1ZB8A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
140
Chain Sequence
SLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
molecule keywords organic hydroperoxide resistance protein
total genus 34
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb8A02
4NOZA 4A3DI 2E2JI 3PO3I 4NBHA 4BXXI 4Y52I 1MKYA 2YCBA 1IBLC 4B3MC 1KKGA 2JA5I 1XMQC 2E2II 1I3QI 1TWHI 4DCSA 3IEVA 5C3EI 2D7VA 3M4OI 3FKII 4DV4C 3GTMI 4DV7C 3IEUA 3HOWI 4B3RC 3GTPI 3S17I 4YY3C 2NVQI 4JI7C 3HOXI 4DCVA 4BBRI 2YU9I 1DL6A 5FLMI 1IBKC 3H3VJ 3LUSA 2E8EA 2JNYA 3H0GI 4NBDA 1WF3A 1SFOI 2UUBC 3R9XA 3CQZI 1TFIA 4X65C 2R92I 5IP7I 4B3SC 4NBAA 1K83I 2KPIA 4DUYC 2B63I 4BSZA 4DV2C 4DR4C 4BY1I 4DV1C 4JI3C 2VQFC 3GTKI 1N32C 4GKKC 3I4MI 4A3BI 1UKKA 1RO4A 4NBFA 3VMGA 3S16I 4A3JI 4A3LI 4A3MI 2UXBC 3ESWA 3S2DI 4BBSI 5LMNC 2NVTI 4JI1C 3GTMS 5C4JI 4GKJC 4NB8A 4OX9C 4LFBC 2F4OA 2XR1A 3S1NI 1ML8A 2AKLA 4XX2A 3RZOI 4Y7NI 2OPLA 2F4VC 4JI2C 1I50I 1TWAI 1USPB 2DYJA 4LF5C 2RBLA 3HOZI 4A3GI 4LF7C 4QTTA 5IP9I 2R7ZI 2JMPA 4DV5C 3T1HC 5FLXD 1R9TI 2VUMI 1EGAA 4DCUA 4A93I 4AQYC 4KHPC 3S1RI 2DE7A 5IWAC 1ZB9A 5LMUC 3PO3S 2ZM6C 5IT9D 3HOVI 1HH2P 3J81D 3VMHA 3GTGI 3I07A 1XMOC 3GTOI 1L2FA 4X6AI 1ZB8A 4B3TC 2J6AA 2NVXI 1JOSA 3OTOC 1HNXC 4X62C 1HNZC 4DR7C 4DV6C 2F4MA 1J5EC 3GTJI 2E5LC 2ATWA 1N33C 1TWFI 2JS4A 3VMIA 1NYEA 2E8CA 4JI6C 1K0RA 1TWGI 4NB9A 4DR1C 3EERA 1XNRC 3Q87A 3AF6A 1Y1WI 1WW9A 2PN2A 3M3YI 4JI8C 4DR6C 4JYAC 3AF5A 2UU9C 1N34C 4JI5C 1Y1VS 3JAMD 1QYPA 2HF1A 1X3ZA 1IBMC 1Y1VI 3D6WA 3HOYI 5C4XI 4X64C 4JI4C 2JR6A 1L1OC 2JA7I 4MTNA 4NBBA 4QTUA 3GTLI 4DUZC 4LF4C 1TWCI 4MH4A 4A3CI 2CY1A 4DR3C 5C44I 2HJGA 2EGTA 4NBCA 1VLAA 3GCFA 3S1MI 2PK7A 4NXNC 2E8FA 2HHHC 4A3FI 4BY7I 4DR5C 3T1YC 4LFCC 3U50C 1HNWC 3S14I 4DCTA 4LF9C 3K7AI 4LF8C 4JI0C 2ASBA 3VB9A 1N2FA 2P3YA 3S2HI 4NXMC 3GTQI 4A3KI 1YUAA 4DV3C 3R9WA 4JV5C 1FJGC 4A3II 2CXCA 2DE5A 2E2HI 2K5RA 2VQEC 2R93I 3CJEA 1HR0C 3S15I 2UXDC 1PA4A 1I6HI 4X66C 4DV0C 1LQLA 3I4NI 1QWIA 2QL8A 1RLYA 2UUAC 2DE6A 1NUIA 4YHHC 4LF6C 4A3EI 3S1QI 2JA8I 3GKUA 3RZDI 4NBEA 3PO2I 1X3WA 5CM2M 1WCMI 2E7GA 2BJOA 1WH9A 2OPLB 1I94C 3GKQA 5A2QD 2UUCC 3J80D 1USPA 1N36C 2NVYI 4DR2C 2ONFA 1PFTA 2JA6I 4NBGA 2UXCC 3HOUI 2PT7G 4LFAC 1XNQC 5BR8C 2KZFA 4K0KC
chains in the Genus database with same CATH superfamily
4Y52I 2E2JI 1TH5A 1IBLC 4BXXI 1MKYA 1VQ81 1XRAA 2CU6A 2P28A 4RVOA 3UOWA 1KKGA 2P02A 3NPDA 2D7VA 4IR7A 5T8TA 1Q811 3ETCA 3GTPI 3CCS1 3CCVZ 4JM1A 2PROA 5A19A 2JIPA 3CCLZ 2QEX1 4BBRI 4RVHA 1IBKC 3H3VJ 4ZLPA 2JNYA 3OW2Y 2OTJZ 3R9XA 3CQZI 2R92I 5IT9b 1XRCA 5IP7I 1S7MA 3CCRZ 1K83I 4DV2C 1RG9A 4KTVA 4JI3C 3GTKI 4A3BI 1RO4A 1VEHA 2KDNA 5JRHA 3VMGA 4DK1A 1M902 3CPWY 2D1TA 1SIWA 3ESWA 4HGYA 2NVTI 4RM2A 4LFBC 2YX1A 3AY0A 2V8JA 3S1NI 3RZOI 3OW2Z 2WP0C 1KC81 3NFZA 3CCL1 1I50I 4L2ZA 4LF5C 3EQ6A 2RBLA 5IP9I 2JMPA 3E7XA 1LCIA 1FDIA 1R9TI 2ZZNA 3G4SZ 2ZZMA 1VQM1 1Q16A 4D4IA 5LMUC 5IT9D 3HOVI 2VUGA 4KTTA 1XMOC 1QM4A 3FCCA 4R0MA 1PG3A 2NVXI 3CCM1 2GTIA 4E33A 1FUGA 1J5EC 2JS4A 3VMIA 1N8R2 3NYQA 3MZLB 1K0RA 1MXAA 3S82A 1TWGI 3JAMf 1YUKA 4RVGA 4DR1C 2Z51A 3Q87A 4RVDA 2IZ4A 5GTDA 4DR6C 3AF5A 4OYCA 1MXCA 3NI2A 4RMNA 4DQYB 3BG1B 4JI4C 2JR6A 2JA7I 1QVFZ 5AE2A 4E30A 1VQNZ 1VQP1 1JJ2Y 4MH4A 5T64A 4A3CI 2NCLA 4FUQA 4GS5A 1YI21 3A26A 1M1K2 3NH4A 4WS9A 4NXNC 2E8FA 4A3FI 3T1YC 4IZ6A 3U50C 4DCTA 4E2XA 4NXMC 2P3YA 3CCEZ 1P4EC 4A3KI 4DV3C 1VQLZ 3CCV1 1P9NA 3CQ2A 2MM9A 2R93I 2O53A 4X66C 1LQLA 1NJI1 1RLYA 3CC21 3IF8A 4BC9A 4A3EI 4PZPA 5D1PA 3PO2I 1P7LA 1YJN1 2E7GA 1NY8A 2BJOA 3H2TA 2UUCC 5A2QD 3J80D 2D1QA 3CC71 2ONFA 1PFTA 2JA6I 4NBGA 5BSMA 2M5OA 4LFAC 1XNQC 2I3CA 3CXCZ 3KIFA 3FQMA 3A9VA 4B3MC 2E2II 1I3QI 1VQ91 4ODJA 4DCSA 1XRBA 3FKII 5BUSA 3GTMI 3IEUA 3CCR1 3CW8X 4YY3C 2NVQI 4JI7C 3HOXI 1VQ7Z 3CCE1 3LUSA 2UUBC 4BC7A 1SFOI 1Q7Y1 1X0TA 2W03A 3CMAZ 2P2QA 4B3SC 2YWCA 3G711 3IMLA 4BSZA 4BY1I 3J7A4 3KIHA 1YI2Z 4PHTA 5K85A 4K0BA 1S721 4EATA 1Z03A 1N32C 3GR1A 1XS3A 2AYAA 2M6NA 2UXBC 4BBSI 2Q4ZA 3F3FC 5LMNC 3GTMS 5C4JI 4GKJC 4NB8A 1VQKZ 4OX9C 1YJ91 2P20A 1ML8A 2AKLA 2RIQA 2V8IA 2QW0X 2VSQA 1VQ71 1PG4A 3CCUZ 2QRCB 3CC41 2DYJA 3UX2A 4DV5C 2R7ZI 4GXRA 1MD9A 5BSWA 4DCUA 4AQYC 4A93I 5LL6f 3S1RI 2DE7A 4FUTA 5IWAC 4FTFA 4HGZA 2ZM6C 4E2WA 3J81D 3I07A 3GTOI 1L2FA 4X6AI 4I9FA 4MRIA 2QA41 3CQ3A 4E31A 1O9TA 1K9M2 1HNXC 5E7QA 4MXUA 4DV6C 1MDFA 3VNRA 5KYVA 1N33C 3G4S1 2YWBA 1TWFI 3BG0B 3CME1 3PROC 1VQO1 3EERA 2JIOA 3IX0A 3B7WA 4JYAC 1N34C 2RT9A 1Y1VS 1QYPA 1IBMC 4RLQA 2OZKA 1Y1VI 4X64C 4MTNA 2OBVA 2WAQA 4L4QA 1V26A 1M1K1 1TWCI 4TPSB 3UZ0A 5C44I 2EGTA 1W2BZ 2PK7A 3CCU1 3VB9A 1AA6A 1FJGC 4MD9A 1QVGZ 1VQN1 3TR3A 4DGLA 1VQ5Z 2K5RA 3TE5B 1Z01A 1N8R1 1PA4A 3RV2A 1Q7Y2 4DV0C 1VQ6Z 3I4NI 1QWIA 2UUAC 3UEBA 4YHHC 1NUIA 4NBEA 5CM2M 4PUGA 2O4HA 1WH9A 1I94C 2OOXB 2QKDA 1O90A 1YJ7A 4PUHA 5BSUA 1MXBA 1P4EA 2HU9A 2UXCC 4RS4A 2VPXA 1QVGY 2RPRA 3CCSZ 4AYBA 4CL1A 3LNOA 1VQK1 4OXIA 5BR8C 4K0KC 4NOZA 1JWHC 1RO2A 2JIMA 3I551 4A3DI 1PU1A 2E0GA 5FLXb 1KC82 3A25A 2LEXA 3VNQA 1WIIA 2JIRA 1YHQZ 4DG8A 5C3EI 2PMZA 5AN9F 1KD11 4GXQA 4DV7C 5A2Qb 3J81b 2IV2X 4RVFA 1KRLA 3QWUA 4DCVA 3CCQ1 1RQFA 5CZXA 2YU9I 5FLMI 2E8EA 4NBDA 1WF3A 1Q861 3J80b 1YIJZ 3NDJA 4NBAA 2M5HA 4RLFA 4DUYC 3MZKB 1YJ9Z 1VQ61 5IFIA 1QVFY 3I4MI 1UKKA 4G37A 1KQSY 1QF8A 4G1IA 3S2DI 3E7WA 4JI1C 2F4OA 4MD7A 2WD9A 2XR1A 3IPLA 5BSTA 5BURA 4XX2A 2KI7B 4Y7NI 2OPLA 3CCQZ 5T67A 4JI2C 3A4IA 2W04A 3CCMZ 1Z02A 3HOZI 2VPZA 4A3GI 1IB8A 4QTTA 4LF7C 3T1HC 1Q862 1Q822 2VUMI 2V7BA 4U5YD 2QVZX 3G7SA 5CZVA 5AE3A 3SO4A 3PO3S 1VQ8Z 2OOYB 5D1OB 1Q821 3VMHA 3MONA 3GTGI 3FCEA 4MONA 3NYRA 2J6AA 1JOSA 1KD12 4X62C 1HNZC 2OO4A 2E5LC 3GTJI 3CD6Z 2AYDA 3NH8A 4JI6C 1NYEA 1YIT1 2Q51A 4NB9A 1XNRC 3D2LA 3CD61 1M6XC 2PN2A 1WW9A 2BH1X 4JI8C 3LNVA 1K731 5T8SA 1RO0A 2V3VA 2YADA 3JAMD 2LFUA 2UU9C 4JI5C 1X3ZA 5KEIA 3I561 2GTHA 3D6WA 1VQ51 1YJWZ 1Y8CA 4NBBA 3CC2Z 1BA3A 1T5HX 4DUZC 1S72Z 1MDBA 2GU2A 1WJ2A 4DR3C 2HJGA 2Y4OA 3GR0A 4NBCA 3PESA 1VLAA 3GCFA 4DG9A 5KYTA 3FQQA 4LFCC 4BY7I 4DR5C 3HKZA 1M901 4JI0C 2VZEA 3NDIA 3S2HI 4E32A 3GTQI 2Y4NA 1YUAA 4JV5C 4A3II 2P2JA 2CXCA 3G6EZ 2E2HI 2UXDC 1HR0C 2MMAB 1I6HI 3UX3A 1WZNA 3TDHB 5A2Qf 3S1QI 3VNSA 1V25A 2D27A 1X3WA 3D9XA 1WCMI 2OPLB 1YITZ 1Q812 1N36C 4BBYA 2NVYI 2V8KA 4PUIA 1FDOA 3J80f 2PT7G 4EWCA 3L8CA 3CPWZ 2QREB 2KZFA 3EEDA 2OTL1 3PBKA 3PO3I 4NBHA 5D1OA 5AE1A 1NP6A 3G6E1 2JMOA 2YCBA 5BSVA 2JA5I 3TDEA 3LAXA 4D56A 1TWHI 4RVNA 1XMQC 3IEVA 2K3RA 3M4OI 4RM3A 1AMUA 4DV4C 2VPWA 4B3RC 2QLVB 3HOWI 1K8A1 1YIJ1 5H9UA 3S17I 4RV9A 4NDNA 4TNUA 1QXFA 3CC7Z 1DL6A 1XHJA 2JUBA 3H0GI 2E9HA 3N54B 2QEXZ 2Y27A 1TFIA 4X65C 4R1LA 1YJW1 3LGXA 4LE5A 2H85A 2KPIA 1O92A 2B63I 2P2BA 4DR4C 2DHMA 4PROC 4DV1C 2VQFC 1VQPZ 2D1SA 4GKKC 5T6BA 3VTNA 4NBFA 3ETOA 4BCAA 3S16I 4A3JI 4A3LI 4A3MI 5DV9A 5A1IA 3CXCY 3TUFA 3C5EA 2OTJ1 3L95X 4R1MA 2JIQA 3G71Z 1K9M1 2F4VC 1VQ41 1USPB 1TWAI 1VQOZ 3A9UA 3GPCA 4D57A 5FLXD 5IT9f 2V45A 2PM9A 3CMEZ 3CCJ1 1EGAA 1VQ9Z 2DPLA 5A1GA 4KHPC 2D1RA 4E2YA 1ZB9A 5FLXf 4MD8A 2D28C 1VQMZ 1HH2P 3CCJZ 4HPVA 3K6RA 2P2FA 5BUQA 3O2EA 3I56Z 2MCQA 1ZB8A 4B3TC 4D4GA 3N2QA 3CC4Z 3CW9A 3OTOC 2NAPA 3J81f 3F3PC 1JJ2Z 4DR7C 1RNIA 2QVYX 2F4MA 3KXWA 2ATWA 3P5JB 1WCJA 4NH1C 2E8CA 1KQSZ 2QR1B 3I08A 1ZH1A 2IZ3A 2QVXX 1VQ4Z 3DAYA 2G2KA 3AF6A 1Y1WI 3M3YI 2E7ZA 2KZ0A 2HF1A 2RHBA 3HOYI 5C4XI 4E2ZA 1L1OC 3NH5A 4QTUA 3GTLI 3CQ1A 1VQL1 3DHVA 4LF4C 2M48A 2WB1A 2CY1A 1W2BY 1ULTA 1NJI2 4G36A 5ADZA 3S1MI 2HHHC 3RG2A 1HNWC 5K8FA 3S14I 3CMA1 3K7AI 4WV3A 4LF8C 4LF9C 2ASBA 4L7IA 1N2FA 3JAMb 4NFRA 1K732 3T4NB 5LCIA 3R9WA 2DE5A 3IR7A 2QA4Z 2VQEC 3CJEA 3S15I 1M6XA 5BSRA 1RY2A 2QRDB 4ZJZA 4LF6C 2QL8A 1YHQ1 2DE6A 4I9GA 1T5DX 1UWDA 2JA8I 2P2MA 3I55Z 3RZDI 3GKUA 3IFUA 2R6MA 2OTLZ 1K8A2 1O93A 2JNVA 2LIYA 3GKQA 3TQIA 1FLOA 1USPA 1YJNZ 2Y0SA 4S1TA 1GPMA 4HH4A 4DR2C 2VF1A 2ZAEB 3DLPX 3HOUI 3R44A 2VPYA 4ISBA 1V60A
chains in the Genus database with same CATH topology
4Y52I 2E2JI 1IBLC 4BXXI 1MKYA 1VQ81 1XRAA 3UOWA 2P28A 4RVOA 1KKGA 2P02A 3NPDA 2D7VA 4IR7A 5T8TA 1Q811 3ETCA 3GTPI 3CCS1 3CCVZ 4JM1A 2PROA 5A19A 3CCLZ 2QEX1 4BBRI 4RVHA 1IBKC 3H3VJ 4ZLPA 2JNYA 3OW2Y 2OTJZ 3R9XA 3CQZI 2R92I 5IT9b 1XRCA 5IP7I 1S7MA 3CCRZ 1K83I 4DV2C 1RG9A 4KTVA 4JI3C 3GTKI 4A3BI 1RO4A 5JRHA 3VMGA 4DK1A 1M902 3CPWY 2D1TA 3ESWA 4HGYA 2NVTI 4RM2A 4LFBC 2V8JA 3S1NI 3RZOI 3OW2Z 2WP0C 1KC81 3NFZA 3CCL1 1I50I 4L2ZA 4LF5C 3EQ6A 2RBLA 5IP9I 2JMPA 3E7XA 1LCIA 1R9TI 3G4SZ 1VQM1 4D4IA 5LMUC 5IT9D 3HOVI 2VUGA 4KTTA 1XMOC 1QM4A 3FCCA 4R0MA 1PG3A 2NVXI 3CCM1 2GTIA 4E33A 1FUGA 1J5EC 2JS4A 3VMIA 1N8R2 3NYQA 3MZLB 1K0RA 1MXAA 3S82A 1TWGI 3JAMf 1YUKA 4RVGA 4DR1C 3Q87A 4RVDA 2IZ4A 5GTDA 4DR6C 3AF5A 4OYCA 1MXCA 3NI2A 4RMNA 4DQYB 3BG1B 4JI4C 2JR6A 2JA7I 1QVFZ 5AE2A 4E30A 1VQNZ 1VQP1 1JJ2Y 4MH4A 5T64A 4A3CI 4FUQA 4GS5A 1YI21 1M1K2 3NH4A 4WS9A 4NXNC 2E8FA 4A3FI 3T1YC 4IZ6A 3U50C 4DCTA 4E2XA 4NXMC 2P3YA 3CCEZ 4A3KI 4DV3C 1VQLZ 3CCV1 1P9NA 2R93I 2O53A 4X66C 1LQLA 1NJI1 1RLYA 3CC21 3IF8A 4BC9A 4A3EI 4PZPA 5D1PA 3PO2I 1P7LA 1YJN1 2E7GA 2BJOA 3H2TA 2UUCC 5A2QD 3J80D 2D1QA 3CC71 2ONFA 1PFTA 2JA6I 4NBGA 5BSMA 4LFAC 1XNQC 2I3CA 3CXCZ 3KIFA 3FQMA 3A9VA 4B3MC 2E2II 1I3QI 1VQ91 4ODJA 4DCSA 1XRBA 3FKII 5BUSA 3GTMI 3IEUA 3CCR1 3CW8X 4YY3C 2NVQI 4JI7C 3HOXI 1VQ7Z 3CCE1 3LUSA 2UUBC 4BC7A 1SFOI 1Q7Y1 1X0TA 2W03A 3CMAZ 2P2QA 4B3SC 2YWCA 3G711 3IMLA 4BSZA 4BY1I 3J7A4 3KIHA 1YI2Z 4PHTA 5K85A 4K0BA 1S721 4EATA 1Z03A 1N32C 3GR1A 2AYAA 2M6NA 2UXBC 4BBSI 2Q4ZA 3F3FC 5LMNC 3GTMS 5C4JI 4GKJC 4NB8A 1VQKZ 4OX9C 1YJ91 2P20A 1ML8A 2AKLA 2RIQA 2V8IA 2QW0X 2VSQA 1VQ71 1PG4A 3CCUZ 2QRCB 3CC41 2DYJA 4DV5C 2R7ZI 4GXRA 1MD9A 5BSWA 4DCUA 4AQYC 4A93I 5LL6f 3S1RI 2DE7A 4FUTA 5IWAC 4FTFA 4HGZA 2ZM6C 4E2WA 3J81D 3I07A 3GTOI 1L2FA 4X6AI 4I9FA 4MRIA 2QA41 4E31A 1O9TA 1K9M2 1HNXC 5E7QA 4MXUA 4DV6C 1MDFA 3VNRA 5KYVA 1N33C 3G4S1 2YWBA 1TWFI 3BG0B 3CME1 3PROC 1VQO1 3EERA 3IX0A 3B7WA 4JYAC 1N34C 2RT9A 1Y1VS 1QYPA 1IBMC 4RLQA 2OZKA 1Y1VI 4X64C 4MTNA 2OBVA 2WAQA 4L4QA 1V26A 1M1K1 1TWCI 4TPSB 3UZ0A 5C44I 2EGTA 1W2BZ 2PK7A 3CCU1 3VB9A 1FJGC 4MD9A 1QVGZ 1VQN1 4DGLA 1VQ5Z 2K5RA 3TE5B 1Z01A 1N8R1 1PA4A 3RV2A 1Q7Y2 4DV0C 1VQ6Z 3I4NI 1QWIA 2UUAC 4YHHC 1NUIA 4NBEA 5CM2M 2O4HA 1WH9A 1I94C 2OOXB 2QKDA 1O90A 1YJ7A 5BSUA 1MXBA 2HU9A 2UXCC 4RS4A 1QVGY 2RPRA 3CCSZ 4AYBA 4CL1A 1VQK1 4OXIA 5BR8C 4K0KC 4NOZA 1JWHC 1RO2A 3I551 4A3DI 2E0GA 5FLXb 1KC82 3VNQA 1WIIA 1YHQZ 4DG8A 5C3EI 2PMZA 5AN9F 1KD11 4GXQA 4DV7C 5A2Qb 3J81b 4RVFA 1KRLA 3QWUA 4DCVA 3CCQ1 1RQFA 5CZXA 2YU9I 5FLMI 2E8EA 4NBDA 1WF3A 1Q861 3J80b 1YIJZ 3NDJA 4NBAA 4RLFA 4DUYC 3MZKB 1YJ9Z 1VQ61 5IFIA 1QVFY 3I4MI 1UKKA 4G37A 1KQSY 1QF8A 4G1IA 3S2DI 3E7WA 4JI1C 2F4OA 4MD7A 2WD9A 2XR1A 3IPLA 5BSTA 5BURA 4XX2A 2KI7B 4Y7NI 2OPLA 3CCQZ 5T67A 4JI2C 3A4IA 2W04A 3CCMZ 1Z02A 3HOZI 4A3GI 4LF7C 4QTTA 3T1HC 1Q862 1Q822 2VUMI 2V7BA 4U5YD 2QVZX 3G7SA 5CZVA 5AE3A 3SO4A 3PO3S 1VQ8Z 2OOYB 5D1OB 1Q821 3VMHA 3MONA 3GTGI 3FCEA 4MONA 3NYRA 2J6AA 1JOSA 1KD12 4X62C 1HNZC 2OO4A 2E5LC 3GTJI 3CD6Z 3NH8A 4JI6C 1NYEA 1YIT1 2Q51A 4NB9A 1XNRC 3CD61 2PN2A 1WW9A 2BH1X 4JI8C 3LNVA 1K731 5T8SA 1RO0A 2YADA 2UU9C 3JAMD 2LFUA 4JI5C 1X3ZA 5KEIA 3I561 2GTHA 3D6WA 1VQ51 1YJWZ 4NBBA 3CC2Z 1BA3A 1T5HX 4DUZC 1S72Z 1MDBA 2GU2A 4DR3C 2HJGA 2Y4OA 3GR0A 4NBCA 3PESA 1VLAA 3GCFA 4DG9A 5KYTA 3FQQA 4LFCC 4BY7I 4DR5C 3HKZA 1M901 4JI0C 2VZEA 3NDIA 3S2HI 4E32A 3GTQI 2Y4NA 1YUAA 4JV5C 4A3II 2P2JA 2CXCA 3G6EZ 2E2HI 2UXDC 1HR0C 1I6HI 3TDHB 5A2Qf 3S1QI 3VNSA 1V25A 2D27A 1X3WA 3D9XA 1WCMI 2OPLB 1YITZ 1Q812 1N36C 4BBYA 2NVYI 2V8KA 3J80f 2PT7G 4EWCA 3L8CA 3CPWZ 2QREB 2KZFA 3EEDA 2OTL1 3PBKA 3PO3I 4NBHA 5D1OA 5AE1A 1NP6A 3G6E1 2JMOA 2YCBA 5BSVA 2JA5I 3TDEA 3LAXA 4D56A 1TWHI 4RVNA 1XMQC 3IEVA 2K3RA 3M4OI 4RM3A 1AMUA 4DV4C 4B3RC 2QLVB 3HOWI 1K8A1 1YIJ1 5H9UA 3S17I 4RV9A 4NDNA 4TNUA 3CC7Z 1DL6A 2JUBA 3H0GI 2E9HA 3N54B 2QEXZ 2Y27A 1TFIA 4X65C 4R1LA 1YJW1 3LGXA 4LE5A 2H85A 2KPIA 1O92A 2B63I 2P2BA 4DR4C 4PROC 4DV1C 2VQFC 1VQPZ 2D1SA 4GKKC 5T6BA 3VTNA 4NBFA 3ETOA 4BCAA 3S16I 4A3JI 4A3LI 4A3MI 5DV9A 5A1IA 3CXCY 3TUFA 3C5EA 2OTJ1 3L95X 4R1MA 3G71Z 1K9M1 2F4VC 1VQ41 1USPB 1TWAI 1VQOZ 3A9UA 3GPCA 4D57A 5FLXD 5IT9f 3CCJ1 2PM9A 3CMEZ 1EGAA 2DPLA 1VQ9Z 5A1GA 4KHPC 2D1RA 4E2YA 1ZB9A 5FLXf 4MD8A 2D28C 1VQMZ 1HH2P 3CCJZ 4HPVA 2P2FA 5BUQA 3I56Z 1ZB8A 4B3TC 4D4GA 3N2QA 3CC4Z 3CW9A 3OTOC 3J81f 3F3PC 1JJ2Z 4DR7C 1RNIA 2QVYX 2F4MA 3KXWA 2ATWA 3P5JB 4NH1C 2E8CA 1KQSZ 2QR1B 3I08A 1ZH1A 2IZ3A 2QVXX 1VQ4Z 3DAYA 2G2KA 3AF6A 1Y1WI 3M3YI 2HF1A 2RHBA 3HOYI 5C4XI 4E2ZA 1L1OC 3NH5A 4QTUA 3GTLI 3DHVA 1VQL1 4LF4C 2M48A 2WB1A 2CY1A 1W2BY 1ULTA 1NJI2 4G36A 5ADZA 3S1MI 2HHHC 3RG2A 1HNWC 5K8FA 3S14I 3CMA1 3K7AI 4WV3A 4LF8C 4LF9C 2ASBA 4L7IA 1N2FA 3JAMb 4NFRA 1K732 3T4NB 3R9WA 2DE5A 2QA4Z 2VQEC 3CJEA 3S15I 5BSRA 1RY2A 2QRDB 4ZJZA 4LF6C 2QL8A 1YHQ1 2DE6A 4I9GA 1T5DX 2JA8I 2P2MA 3I55Z 3RZDI 3GKUA 3IFUA 2R6MA 2OTLZ 1K8A2 1O93A 3TQIA 2LIYA 3GKQA 1USPA 1YJNZ 2Y0SA 4S1TA 1GPMA 4HH4A 4DR2C 2VF1A 2ZAEB 3HOUI 3R44A 4ISBA 3DLPX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NOZ A;  4A3D I;  2E2J I;  3PO3 I;  4NBH A;  4BXX I;  4Y52 I;  1MKY A;  2YCB A;  1IBL C;  4B3M C;  1KKG A;  2JA5 I;  1XMQ C;  2E2I I;  1I3Q I;  1TWH I;  4DCS A;  3IEV A;  5C3E I;  2D7V A;  3M4O I;  3FKI I;  4DV4 C;  3GTM I;  4DV7 C;  3IEU A;  3HOW I;  4B3R C;  3GTP I;  3S17 I;  4YY3 C;  2NVQ I;  4JI7 C;  3HOX I;  4DCV A;  4BBR I;  2YU9 I;  1DL6 A;  5FLM I;  1IBK C;  3H3V J;  3LUS A;  2E8E A;  2JNY A;  3H0G I;  4NBD A;  1WF3 A;  1SFO I;  2UUB C;  3R9X A;  3CQZ I;  1TFI A;  4X65 C;  2R92 I;  5IP7 I;  4B3S C;  4NBA A;  1K83 I;  2KPI A;  4DUY C;  2B63 I;  4BSZ A;  4DV2 C;  4DR4 C;  4BY1 I;  4DV1 C;  4JI3 C;  2VQF C;  3GTK I;  1N32 C;  4GKK C;  3I4M I;  4A3B I;  1UKK A;  1RO4 A;  4NBF A;  3VMG A;  3S16 I;  4A3J I;  4A3L I;  4A3M I;  2UXB C;  3ESW A;  3S2D I;  4BBS I;  5LMN C;  2NVT I;  4JI1 C;  3GTM S;  5C4J I;  4GKJ C;  4NB8 A;  4OX9 C;  4LFB C;  2F4O A;  2XR1 A;  3S1N I;  1ML8 A;  2AKL A;  4XX2 A;  3RZO I;  4Y7N I;  2OPL A;  2F4V C;  4JI2 C;  1I50 I;  1TWA I;  1USP B;  2DYJ A;  4LF5 C;  2RBL A;  3HOZ I;  4A3G I;  4LF7 C;  4QTT A;  5IP9 I;  2R7Z I;  2JMP A;  4DV5 C;  3T1H C;  5FLX D;  1R9T I;  2VUM I;  1EGA A;  4DCU A;  4A93 I;  4AQY C;  4KHP C;  3S1R I;  2DE7 A;  5IWA C;  1ZB9 A;  5LMU C;  3PO3 S;  2ZM6 C;  5IT9 D;  3HOV I;  1HH2 P;  3J81 D;  3VMH A;  3GTG I;  3I07 A;  1XMO C;  3GTO I;  1L2F A;  4X6A I;  1ZB8 A;  4B3T C;  2J6A A;  2NVX I;  1JOS A;  3OTO C;  1HNX C;  4X62 C;  1HNZ C;  4DR7 C;  4DV6 C;  2F4M A;  1J5E C;  3GTJ I;  2E5L C;  2ATW A;  1N33 C;  1TWF I;  2JS4 A;  3VMI A;  1NYE A;  2E8C A;  4JI6 C;  1K0R A;  1TWG I;  4NB9 A;  4DR1 C;  3EER A;  1XNR C;  3Q87 A;  3AF6 A;  1Y1W I;  1WW9 A;  2PN2 A;  3M3Y I;  4JI8 C;  4DR6 C;  4JYA C;  3AF5 A;  2UU9 C;  1N34 C;  4JI5 C;  1Y1V S;  3JAM D;  1QYP A;  2HF1 A;  1X3Z A;  1IBM C;  1Y1V I;  3D6W A;  3HOY I;  5C4X I;  4X64 C;  4JI4 C;  2JR6 A;  1L1O C;  2JA7 I;  4MTN A;  4NBB A;  4QTU A;  3GTL I;  4DUZ C;  4LF4 C;  1TWC I;  4MH4 A;  4A3C I;  2CY1 A;  4DR3 C;  5C44 I;  2HJG A;  2EGT A;  4NBC A;  1VLA A;  3GCF A;  3S1M I;  2PK7 A;  4NXN C;  2E8F A;  2HHH C;  4A3F I;  4BY7 I;  4DR5 C;  3T1Y C;  4LFC C;  3U50 C;  1HNW C;  3S14 I;  4DCT A;  4LF9 C;  3K7A I;  4LF8 C;  4JI0 C;  2ASB A;  3VB9 A;  1N2F A;  2P3Y A;  3S2H I;  4NXM C;  3GTQ I;  4A3K I;  1YUA A;  4DV3 C;  3R9W A;  4JV5 C;  1FJG C;  4A3I I;  2CXC A;  2DE5 A;  2E2H I;  2K5R A;  2VQE C;  2R93 I;  3CJE A;  1HR0 C;  3S15 I;  2UXD C;  1PA4 A;  1I6H I;  4X66 C;  4DV0 C;  1LQL A;  3I4N I;  1QWI A;  2QL8 A;  1RLY A;  2UUA C;  2DE6 A;  1NUI A;  4YHH C;  4LF6 C;  4A3E I;  3S1Q I;  2JA8 I;  3GKU A;  3RZD I;  4NBE A;  3PO2 I;  1X3W A;  5CM2 M;  1WCM I;  2E7G A;  2BJO A;  1WH9 A;  2OPL B;  1I94 C;  3GKQ A;  5A2Q D;  2UUC C;  3J80 D;  1USP A;  1N36 C;  2NVY I;  4DR2 C;  2ONF A;  1PFT A;  2JA6 I;  4NBG A;  2UXC C;  3HOU I;  2PT7 G;  4LFA C;  1XNQ C;  5BR8 C;  2KZF A;  4K0K C; 
#chains in the Genus database with same CATH topology
 4Y52 I;  2E2J I;  1TH5 A;  1IBL C;  4BXX I;  1MKY A;  1VQ8 1;  1XRA A;  2CU6 A;  2P28 A;  4RVO A;  3UOW A;  1KKG A;  2P02 A;  3NPD A;  2D7V A;  4IR7 A;  5T8T A;  1Q81 1;  3ETC A;  3GTP I;  3CCS 1;  3CCV Z;  4JM1 A;  2PRO A;  5A19 A;  2JIP A;  3CCL Z;  2QEX 1;  4BBR I;  4RVH A;  1IBK C;  3H3V J;  4ZLP A;  2JNY A;  3OW2 Y;  2OTJ Z;  3R9X A;  3CQZ I;  2R92 I;  5IT9 b;  1XRC A;  5IP7 I;  1S7M A;  3CCR Z;  1K83 I;  4DV2 C;  1RG9 A;  4KTV A;  4JI3 C;  3GTK I;  4A3B I;  1RO4 A;  1VEH A;  2KDN A;  5JRH A;  3VMG A;  4DK1 A;  1M90 2;  3CPW Y;  2D1T A;  1SIW A;  3ESW A;  4HGY A;  2NVT I;  4RM2 A;  4LFB C;  2YX1 A;  3AY0 A;  2V8J A;  3S1N I;  3RZO I;  3OW2 Z;  2WP0 C;  1KC8 1;  3NFZ A;  3CCL 1;  1I50 I;  4L2Z A;  4LF5 C;  3EQ6 A;  2RBL A;  5IP9 I;  2JMP A;  3E7X A;  1LCI A;  1FDI A;  1R9T I;  2ZZN A;  3G4S Z;  2ZZM A;  1VQM 1;  1Q16 A;  4D4I A;  5LMU C;  5IT9 D;  3HOV I;  2VUG A;  4KTT A;  1XMO C;  1QM4 A;  3FCC A;  4R0M A;  1PG3 A;  2NVX I;  3CCM 1;  2GTI A;  4E33 A;  1FUG A;  1J5E C;  2JS4 A;  3VMI A;  1N8R 2;  3NYQ A;  3MZL B;  1K0R A;  1MXA A;  3S82 A;  1TWG I;  3JAM f;  1YUK A;  4RVG A;  4DR1 C;  2Z51 A;  3Q87 A;  4RVD A;  2IZ4 A;  5GTD A;  4DR6 C;  3AF5 A;  4OYC A;  1MXC A;  3NI2 A;  4RMN A;  4DQY B;  3BG1 B;  4JI4 C;  2JR6 A;  2JA7 I;  1QVF Z;  5AE2 A;  4E30 A;  1VQN Z;  1VQP 1;  1JJ2 Y;  4MH4 A;  5T64 A;  4A3C I;  2NCL A;  4FUQ A;  4GS5 A;  1YI2 1;  3A26 A;  1M1K 2;  3NH4 A;  4WS9 A;  4NXN C;  2E8F A;  4A3F I;  3T1Y C;  4IZ6 A;  3U50 C;  4DCT A;  4E2X A;  4NXM C;  2P3Y A;  3CCE Z;  1P4E C;  4A3K I;  4DV3 C;  1VQL Z;  3CCV 1;  1P9N A;  3CQ2 A;  2MM9 A;  2R93 I;  2O53 A;  4X66 C;  1LQL A;  1NJI 1;  1RLY A;  3CC2 1;  3IF8 A;  4BC9 A;  4A3E I;  4PZP A;  5D1P A;  3PO2 I;  1P7L A;  1YJN 1;  2E7G A;  1NY8 A;  2BJO A;  3H2T A;  2UUC C;  5A2Q D;  3J80 D;  2D1Q A;  3CC7 1;  2ONF A;  1PFT A;  2JA6 I;  4NBG A;  5BSM A;  2M5O A;  4LFA C;  1XNQ C;  2I3C A;  3CXC Z;  3KIF A;  3FQM A;  3A9V A;  4B3M C;  2E2I I;  1I3Q I;  1VQ9 1;  4ODJ A;  4DCS A;  1XRB A;  3FKI I;  5BUS A;  3GTM I;  3IEU A;  3CCR 1;  3CW8 X;  4YY3 C;  2NVQ I;  4JI7 C;  3HOX I;  1VQ7 Z;  3CCE 1;  3LUS A;  2UUB C;  4BC7 A;  1SFO I;  1Q7Y 1;  1X0T A;  2W03 A;  3CMA Z;  2P2Q A;  4B3S C;  2YWC A;  3G71 1;  3IML A;  4BSZ A;  4BY1 I;  3J7A 4;  3KIH A;  1YI2 Z;  4PHT A;  5K85 A;  4K0B A;  1S72 1;  4EAT A;  1Z03 A;  1N32 C;  3GR1 A;  1XS3 A;  2AYA A;  2M6N A;  2UXB C;  4BBS I;  2Q4Z A;  3F3F C;  5LMN C;  3GTM S;  5C4J I;  4GKJ C;  4NB8 A;  1VQK Z;  4OX9 C;  1YJ9 1;  2P20 A;  1ML8 A;  2AKL A;  2RIQ A;  2V8I A;  2QW0 X;  2VSQ A;  1VQ7 1;  1PG4 A;  3CCU Z;  2QRC B;  3CC4 1;  2DYJ A;  3UX2 A;  4DV5 C;  2R7Z I;  4GXR A;  1MD9 A;  5BSW A;  4DCU A;  4AQY C;  4A93 I;  5LL6 f;  3S1R I;  2DE7 A;  4FUT A;  5IWA C;  4FTF A;  4HGZ A;  2ZM6 C;  4E2W A;  3J81 D;  3I07 A;  3GTO I;  1L2F A;  4X6A I;  4I9F A;  4MRI A;  2QA4 1;  3CQ3 A;  4E31 A;  1O9T A;  1K9M 2;  1HNX C;  5E7Q A;  4MXU A;  4DV6 C;  1MDF A;  3VNR A;  5KYV A;  1N33 C;  3G4S 1;  2YWB A;  1TWF I;  3BG0 B;  3CME 1;  3PRO C;  1VQO 1;  3EER A;  2JIO A;  3IX0 A;  3B7W A;  4JYA C;  1N34 C;  2RT9 A;  1Y1V S;  1QYP A;  1IBM C;  4RLQ A;  2OZK A;  1Y1V I;  4X64 C;  4MTN A;  2OBV A;  2WAQ A;  4L4Q A;  1V26 A;  1M1K 1;  1TWC I;  4TPS B;  3UZ0 A;  5C44 I;  2EGT A;  1W2B Z;  2PK7 A;  3CCU 1;  3VB9 A;  1AA6 A;  1FJG C;  4MD9 A;  1QVG Z;  1VQN 1;  3TR3 A;  4DGL A;  1VQ5 Z;  2K5R A;  3TE5 B;  1Z01 A;  1N8R 1;  1PA4 A;  3RV2 A;  1Q7Y 2;  4DV0 C;  1VQ6 Z;  3I4N I;  1QWI A;  2UUA C;  3UEB A;  4YHH C;  1NUI A;  4NBE A;  5CM2 M;  4PUG A;  2O4H A;  1WH9 A;  1I94 C;  2OOX B;  2QKD A;  1O90 A;  1YJ7 A;  4PUH A;  5BSU A;  1MXB A;  1P4E A;  2HU9 A;  2UXC C;  4RS4 A;  2VPX A;  1QVG Y;  2RPR A;  3CCS Z;  4AYB A;  4CL1 A;  3LNO A;  1VQK 1;  4OXI A;  5BR8 C;  4K0K C;  4NOZ A;  1JWH C;  1RO2 A;  2JIM A;  3I55 1;  4A3D I;  1PU1 A;  2E0G A;  5FLX b;  1KC8 2;  3A25 A;  2LEX A;  3VNQ A;  1WII A;  2JIR A;  1YHQ Z;  4DG8 A;  5C3E I;  2PMZ A;  5AN9 F;  1KD1 1;  4GXQ A;  4DV7 C;  5A2Q b;  3J81 b;  2IV2 X;  4RVF A;  1KRL A;  3QWU A;  4DCV A;  3CCQ 1;  1RQF A;  5CZX A;  2YU9 I;  5FLM I;  2E8E A;  4NBD A;  1WF3 A;  1Q86 1;  3J80 b;  1YIJ Z;  3NDJ A;  4NBA A;  2M5H A;  4RLF A;  4DUY C;  3MZK B;  1YJ9 Z;  1VQ6 1;  5IFI A;  1QVF Y;  3I4M I;  1UKK A;  4G37 A;  1KQS Y;  1QF8 A;  4G1I A;  3S2D I;  3E7W A;  4JI1 C;  2F4O A;  4MD7 A;  2WD9 A;  2XR1 A;  3IPL A;  5BST A;  5BUR A;  4XX2 A;  2KI7 B;  4Y7N I;  2OPL A;  3CCQ Z;  5T67 A;  4JI2 C;  3A4I A;  2W04 A;  3CCM Z;  1Z02 A;  3HOZ I;  2VPZ A;  4A3G I;  1IB8 A;  4QTT A;  4LF7 C;  3T1H C;  1Q86 2;  1Q82 2;  2VUM I;  2V7B A;  4U5Y D;  2QVZ X;  3G7S A;  5CZV A;  5AE3 A;  3SO4 A;  3PO3 S;  1VQ8 Z;  2OOY B;  5D1O B;  1Q82 1;  3VMH A;  3MON A;  3GTG I;  3FCE A;  4MON A;  3NYR A;  2J6A A;  1JOS A;  1KD1 2;  4X62 C;  1HNZ C;  2OO4 A;  2E5L C;  3GTJ I;  3CD6 Z;  2AYD A;  3NH8 A;  4JI6 C;  1NYE A;  1YIT 1;  2Q51 A;  4NB9 A;  1XNR C;  3D2L A;  3CD6 1;  1M6X C;  2PN2 A;  1WW9 A;  2BH1 X;  4JI8 C;  3LNV A;  1K73 1;  5T8S A;  1RO0 A;  2V3V A;  2YAD A;  3JAM D;  2LFU A;  2UU9 C;  4JI5 C;  1X3Z A;  5KEI A;  3I56 1;  2GTH A;  3D6W A;  1VQ5 1;  1YJW Z;  1Y8C A;  4NBB A;  3CC2 Z;  1BA3 A;  1T5H X;  4DUZ C;  1S72 Z;  1MDB A;  2GU2 A;  1WJ2 A;  4DR3 C;  2HJG A;  2Y4O A;  3GR0 A;  4NBC A;  3PES A;  1VLA A;  3GCF A;  4DG9 A;  5KYT A;  3FQQ A;  4LFC C;  4BY7 I;  4DR5 C;  3HKZ A;  1M90 1;  4JI0 C;  2VZE A;  3NDI A;  3S2H I;  4E32 A;  3GTQ I;  2Y4N A;  1YUA A;  4JV5 C;  4A3I I;  2P2J A;  2CXC A;  3G6E Z;  2E2H I;  2UXD C;  1HR0 C;  2MMA B;  1I6H I;  3UX3 A;  1WZN A;  3TDH B;  5A2Q f;  3S1Q I;  3VNS A;  1V25 A;  2D27 A;  1X3W A;  3D9X A;  1WCM I;  2OPL B;  1YIT Z;  1Q81 2;  1N36 C;  4BBY A;  2NVY I;  2V8K A;  4PUI A;  1FDO A;  3J80 f;  2PT7 G;  4EWC A;  3L8C A;  3CPW Z;  2QRE B;  2KZF A;  3EED A;  2OTL 1;  3PBK A;  3PO3 I;  4NBH A;  5D1O A;  5AE1 A;  1NP6 A;  3G6E 1;  2JMO A;  2YCB A;  5BSV A;  2JA5 I;  3TDE A;  3LAX A;  4D56 A;  1TWH I;  4RVN A;  1XMQ C;  3IEV A;  2K3R A;  3M4O I;  4RM3 A;  1AMU A;  4DV4 C;  2VPW A;  4B3R C;  2QLV B;  3HOW I;  1K8A 1;  1YIJ 1;  5H9U A;  3S17 I;  4RV9 A;  4NDN A;  4TNU A;  1QXF A;  3CC7 Z;  1DL6 A;  1XHJ A;  2JUB A;  3H0G I;  2E9H A;  3N54 B;  2QEX Z;  2Y27 A;  1TFI A;  4X65 C;  4R1L A;  1YJW 1;  3LGX A;  4LE5 A;  2H85 A;  2KPI A;  1O92 A;  2B63 I;  2P2B A;  4DR4 C;  2DHM A;  4PRO C;  4DV1 C;  2VQF C;  1VQP Z;  2D1S A;  4GKK C;  5T6B A;  3VTN A;  4NBF A;  3ETO A;  4BCA A;  3S16 I;  4A3J I;  4A3L I;  4A3M I;  5DV9 A;  5A1I A;  3CXC Y;  3TUF A;  3C5E A;  2OTJ 1;  3L95 X;  4R1M A;  2JIQ A;  3G71 Z;  1K9M 1;  2F4V C;  1VQ4 1;  1USP B;  1TWA I;  1VQO Z;  3A9U A;  3GPC A;  4D57 A;  5FLX D;  5IT9 f;  2V45 A;  2PM9 A;  3CME Z;  3CCJ 1;  1EGA A;  1VQ9 Z;  2DPL A;  5A1G A;  4KHP C;  2D1R A;  4E2Y A;  1ZB9 A;  5FLX f;  4MD8 A;  2D28 C;  1VQM Z;  1HH2 P;  3CCJ Z;  4HPV A;  3K6R A;  2P2F A;  5BUQ A;  3O2E A;  3I56 Z;  2MCQ A;  1ZB8 A;  4B3T C;  4D4G A;  3N2Q A;  3CC4 Z;  3CW9 A;  3OTO C;  2NAP A;  3J81 f;  3F3P C;  1JJ2 Z;  4DR7 C;  1RNI A;  2QVY X;  2F4M A;  3KXW A;  2ATW A;  3P5J B;  1WCJ A;  4NH1 C;  2E8C A;  1KQS Z;  2QR1 B;  3I08 A;  1ZH1 A;  2IZ3 A;  2QVX X;  1VQ4 Z;  3DAY A;  2G2K A;  3AF6 A;  1Y1W I;  3M3Y I;  2E7Z A;  2KZ0 A;  2HF1 A;  2RHB A;  3HOY I;  5C4X I;  4E2Z A;  1L1O C;  3NH5 A;  4QTU A;  3GTL I;  3CQ1 A;  1VQL 1;  3DHV A;  4LF4 C;  2M48 A;  2WB1 A;  2CY1 A;  1W2B Y;  1ULT A;  1NJI 2;  4G36 A;  5ADZ A;  3S1M I;  2HHH C;  3RG2 A;  1HNW C;  5K8F A;  3S14 I;  3CMA 1;  3K7A I;  4WV3 A;  4LF8 C;  4LF9 C;  2ASB A;  4L7I A;  1N2F A;  3JAM b;  4NFR A;  1K73 2;  3T4N B;  5LCI A;  3R9W A;  2DE5 A;  3IR7 A;  2QA4 Z;  2VQE C;  3CJE A;  3S15 I;  1M6X A;  5BSR A;  1RY2 A;  2QRD B;  4ZJZ A;  4LF6 C;  2QL8 A;  1YHQ 1;  2DE6 A;  4I9G A;  1T5D X;  1UWD A;  2JA8 I;  2P2M A;  3I55 Z;  3RZD I;  3GKU A;  3IFU A;  2R6M A;  2OTL Z;  1K8A 2;  1O93 A;  2JNV A;  2LIY A;  3GKQ A;  3TQI A;  1FLO A;  1USP A;  1YJN Z;  2Y0S A;  4S1T A;  1GPM A;  4HH4 A;  4DR2 C;  2VF1 A;  2ZAE B;  3DLP X;  3HOU I;  3R44 A;  2VPY A;  4ISB A;  1V60 A; 
#chains in the Genus database with same CATH homology
 4Y52 I;  2E2J I;  1IBL C;  4BXX I;  1MKY A;  1VQ8 1;  1XRA A;  3UOW A;  2P28 A;  4RVO A;  1KKG A;  2P02 A;  3NPD A;  2D7V A;  4IR7 A;  5T8T A;  1Q81 1;  3ETC A;  3GTP I;  3CCS 1;  3CCV Z;  4JM1 A;  2PRO A;  5A19 A;  3CCL Z;  2QEX 1;  4BBR I;  4RVH A;  1IBK C;  3H3V J;  4ZLP A;  2JNY A;  3OW2 Y;  2OTJ Z;  3R9X A;  3CQZ I;  2R92 I;  5IT9 b;  1XRC A;  5IP7 I;  1S7M A;  3CCR Z;  1K83 I;  4DV2 C;  1RG9 A;  4KTV A;  4JI3 C;  3GTK I;  4A3B I;  1RO4 A;  5JRH A;  3VMG A;  4DK1 A;  1M90 2;  3CPW Y;  2D1T A;  3ESW A;  4HGY A;  2NVT I;  4RM2 A;  4LFB C;  2V8J A;  3S1N I;  3RZO I;  3OW2 Z;  2WP0 C;  1KC8 1;  3NFZ A;  3CCL 1;  1I50 I;  4L2Z A;  4LF5 C;  3EQ6 A;  2RBL A;  5IP9 I;  2JMP A;  3E7X A;  1LCI A;  1R9T I;  3G4S Z;  1VQM 1;  4D4I A;  5LMU C;  5IT9 D;  3HOV I;  2VUG A;  4KTT A;  1XMO C;  1QM4 A;  3FCC A;  4R0M A;  1PG3 A;  2NVX I;  3CCM 1;  2GTI A;  4E33 A;  1FUG A;  1J5E C;  2JS4 A;  3VMI A;  1N8R 2;  3NYQ A;  3MZL B;  1K0R A;  1MXA A;  3S82 A;  1TWG I;  3JAM f;  1YUK A;  4RVG A;  4DR1 C;  3Q87 A;  4RVD A;  2IZ4 A;  5GTD A;  4DR6 C;  3AF5 A;  4OYC A;  1MXC A;  3NI2 A;  4RMN A;  4DQY B;  3BG1 B;  4JI4 C;  2JR6 A;  2JA7 I;  1QVF Z;  5AE2 A;  4E30 A;  1VQN Z;  1VQP 1;  1JJ2 Y;  4MH4 A;  5T64 A;  4A3C I;  4FUQ A;  4GS5 A;  1YI2 1;  1M1K 2;  3NH4 A;  4WS9 A;  4NXN C;  2E8F A;  4A3F I;  3T1Y C;  4IZ6 A;  3U50 C;  4DCT A;  4E2X A;  4NXM C;  2P3Y A;  3CCE Z;  4A3K I;  4DV3 C;  1VQL Z;  3CCV 1;  1P9N A;  2R93 I;  2O53 A;  4X66 C;  1LQL A;  1NJI 1;  1RLY A;  3CC2 1;  3IF8 A;  4BC9 A;  4A3E I;  4PZP A;  5D1P A;  3PO2 I;  1P7L A;  1YJN 1;  2E7G A;  2BJO A;  3H2T A;  2UUC C;  5A2Q D;  3J80 D;  2D1Q A;  3CC7 1;  2ONF A;  1PFT A;  2JA6 I;  4NBG A;  5BSM A;  4LFA C;  1XNQ C;  2I3C A;  3CXC Z;  3KIF A;  3FQM A;  3A9V A;  4B3M C;  2E2I I;  1I3Q I;  1VQ9 1;  4ODJ A;  4DCS A;  1XRB A;  3FKI I;  5BUS A;  3GTM I;  3IEU A;  3CCR 1;  3CW8 X;  4YY3 C;  2NVQ I;  4JI7 C;  3HOX I;  1VQ7 Z;  3CCE 1;  3LUS A;  2UUB C;  4BC7 A;  1SFO I;  1Q7Y 1;  1X0T A;  2W03 A;  3CMA Z;  2P2Q A;  4B3S C;  2YWC A;  3G71 1;  3IML A;  4BSZ A;  4BY1 I;  3J7A 4;  3KIH A;  1YI2 Z;  4PHT A;  5K85 A;  4K0B A;  1S72 1;  4EAT A;  1Z03 A;  1N32 C;  3GR1 A;  2AYA A;  2M6N A;  2UXB C;  4BBS I;  2Q4Z A;  3F3F C;  5LMN C;  3GTM S;  5C4J I;  4GKJ C;  4NB8 A;  1VQK Z;  4OX9 C;  1YJ9 1;  2P20 A;  1ML8 A;  2AKL A;  2RIQ A;  2V8I A;  2QW0 X;  2VSQ A;  1VQ7 1;  1PG4 A;  3CCU Z;  2QRC B;  3CC4 1;  2DYJ A;  4DV5 C;  2R7Z I;  4GXR A;  1MD9 A;  5BSW A;  4DCU A;  4AQY C;  4A93 I;  5LL6 f;  3S1R I;  2DE7 A;  4FUT A;  5IWA C;  4FTF A;  4HGZ A;  2ZM6 C;  4E2W A;  3J81 D;  3I07 A;  3GTO I;  1L2F A;  4X6A I;  4I9F A;  4MRI A;  2QA4 1;  4E31 A;  1O9T A;  1K9M 2;  1HNX C;  5E7Q A;  4MXU A;  4DV6 C;  1MDF A;  3VNR A;  5KYV A;  1N33 C;  3G4S 1;  2YWB A;  1TWF I;  3BG0 B;  3CME 1;  3PRO C;  1VQO 1;  3EER A;  3IX0 A;  3B7W A;  4JYA C;  1N34 C;  2RT9 A;  1Y1V S;  1QYP A;  1IBM C;  4RLQ A;  2OZK A;  1Y1V I;  4X64 C;  4MTN A;  2OBV A;  2WAQ A;  4L4Q A;  1V26 A;  1M1K 1;  1TWC I;  4TPS B;  3UZ0 A;  5C44 I;  2EGT A;  1W2B Z;  2PK7 A;  3CCU 1;  3VB9 A;  1FJG C;  4MD9 A;  1QVG Z;  1VQN 1;  4DGL A;  1VQ5 Z;  2K5R A;  3TE5 B;  1Z01 A;  1N8R 1;  1PA4 A;  3RV2 A;  1Q7Y 2;  4DV0 C;  1VQ6 Z;  3I4N I;  1QWI A;  2UUA C;  4YHH C;  1NUI A;  4NBE A;  5CM2 M;  2O4H A;  1WH9 A;  1I94 C;  2OOX B;  2QKD A;  1O90 A;  1YJ7 A;  5BSU A;  1MXB A;  2HU9 A;  2UXC C;  4RS4 A;  1QVG Y;  2RPR A;  3CCS Z;  4AYB A;  4CL1 A;  1VQK 1;  4OXI A;  5BR8 C;  4K0K C;  4NOZ A;  1JWH C;  1RO2 A;  3I55 1;  4A3D I;  2E0G A;  5FLX b;  1KC8 2;  3VNQ A;  1WII A;  1YHQ Z;  4DG8 A;  5C3E I;  2PMZ A;  5AN9 F;  1KD1 1;  4GXQ A;  4DV7 C;  5A2Q b;  3J81 b;  4RVF A;  1KRL A;  3QWU A;  4DCV A;  3CCQ 1;  1RQF A;  5CZX A;  2YU9 I;  5FLM I;  2E8E A;  4NBD A;  1WF3 A;  1Q86 1;  3J80 b;  1YIJ Z;  3NDJ A;  4NBA A;  4RLF A;  4DUY C;  3MZK B;  1YJ9 Z;  1VQ6 1;  5IFI A;  1QVF Y;  3I4M I;  1UKK A;  4G37 A;  1KQS Y;  1QF8 A;  4G1I A;  3S2D I;  3E7W A;  4JI1 C;  2F4O A;  4MD7 A;  2WD9 A;  2XR1 A;  3IPL A;  5BST A;  5BUR A;  4XX2 A;  2KI7 B;  4Y7N I;  2OPL A;  3CCQ Z;  5T67 A;  4JI2 C;  3A4I A;  2W04 A;  3CCM Z;  1Z02 A;  3HOZ I;  4A3G I;  4LF7 C;  4QTT A;  3T1H C;  1Q86 2;  1Q82 2;  2VUM I;  2V7B A;  4U5Y D;  2QVZ X;  3G7S A;  5CZV A;  5AE3 A;  3SO4 A;  3PO3 S;  1VQ8 Z;  2OOY B;  5D1O B;  1Q82 1;  3VMH A;  3MON A;  3GTG I;  3FCE A;  4MON A;  3NYR A;  2J6A A;  1JOS A;  1KD1 2;  4X62 C;  1HNZ C;  2OO4 A;  2E5L C;  3GTJ I;  3CD6 Z;  3NH8 A;  4JI6 C;  1NYE A;  1YIT 1;  2Q51 A;  4NB9 A;  1XNR C;  3CD6 1;  2PN2 A;  1WW9 A;  2BH1 X;  4JI8 C;  3LNV A;  1K73 1;  5T8S A;  1RO0 A;  2YAD A;  2UU9 C;  3JAM D;  2LFU A;  4JI5 C;  1X3Z A;  5KEI A;  3I56 1;  2GTH A;  3D6W A;  1VQ5 1;  1YJW Z;  4NBB A;  3CC2 Z;  1BA3 A;  1T5H X;  4DUZ C;  1S72 Z;  1MDB A;  2GU2 A;  4DR3 C;  2HJG A;  2Y4O A;  3GR0 A;  4NBC A;  3PES A;  1VLA A;  3GCF A;  4DG9 A;  5KYT A;  3FQQ A;  4LFC C;  4BY7 I;  4DR5 C;  3HKZ A;  1M90 1;  4JI0 C;  2VZE A;  3NDI A;  3S2H I;  4E32 A;  3GTQ I;  2Y4N A;  1YUA A;  4JV5 C;  4A3I I;  2P2J A;  2CXC A;  3G6E Z;  2E2H I;  2UXD C;  1HR0 C;  1I6H I;  3TDH B;  5A2Q f;  3S1Q I;  3VNS A;  1V25 A;  2D27 A;  1X3W A;  3D9X A;  1WCM I;  2OPL B;  1YIT Z;  1Q81 2;  1N36 C;  4BBY A;  2NVY I;  2V8K A;  3J80 f;  2PT7 G;  4EWC A;  3L8C A;  3CPW Z;  2QRE B;  2KZF A;  3EED A;  2OTL 1;  3PBK A;  3PO3 I;  4NBH A;  5D1O A;  5AE1 A;  1NP6 A;  3G6E 1;  2JMO A;  2YCB A;  5BSV A;  2JA5 I;  3TDE A;  3LAX A;  4D56 A;  1TWH I;  4RVN A;  1XMQ C;  3IEV A;  2K3R A;  3M4O I;  4RM3 A;  1AMU A;  4DV4 C;  4B3R C;  2QLV B;  3HOW I;  1K8A 1;  1YIJ 1;  5H9U A;  3S17 I;  4RV9 A;  4NDN A;  4TNU A;  3CC7 Z;  1DL6 A;  2JUB A;  3H0G I;  2E9H A;  3N54 B;  2QEX Z;  2Y27 A;  1TFI A;  4X65 C;  4R1L A;  1YJW 1;  3LGX A;  4LE5 A;  2H85 A;  2KPI A;  1O92 A;  2B63 I;  2P2B A;  4DR4 C;  4PRO C;  4DV1 C;  2VQF C;  1VQP Z;  2D1S A;  4GKK C;  5T6B A;  3VTN A;  4NBF A;  3ETO A;  4BCA A;  3S16 I;  4A3J I;  4A3L I;  4A3M I;  5DV9 A;  5A1I A;  3CXC Y;  3TUF A;  3C5E A;  2OTJ 1;  3L95 X;  4R1M A;  3G71 Z;  1K9M 1;  2F4V C;  1VQ4 1;  1USP B;  1TWA I;  1VQO Z;  3A9U A;  3GPC A;  4D57 A;  5FLX D;  5IT9 f;  3CCJ 1;  2PM9 A;  3CME Z;  1EGA A;  2DPL A;  1VQ9 Z;  5A1G A;  4KHP C;  2D1R A;  4E2Y A;  1ZB9 A;  5FLX f;  4MD8 A;  2D28 C;  1VQM Z;  1HH2 P;  3CCJ Z;  4HPV A;  2P2F A;  5BUQ A;  3I56 Z;  1ZB8 A;  4B3T C;  4D4G A;  3N2Q A;  3CC4 Z;  3CW9 A;  3OTO C;  3J81 f;  3F3P C;  1JJ2 Z;  4DR7 C;  1RNI A;  2QVY X;  2F4M A;  3KXW A;  2ATW A;  3P5J B;  4NH1 C;  2E8C A;  1KQS Z;  2QR1 B;  3I08 A;  1ZH1 A;  2IZ3 A;  2QVX X;  1VQ4 Z;  3DAY A;  2G2K A;  3AF6 A;  1Y1W I;  3M3Y I;  2HF1 A;  2RHB A;  3HOY I;  5C4X I;  4E2Z A;  1L1O C;  3NH5 A;  4QTU A;  3GTL I;  3DHV A;  1VQL 1;  4LF4 C;  2M48 A;  2WB1 A;  2CY1 A;  1W2B Y;  1ULT A;  1NJI 2;  4G36 A;  5ADZ A;  3S1M I;  2HHH C;  3RG2 A;  1HNW C;  5K8F A;  3S14 I;  3CMA 1;  3K7A I;  4WV3 A;  4LF8 C;  4LF9 C;  2ASB A;  4L7I A;  1N2F A;  3JAM b;  4NFR A;  1K73 2;  3T4N B;  3R9W A;  2DE5 A;  2QA4 Z;  2VQE C;  3CJE A;  3S15 I;  5BSR A;  1RY2 A;  2QRD B;  4ZJZ A;  4LF6 C;  2QL8 A;  1YHQ 1;  2DE6 A;  4I9G A;  1T5D X;  2JA8 I;  2P2M A;  3I55 Z;  3RZD I;  3GKU A;  3IFU A;  2R6M A;  2OTL Z;  1K8A 2;  1O93 A;  3TQI A;  2LIY A;  3GKQ A;  1USP A;  1YJN Z;  2Y0S A;  4S1T A;  1GPM A;  4HH4 A;  4DR2 C;  2VF1 A;  2ZAE B;  3HOU I;  3R44 A;  4ISB A;  3DLP X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...