1QF8 A;  2JA7 I;  3CD6 1;  5DV9 A;  5A2Q f;  4JI3 C;  3CMA 1;  2LFU A;  4JYA C;  1K8A 1;  3CCM 1;  3CCE 1;  3S2H I;  3GPC A;  4JI7 C;  1IBM C;  4A3E I;  4E32 A;  4K0K C;  1JJ2 Y;  1VQO 1;  4PHT A;  4X65 C;  3KXW A;  5IT9 D;  3PO2 I;  4GKK C;  2UU9 C;  1DL6 A;  4JI0 C;  2LIY A;  1ML8 A;  2YU9 I;  5T64 A;  4DUZ C;  3CPW Y;  1Q82 1;  3I55 Z;  2KPI A;  1YUK A;  2JMO A;  5T6B A;  1VQ8 Z;  3P5J B;  1IBK C;  3J81 b;  1M1K 2;  1IBL C;  1M90 2;  4RLQ A;  3L95 X;  5A19 A;  3NYQ A;  2ONF A;  5T8T A;  4DG8 A;  1VQP 1;  1Z03 A;  1N8R 2;  1AMU A;  5FLM I;  3RG2 A;  4DCV A;  1WCM I;  3CPW Z;  4X66 C;  3HKZ A;  2DE5 A;  4B3M C;  5CZX A;  2E9H A;  1WII A;  2ASB A;  2RPR A;  4D56 A;  3NH8 A;  3HOW I;  5GTD A;  4HGY A;  2V7B A;  2M48 A;  2R93 I;  2QVZ X;  4JI4 C;  3HOX I;  1VQ4 1;  3FCC A;  1Q86 2;  4BBR I;  2QEX 1;  3RZD I;  3KIH A;  1K9M 1;  4DV6 C;  2RIQ A;  4A3K I;  3D6W A;  5LMN C;  5AE3 A;  4KTV A;  3L8C A;  1XMQ C;  1RO4 A;  3VMI A;  1TWG I;  2P2M A;  4HPV A;  4IZ6 A;  4D4G A;  1JOS A;  3R9X A;  1HR0 C;  1Q86 1;  3EED A;  3RZO I;  4NXN C;  4DV7 C;  2QR1 B;  1MDF A;  1I94 C;  4K0B A;  3CMA Z;  3E7W A;  4DR4 C;  2WB1 A;  4X6A I;  3CCJ 1;  3CC7 Z;  3GTM S;  2P2J A;  3J80 f;  3CCU Z;  1FJG C;  1T5D X;  4DR5 C;  4RVF A;  1N8R 1;  2D1T A;  5AE1 A;  4B3R C;  1MXC A;  4LE5 A;  3I56 Z;  3NFZ A;  4LF4 C;  1V26 A;  3T4N B;  2GU2 A;  2D1Q A;  4NBG A;  1YHQ 1;  3TUF A;  2BH1 X;  4RM3 A;  1JJ2 Z;  3JAM D;  4PZP A;  2VUM I;  3EER A;  4A3F I;  1LQL A;  3ETC A;  4DR3 C;  3J80 b;  1VQ4 Z;  1KQS Z;  1XNQ C;  2P02 A;  1T5H X;  1WH9 A;  4NXM C;  2XR1 A;  2QEX Z;  3I55 1;  1BA3 A;  1NP6 A;  1FUG A;  3CCR 1;  3FKI I;  2GTI A;  4NBB A;  2JUB A;  2UUA C;  4KTT A;  3H0G I;  2OPL A;  3PBK A;  3N54 B;  3ETO A;  2K5R A;  2GTH A;  1O90 A;  2OOY B;  4NOZ A;  2Q51 A;  4RVG A;  2D1R A;  3T1H C;  1Q7Y 1;  4A3L I;  1VQ7 Z;  5H9U A;  3I08 A;  4E2X A;  2PK7 A;  4CL1 A;  4BXX I;  3FQM A;  3CCU 1;  3F3P C;  2D27 A;  3OW2 Y;  2CXC A;  4DG9 A;  1PG4 A;  2G2K A;  2P28 A;  3U50 C;  2D7V A;  3S1M I;  3MZL B;  2E2H I;  1YHQ Z;  1TWH I;  2VQE C;  4G36 A;  4LF5 C;  3DLP X;  1PFT A;  4RVD A;  2AYA A;  2QL8 A;  2P2Q A;  4DK1 A;  3MON A;  1KC8 2;  1HNX C;  1MXA A;  2PT7 G;  3J80 D;  4RM2 A;  3GTK I;  1I3Q I;  2QVY X;  3IPL A;  1YJ9 Z;  3DHV A;  1RY2 A;  1VQ6 Z;  5FLX f;  4JI6 C;  2YWC A;  5IP7 I;  4FTF A;  1W2B Y;  2PMZ A;  1X3W A;  1YUA A;  2BJO A;  2YWB A;  1NYE A;  5KYT A;  1Z02 A;  2VZE A;  3VTN A;  2QRE B;  4BY7 I;  3R9W A;  4MRI A;  4BC7 A;  5KEI A;  4TNU A;  2QW0 X;  4GXQ A;  5FLX D;  5A1G A;  4A3D I;  5K85 A;  3AF6 A;  3ESW A;  1NJI 1;  1VQK Z;  3BG1 B;  3CXC Z;  2NVX I;  5LL6 f;  2DPL A;  4EAT A;  3NH5 A;  2O4H A;  2HF1 A;  3CCL 1;  1Y1V I;  1RNI A;  4A3J I;  4Y7N I;  2IZ4 A;  1QVG Z;  4E33 A;  3S82 A;  1S72 Z;  3VMG A;  1MXB A;  2NVT I;  2HJG A;  5C44 I;  3S1Q I;  2CY1 A;  3CCS Z;  1K73 1;  2JA8 I;  3A9V A;  5BUQ A;  1M90 1;  4X64 C;  4E30 A;  4FUT A;  3B7W A;  3GCF A;  2E8E A;  4HH4 A;  2PN2 A;  4BBY A;  5A1I A;  1VQN 1;  1HNZ C;  4DR1 C;  3G6E 1;  2ATW A;  4Y52 I;  1YIT Z;  2HU9 A;  3S2D I;  1NJI 2;  2WP0 C;  5BSW A;  1UKK A;  1QWI A;  4ODJ A;  4RVN A;  3J81 D;  4B3S C;  4R1L A;  4DCU A;  2OO4 A;  5BUS A;  5KYV A;  4DV2 C;  2W03 A;  2QRC B;  3PO3 I;  2VQF C;  3VNR A;  2O53 A;  2J6A A;  1HNW C;  1Q81 1;  4A3I I;  2RHB A;  4ZLP A;  4YHH C;  4E2Z A;  4L7I A;  5K8F A;  2Y4N A;  2V8K A;  3H2T A;  3HOV I;  4I9F A;  1VQL Z;  3A4I A;  2EGT A;  3PRO C;  3IEV A;  1VQ9 Z;  1YIJ 1;  2OOX B;  1QVF Y;  3LAX A;  3MZK B;  1O9T A;  1MD9 A;  4LF9 C;  3GTQ I;  3CW9 A;  3CCJ Z;  3S14 I;  2E8F A;  1K73 2;  3CD6 Z;  5JRH A;  4MD7 A;  2UXB C;  1ZB9 A;  4S1T A;  4NFR A;  1M1K 1;  5IP9 I;  1QVG Y;  3G6E Z;  1JWH C;  1YIT 1;  1VQK 1;  3CCM Z;  4G37 A;  4WS9 A;  3E7X A;  1S7M A;  2JA6 I;  3CCL Z;  1Q81 2;  5BUR A;  4NBD A;  2VF1 A;  4A93 I;  3G71 Z;  2Y27 A;  3I07 A;  4A3C I;  3LUS A;  3AF5 A;  3LNV A;  1XNR C;  2NVQ I;  1O92 A;  5BSR A;  4X62 C;  2RBL A;  1N34 C;  1Z01 A;  4FUQ A;  5D1P A;  3TE5 B;  1MKY A;  4JI2 C;  2AKL A;  2QLV B;  4BBS I;  1VQL 1;  1X0T A;  4MD8 A;  2Y0S A;  3RV2 A;  3VB9 A;  2OTL Z;  1K8A 2;  2UXD C;  3TQI A;  1L2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...