1ZB8A

Crystal structure of xylella fastidiosa organic peroxide resistance protein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
140
Chain Sequence
SLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGTNPEQLFAAGYSAFIGALKFVANKEKVDLPAEPRVEGRVGIGEIPGGFGLVVELRIAVSGMERSMLQTLVDKAHRVCPYSNATRGNIDVVLILID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords organic hydroperoxide resistance protein
publication title Structural Insights into Enzyme-Substrate Interaction and Characterization of Enzymatic Intermediates of Organic Hydroperoxide Resistance Protein from Xylella fastidiosa.
pubmed doi rcsb
source organism Xylella fastidiosa
molecule tags Oxidoreductase
total genus 34
structure length 140
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02566 OsmC OsmC-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 1zb8A01
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 1zb8A02
1USPA 3RZDI 5A2QD 1IBMC 4DV0C 3GKQA 2JMPA 4DR7C 2F4OA 2F4MA 4DUYC 1UKKA 4X66C 2PK7A 2XR1A 2PN2A 3IEUA 4DV7C 4NB8A 2K5RA 2HF1A 3T1YC 3S1RI 3D6WA 4NBDA 1N36C 4DR1C 3GTPI 3GKUA 4JV5C 3T1HC 2J6AA 2JS4A 2EGTA 4B3TC 3K7AI 3R9XA 2JNYA 4DR3C 5IP9I 1N34C 1YUAA 1ZB8A 1N33C 4GKKC 5C3EI 2HJGA 1TWFI 5LMUC 2DE7A 4NBGA 1DL6A 4DR2C 3S2HI 2E7GA 1XMOC 4DCUA 4DR6C 4MH4A 2JA5I 4DV1C 2JA7I 2UXDC 3VB9A 4X6AI 2NVQI 2VUMI 4BY7I 1TWCI 3VMIA 5FLMI 1JOSA 2ASBA 3PO3I 1WH9A 3J81D 2QL8A 1HNZC 3GTKI 4JI0C 1J5EC 1HNWC 2VQFC 2RBLA 1HNXC 1XNRC 3S1NI 3LUSA 1Y1VI 4QTUA 4X62C 4NB9A 4NBBA 4A3LI 2CY1A 2E8EA 1TWAI 5C44I 1SFOI 2E2II 2R92I 4KHPC 1ML8A 1IBLC 3GTGI 4DV4C 3EERA 4DCSA 3H0GI 3HOYI 4BSZA 3I4NI 1VLAA 4LF6C 1MKYA 1HR0C 2UUCC 4GKJC 4X64C 3GTQI 2KZFA 5C4JI 2DE5A 1RLYA 2R93I 1X3ZA 4A3GI 2CXCA 3S1QI 2YCBA 3R9WA 4LFCC 5BR8C 2ATWA 2DYJA 4A3II 4LF5C 2OPLB 3PO3S 1NUIA 5IP7I 2E5LC 4AQYC 5IT9D 3HOVI 4JI1C 1QYPA 1LQLA 1XNQC 4JI8C 1Y1VS 4JI7C 3VMGA 2ONFA 2DE6A 3S2DI 3Q87A 1L2FA 1WW9A 4JI5C 3OTOC 4DUZC 4A3MI 2OPLA 4DR5C 2UXCC 4DV3C 1WCMI 2JA6I 4DV5C 4YY3C 5IWAC 1RO4A 4XX2A 1TFIA 2R7ZI 2KPIA 1PFTA 4MTNA 2NVTI 4DV2C 3HOZI 4LF4C 3S17I 4NBEA 4A3KI 4BBRI 4DR4C 1N32C 1HH2P 3FKII 1IBKC 4JI2C 2UUAC 4DV6C 2P3YA 2BJOA 1K0RA 4A3CI 4NXMC 2E8FA 3AF5A 3CJEA 1R9TI 3S14I 4NBFA 2D7VA 4LF8C 4NBAA 4B3SC 2AKLA 3GTLI 2JA8I 2ZM6C 1NYEA 2B63I 3J80D 1I50I 3HOXI 5C4XI 3CQZI 1I94C 4JYAC 4QTTA 4X65C 2UXBC 4K0KC 1X3WA 1I3QI 1TWGI 1QWIA 4OX9C 3U50C 1K83I 2NVXI 3GTMI 1KKGA 1XMQC 3S1MI 5CM2M 4B3RC 4LF9C 2E2HI 2E2JI 3M4OI 2YU9I 4JI6C 3ESWA 2PT7G 4BXXI 3I4MI 5FLXD 1TWHI 3H3VJ 3RZOI 4NXNC 4A3BI 3M3YI 4A93I 3S16I 4LFAC 4NBHA 4LFBC 3I07A 4LF7C 1Y1WI 3AF6A 3S15I 4A3EI 1EGAA 4NOZA 3HOUI 2HHHC 5LMNC 3IEVA 3GTJI 4B3MC 1WF3A 1L1OC 3GCFA 4A3FI 1USPB 4YHHC 1I6HI 4NBCA 4Y52I 3VMHA 2NVYI 4Y7NI 4A3JI 1PA4A 4DCTA 3PO2I 3HOWI 4DCVA 2JR6A 4BY1I 1N2FA 2UU9C 4JI3C 2F4VC 4JI4C 4BBSI 2VQEC 3GTOI 4A3DI 3GTMS 3JAMD 1ZB9A 2UUBC 2E8CA 1FJGC
chains in the Genus database with same CATH superfamily
1USPA 3JAMf 1O93A 3RZDI 5A2QD 1KRLA 1IBMC 4DV0C 2JNVA 1K732 5BUQA 4JM1A 3VNRA 3GKQA 3NH8A 5A1GA 4I9GA 2D1RA 3NFZA 5A2Qf 1Q811 2Y27A 3EQ6A 2QKDA 5A19A 2JMPA 2OTL1 3TQIA 1YJN1 3IX0A 3CQ1A 1YI21 4DR7C 2D28C 2F4OA 3CD61 2F4MA 1XHJA 4DUYC 5BSMA 1UKKA 3A4IA 4X66C 2PK7A 4GXQA 4RVFA 2JIOA 4GS5A 2XR1A 3IR7A 3UX2A 2PN2A 3IEUA 3LNOA 4RLFA 3I55Z 2JUBA 5H9UA 4DV7C 1VQ61 1M901 2G2KA 4NB8A 2K5RA 2HF1A 3T1YC 4ISBA 2QLVB 5K8FA 3G711 1AMUA 3S1RI 3D6WA 4MRIA 2OTJZ 4NBDA 4MXUA 3AY0A 1N36C 4DR1C 1VQOZ 3CCVZ 3GTPI 3GKUA 1MXAA 4JV5C 2WD9A 1PU1A 3MZKB 1N8R2 2LFUA 3CCE1 3T1HC 2J6AA 2JS4A 1O90A 4D57A 5ADZA 2EGTA 5CZXA 4B3TC 3D9XA 5KYVA 3K7AI 3R9XA 3OW2Y 3E7WA 1Q7Y1 2Y4OA 1TH5A 1P4EC 2JNYA 4NH1C 3J80b 3CCR1 3CMEZ 4DR3C 1LCIA 1YJW1 5IP9I 5DV9A 1N34C 1RO0A 1YUAA 1VQ7Z 1ZB8A 1VQ91 3VNQA 1N33C 4GKKC 2JIQA 2MMAB 5C3EI 1YHQ1 2VUGA 3CC41 1YIT1 4RM3A 3EEDA 2QA41 1S72Z 2HJGA 3CCM1 1TWFI 2H85A 5LMUC 2DE7A 3A26A 4NBGA 1YJNZ 5E7QA 4DG8A 1DL6A 4DR2C 1M1K2 3S2HI 2E7GA 1XMOC 1WJ2A 3E7XA 3N2QA 4DCUA 3TUFA 4DR6C 4MH4A 3G7SA 5BSTA 2JA5I 1VQL1 4DV1C 2YADA 2JA7I 4RS4A 3VB9A 3ETCA 4X6AI 2UXDC 2NVQI 2VUMI 4HGYA 4WS9A 4BY7I 1TWCI 3VMIA 5FLMI 3CC21 3IF8A 1JOSA 2ASBA 3PO3I 3GR1A 1WH9A 3TR3A 3J81D 3R44A 2QL8A 2YX1A 1YIJZ 4NDNA 1GPMA 2V8KA 3CCU1 1HNZC 3GTKI 3J81f 1W2BZ 4JI0C 1J5EC 1KC81 3G71Z 2QRCB 2OO4A 1HNWC 5FLXb 3P5JB 3NI2A 2VQFC 3CCS1 2RBLA 1M6XC 4PUHA 1HNXC 2D27A 5T64A 1Q821 3S1NI 1Q861 1XNRC 3LUSA 4MD7A 1VQ51 1Y1VI 1T5HX 3O2EA 4QTUA 1T5DX 4X62C 1V60A 1XRBA 3CQ3A 4NB9A 4R1MA 4NBBA 4L4QA 3KXWA 4A3LI 2CY1A 2E8EA 3MONA 1K8A2 1TWAI 1YJ7A 1KD12 2OZKA 5C44I 1SFOI 2ZZMA 2E2II 1RG9A 4RVGA 1P4EA 2R92I 4KHPC 1YJ91 1P9NA 4KTTA 1ML8A 1RQFA 1VQPZ 1IBLC 4S1TA 3LAXA 3A9VA 2W04A 3GTGI 4DV4C 3EERA 2QRDB 2VZEA 4DCSA 1S7MA 4R0MA 2R6MA 5CZVA 3G6EZ 3H0GI 3HOYI 1QVFY 3KIHA 3CCMZ 3I4NI 2GTIA 4ODJA 4BSZA 1K731 1VLAA 4LF6C 4I9FA 1MKYA 2E7ZA 5LCIA 1HR0C 1Q16A 2UUCC 1P7LA 3I561 4GKJC 3DAYA 3CCQZ 1VQ41 4X64C 1QVGY 2OBVA 4OYCA 3CPWY 3GTQI 4HPVA 1QM4A 2KZFA 4RM2A 5AN9F 4PUGA 5C4JI 2DE5A 2K3RA 1NY8A 2M6NA 1V25A 4HH4A 3G4SZ 1RLYA 4BBYA 1NJI2 2R93I 1X3ZA 1QVFZ 2W03A 3CMAZ 3I08A 4A3GI 3DHVA 3FCCA 3NDJA 3DLPX 3CC71 4FUTA 4E32A 3NYRA 2VSQA 3JAMb 2CXCA 3S1QI 5BURA 3CPWZ 2YCBA 3R9WA 3LGXA 1VQ5Z 4LFCC 5BR8C 2ATWA 5A2Qb 2DYJA 2M48A 4A3II 2QEXZ 1N8R1 2V3VA 5LL6f 4K0BA 4LF5C 2M5OA 4MD9A 2OPLB 3H2TA 3PO3S 2Z51A 5BSUA 2MCQA 1NUIA 5IP7I 4G1IA 4GXRA 2E5LC 4IR7A 3N54B 5KYTA 1O9TA 2P2FA 1K9M2 4E2ZA 3CCLZ 2KDNA 2GTHA 4AQYC 1VQ81 5BSRA 3HOVI 2I3CA 5IT9D 4JI1C 4D4IA 1QYPA 1Q7Y2 1LQLA 4RVHA 1JWHC 1ZH1A 1VQM1 4NFRA 5IT9f 5A1IA 4JI8C 3C5EA 4OXIA 1XNQC 1Y1VS 2PMZA 3OW2Z 4L7IA 2OTLZ 4JI7C 1RNIA 1YI2Z 4PZPA 3VMGA 2ONFA 3CD6Z 2Y0SA 3TE5B 2DE6A 3S2DI 4PHTA 3Q87A 3ETOA 2WB1A 3FQQA 1L2FA 1WW9A 3I56Z 1VQ4Z 4U5YD 2VPXA 1XRAA 4JI5C 1M1K1 3OTOC 4DUZC 4A3MI 1Y8CA 2OPLA 3NYQA 2HU9A 4DR5C 3GPCA 2UXCC 4RLQA 4DV3C 1AA6A 1VQ6Z 5T8SA 1Z01A 1WCMI 4D56A 4HGZA 4MONA 2VF1A 2JA6I 4LE5A 5AE1A 3UZ0A 3L95X 2QVXX 2QVYX 3PBKA 4EATA 1YUKA 4DV5C 4WV3A 4YY3C 5IWAC 1RO4A 1FUGA 4XX2A 1KQSY 1XS3A 4RMNA 1TFIA 2V8IA 5D1PA 2KPIA 2VPWA 2PM9A 2R7ZI 2BH1X 1FDIA 1PFTA 4TNUA 3I551 2O4HA 3CCEZ 1IB8A 4MTNA 1ULTA 3NH5A 2NVTI 5IT9b 4DV2C 3HOZI 4LF4C 2Q4ZA 3S17I 4FUQA 4NBEA 3NPDA 3HKZA 1Q862 4A3KI 2OTJ1 1BA3A 4BBRI 3D2LA 4DR4C 1N32C 2QW0X 4CL1A 2ZZNA 1HH2P 1VQO1 3FKII 3CCRZ 3CXCY 3CW9A 1K8A1 1IBKC 1YJWZ 3NH4A 1WCJA 3BG0B 4JI2C 2OOYB 2UUAC 4DV6C 2VPYA 3QWUA 1KD11 5K85A 2P3YA 2Q51A 4E2XA 1FJGC 1VQ9Z 2BJOA 1K0RA 1V26A 4MD8A 4A3CI 4NXMC 1YHQZ 2AYDA 2LIYA 3CC4Z 2E8FA 1YITZ 3A9UA 3AF5A 3FQMA 3IPLA 2QA4Z 3UX3A 3CJEA 1XRCA 4RVOA 2D1TA 5KEIA 1R9TI 3S14I 3J81b 2YWBA 3CME1 3UEBA 4NBFA 2D7VA 1FLOA 5BSWA 1MDBA 2V7BA 1VQ71 3CXCZ 1Q812 1VQLZ 4LF8C 4NBAA 3L8CA 4B3SC 2AKLA 3S82A 3GTLI 1JJ2Y 2JA8I 3CCJ1 2P2MA 5IFIA 1S721 3RG2A 2P2BA 3CC2Z 2ZM6C 3IFUA 2LEXA 3VTNA 2VPZA 2WAQA 4RVDA 1NYEA 2B63I 1VQN1 2AYAA 3J80D 2CU6A 1I50I 3HOXI 2DHMA 1Z03A 5C4XI 3RV2A 3CCUZ 3CQZI 1MXCA 2RIQA 4G37A 3J80f 2E0GA 3MZLB 3A25A 1I94C 4DGLA 4JYAC 4QTTA 2YWCA 3PROC 4X65C 4R1LA 2UXBC 1PG4A 3CCSZ 1X3WA 1NJI1 3GR0A 4K0KC 1I3QI 4BCAA 4IZ6A 2P20A 1TWGI 1M902 4L2ZA 1QWIA 1QVGZ 1M6XA 4OX9C 3U50C 1K83I 1JJ2Z 1VQK1 2NVXI 3GTMI 1YIJ1 3TDHB 2NAPA 5JRHA 1NP6A 2Y4NA 1XMQC 1KKGA 3S1MI 1MD9A 5CM2M 3CQ2A 4AYBA 4B3RC 1WZNA 1WIIA 3SO4A 2E2HI 4E33A 1MDFA 4LF9C 4G36A 2E2JI 5BUSA 3IMLA 1YJ9Z 3M4OI 5T67A 2IZ3A 4BC9A 2P2JA 5T8TA 2YU9I 2P28A 4ZJZA 4JI6C 4E30A 3UOWA 1K9M1 1UWDA 3ESWA 4E2WA 5AE2A 4E31A 2PT7G 2MM9A 4BXXI 3I4MI 5FLXD 1TWHI 3H3VJ 5AE3A 4DQYB 3RZOI 4NXNC 4A3BI 3M3YI 1VEHA 2RPRA 3K6RA 4A93I 2IV2X 4D4GA 3S16I 5FLXf 5GTDA 4BC7A 2QREB 2P2QA 4LFAC 1Z02A 1VQP1 2JIRA 4NBHA 1MXBA 2PROA 4LFBC 3I07A 2D1SA 2DPLA 4LF7C 2GU2A 2QVZX 1Y1WI 3AF6A 3S15I 4A3EI 5T6BA 3CCJZ 1RY2A 3G6E1 5D1OB 1FDOA 2JIMA 2RT9A 4KTVA 3PESA 2D1QA 1VQNZ 1EGAA 4NOZA 3HOUI 1W2BY 2HHHC 3CW8X 2WP0C 2NCLA 2QR1B 4E2YA 1QXFA 2IZ4A 5LMNC 3IEVA 2O53A 3CCQ1 3CC7Z 3GTJI 3KIFA 2E9HA 3TDEA 4B3MC 1WF3A 4TPSB 2KI7B 4ZLPA 5BSVA 1L1OC 3NDIA 3GCFA 1KC82 4A3FI 3FCEA 4DK1A 1VQKZ 1USPB 3G4S1 4YHHC 1X0TA 1I6HI 3J7A4 2KZ0A 4NBCA 3CMA1 1Q822 4Y52I 3VMHA 4EWCA 2NVYI 4Y7NI 1PG3A 1RO2A 4A3JI 1PA4A 4DCTA 3PO2I 3CCV1 2ZAEB 2V45A 3HOWI 4RVNA 4DCVA 2JR6A 4BY1I 1N2FA 2RHBA 5D1OA 2UU9C 2OOXB 4JI3C 4DG9A 2F4VC 2M5HA 1SIWA 4JI4C 1VQ8Z 1KQSZ 4BBSI 3F3PC 4PROC 3LNVA 2JMOA 3VNSA 2VQEC 1QF8A 2V8JA 1VQMZ 2P02A 2QEX1 3GTOI 4RV9A 4A3DI 1O92A 4FTFA 3GTMS 3JAMD 1ZB9A 3F3FC 2UUBC 4PUIA 3CCL1 2E8CA 3T4NB 3BG1B 2JIPA 3B7WA
chains in the Genus database with same CATH topology
1USPA 3JAMf 1O93A 3RZDI 5A2QD 1KRLA 1IBMC 4DV0C 1K732 5BUQA 4JM1A 3VNRA 3GKQA 3NH8A 5A1GA 4I9GA 2D1RA 3NFZA 5A2Qf 1Q811 2Y27A 3EQ6A 2QKDA 5A19A 2JMPA 2OTL1 3TQIA 1YJN1 3IX0A 4DR7C 1YI21 2D28C 2F4OA 3CD61 2F4MA 4DUYC 5BSMA 1UKKA 3A4IA 4X66C 2PK7A 4GXQA 4RVFA 4GS5A 2XR1A 2PN2A 3IEUA 4RLFA 3I55Z 2JUBA 5H9UA 4DV7C 1VQ61 1M901 2G2KA 4NB8A 2K5RA 2HF1A 3T1YC 4ISBA 2QLVB 5K8FA 3G711 1AMUA 3S1RI 3D6WA 4MRIA 2OTJZ 4NBDA 4MXUA 1N36C 4DR1C 1VQOZ 3CCVZ 3GTPI 3GKUA 1MXAA 4JV5C 2WD9A 3MZKB 1N8R2 2LFUA 3CCE1 3T1HC 2J6AA 2JS4A 1O90A 4D57A 5ADZA 2EGTA 5CZXA 4B3TC 3D9XA 5KYVA 3K7AI 3R9XA 3OW2Y 3E7WA 1Q7Y1 2Y4OA 2JNYA 4NH1C 3J80b 3CCR1 3CMEZ 4DR3C 1LCIA 1YJW1 5IP9I 5DV9A 1N34C 1RO0A 1YUAA 1VQ7Z 1ZB8A 1VQ91 3VNQA 1N33C 4GKKC 5C3EI 1YHQ1 2VUGA 3CC41 1YIT1 4RM3A 3EEDA 2QA41 1S72Z 2HJGA 3CCM1 1TWFI 2H85A 5LMUC 2DE7A 4NBGA 1YJNZ 5E7QA 4DG8A 1DL6A 4DR2C 1M1K2 3S2HI 2E7GA 1XMOC 4DCUA 3E7XA 3N2QA 3TUFA 4DR6C 4MH4A 3G7SA 5BSTA 2JA5I 1VQL1 4DV1C 2YADA 2JA7I 4RS4A 3VB9A 3ETCA 4X6AI 2UXDC 2NVQI 2VUMI 4HGYA 4WS9A 4BY7I 1TWCI 3VMIA 5FLMI 3CC21 3IF8A 1JOSA 2ASBA 3PO3I 3GR1A 1WH9A 3J81D 3R44A 2QL8A 1YIJZ 4NDNA 1GPMA 2V8KA 3CCU1 1HNZC 3GTKI 3J81f 1W2BZ 4JI0C 1J5EC 1KC81 3G71Z 2QRCB 2OO4A 1HNWC 5FLXb 3P5JB 3NI2A 2VQFC 3CCS1 2RBLA 1HNXC 1XNRC 2D27A 5T64A 1Q821 3S1NI 1Q861 3LUSA 4MD7A 1VQ51 1Y1VI 1T5HX 4QTUA 1T5DX 4X62C 1XRBA 4NB9A 4R1MA 4NBBA 4L4QA 3KXWA 4A3LI 2CY1A 2E8EA 3MONA 1K8A2 1TWAI 1YJ7A 1KD12 2OZKA 5C44I 1SFOI 2E2II 1RG9A 4RVGA 2R92I 4KHPC 1YJ91 1P9NA 4KTTA 1ML8A 1RQFA 1VQPZ 1IBLC 4S1TA 3LAXA 3A9VA 2W04A 3GTGI 4DV4C 3EERA 2QRDB 2VZEA 4DCSA 1S7MA 4R0MA 2R6MA 5CZVA 3G6EZ 3H0GI 3HOYI 1QVFY 3KIHA 3CCMZ 3I4NI 2GTIA 4ODJA 4BSZA 1K731 1VLAA 4LF6C 4I9FA 1MKYA 1HR0C 2UUCC 1P7LA 3I561 4GKJC 3DAYA 3CCQZ 1VQ41 4X64C 1QVGY 2OBVA 4OYCA 3CPWY 3GTQI 4HPVA 1QM4A 2KZFA 4RM2A 5AN9F 5C4JI 2DE5A 2K3RA 2M6NA 1V25A 4HH4A 3G4SZ 1RLYA 4BBYA 1NJI2 2R93I 1X3ZA 1QVFZ 2W03A 3CMAZ 3I08A 4A3GI 3DHVA 3FCCA 3NDJA 3DLPX 3CC71 4FUTA 4E32A 3NYRA 2VSQA 3JAMb 2CXCA 3S1QI 5BURA 3CPWZ 2YCBA 3R9WA 3LGXA 1VQ5Z 4LFCC 5BR8C 2ATWA 5A2Qb 2DYJA 2M48A 4A3II 2QEXZ 1N8R1 5LL6f 4K0BA 4LF5C 4MD9A 2OPLB 3H2TA 3PO3S 5BSUA 1NUIA 5IP7I 4G1IA 4GXRA 2E5LC 4IR7A 3N54B 5KYTA 1O9TA 2P2FA 1K9M2 4E2ZA 3CCLZ 2GTHA 4AQYC 1VQ81 5BSRA 3HOVI 2I3CA 5IT9D 4JI1C 4D4IA 1QYPA 1Q7Y2 1LQLA 4RVHA 1JWHC 1ZH1A 1VQM1 4NFRA 5IT9f 5A1IA 4JI8C 3C5EA 4OXIA 1XNQC 1Y1VS 2PMZA 3OW2Z 4L7IA 2OTLZ 4JI7C 1RNIA 1YI2Z 4PZPA 3VMGA 2ONFA 3CD6Z 2Y0SA 3TE5B 2DE6A 3S2DI 4PHTA 3Q87A 3ETOA 2WB1A 3FQQA 1L2FA 1WW9A 3I56Z 1VQ4Z 4U5YD 1XRAA 4JI5C 1M1K1 3OTOC 4DUZC 4A3MI 2OPLA 3NYQA 2HU9A 4DR5C 3GPCA 2UXCC 4RLQA 4DV3C 1VQ6Z 5T8SA 1Z01A 1WCMI 4D56A 4HGZA 4MONA 2VF1A 2JA6I 4LE5A 5AE1A 3UZ0A 3L95X 2QVXX 2QVYX 3PBKA 4EATA 1YUKA 4DV5C 4WV3A 4YY3C 5IWAC 1RO4A 1FUGA 4XX2A 1KQSY 4RMNA 1TFIA 2V8IA 5D1PA 2KPIA 2R7ZI 2PM9A 2BH1X 1PFTA 4TNUA 3I551 2O4HA 3CCEZ 4MTNA 1ULTA 3NH5A 2NVTI 5IT9b 4DV2C 3HOZI 4LF4C 2Q4ZA 3S17I 4FUQA 4NBEA 3NPDA 3HKZA 1Q862 4A3KI 2OTJ1 1BA3A 4BBRI 4DR4C 1N32C 2QW0X 4CL1A 1HH2P 1VQO1 3FKII 3CCRZ 3CXCY 3CW9A 1K8A1 1IBKC 1YJWZ 3NH4A 3BG0B 4JI2C 2OOYB 2UUAC 4DV6C 3QWUA 1KD11 5K85A 2P3YA 2Q51A 4E2XA 1VQ9Z 2BJOA 1K0RA 1V26A 4MD8A 4A3CI 4NXMC 1YHQZ 3CC4Z 2LIYA 2E8FA 3A9UA 1YITZ 3AF5A 3IPLA 3FQMA 2QA4Z 3CJEA 1XRCA 4RVOA 2D1TA 5KEIA 1R9TI 3S14I 3J81b 2YWBA 3CME1 4NBFA 2D7VA 5BSWA 1MDBA 2V7BA 1VQ71 3CXCZ 1Q812 1VQLZ 4LF8C 4NBAA 3L8CA 4B3SC 2AKLA 3S82A 3GTLI 1JJ2Y 2JA8I 3CCJ1 2P2MA 5IFIA 1S721 3RG2A 2P2BA 3CC2Z 2ZM6C 3IFUA 3VTNA 2WAQA 4RVDA 1NYEA 2B63I 1VQN1 2AYAA 3J80D 1I50I 3HOXI 1Z03A 5C4XI 3RV2A 3CCUZ 3CQZI 1MXCA 2RIQA 4G37A 3J80f 2E0GA 3MZLB 1I94C 4DGLA 4JYAC 4QTTA 2YWCA 3PROC 4X65C 4R1LA 2UXBC 1PG4A 3CCSZ 1X3WA 1NJI1 3GR0A 4K0KC 1I3QI 4BCAA 4IZ6A 2P20A 1TWGI 1M902 4L2ZA 1QWIA 1QVGZ 4OX9C 3U50C 1K83I 1JJ2Z 1VQK1 2NVXI 3GTMI 1YIJ1 3TDHB 5JRHA 1NP6A 2Y4NA 1XMQC 1KKGA 3S1MI 1MD9A 5CM2M 4AYBA 4B3RC 1WIIA 3SO4A 2E2HI 4E33A 1MDFA 4LF9C 4G36A 2E2JI 5BUSA 3IMLA 1YJ9Z 3M4OI 5T67A 2IZ3A 4BC9A 2P2JA 5T8TA 2YU9I 2P28A 4ZJZA 4JI6C 4E30A 3UOWA 1K9M1 3ESWA 4E2WA 5AE2A 4E31A 2PT7G 4BXXI 3I4MI 5FLXD 1TWHI 3H3VJ 5AE3A 4DQYB 3RZOI 4NXNC 4A3BI 3M3YI 2RPRA 4A93I 4D4GA 3S16I 5FLXf 5GTDA 4BC7A 2QREB 2P2QA 4LFAC 1Z02A 1VQP1 4NBHA 1MXBA 2PROA 4LFBC 3I07A 2D1SA 2DPLA 4LF7C 2GU2A 2QVZX 1Y1WI 3AF6A 3S15I 4A3EI 5T6BA 3CCJZ 1RY2A 3G6E1 5D1OB 2RT9A 4KTVA 3PESA 2D1QA 1VQNZ 1EGAA 4NOZA 3HOUI 1W2BY 2HHHC 3CW8X 2WP0C 2QR1B 4E2YA 2IZ4A 5LMNC 3IEVA 2O53A 3CCQ1 3CC7Z 3GTJI 3KIFA 2E9HA 3TDEA 4B3MC 1WF3A 4TPSB 2KI7B 4ZLPA 5BSVA 1L1OC 3NDIA 3GCFA 1KC82 4A3FI 3FCEA 4DK1A 1VQKZ 1USPB 3G4S1 4YHHC 1X0TA 1I6HI 3J7A4 4NBCA 3CMA1 1Q822 4Y52I 3VMHA 4EWCA 2NVYI 4Y7NI 1PG3A 1RO2A 4A3JI 1PA4A 4DCTA 3PO2I 3CCV1 2ZAEB 3HOWI 4RVNA 4DCVA 2JR6A 4BY1I 1N2FA 2RHBA 5D1OA 2UU9C 2OOXB 4JI3C 4DG9A 2F4VC 4JI4C 1VQ8Z 1KQSZ 4BBSI 3F3PC 4PROC 3LNVA 2JMOA 3VNSA 2VQEC 1QF8A 2V8JA 1VQMZ 2P02A 2QEX1 3GTOI 4RV9A 4A3DI 1O92A 4FTFA 3GTMS 3JAMD 1ZB9A 3F3FC 2UUBC 3CCL1 2E8CA 3T4NB 3BG1B 1FJGC 3B7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USP A;  3RZD I;  5A2Q D;  1IBM C;  4DV0 C;  3GKQ A;  2JMP A;  4DR7 C;  2F4O A;  2F4M A;  4DUY C;  1UKK A;  4X66 C;  2PK7 A;  2XR1 A;  2PN2 A;  3IEU A;  4DV7 C;  4NB8 A;  2K5R A;  2HF1 A;  3T1Y C;  3S1R I;  3D6W A;  4NBD A;  1N36 C;  4DR1 C;  3GTP I;  3GKU A;  4JV5 C;  3T1H C;  2J6A A;  2JS4 A;  2EGT A;  4B3T C;  3K7A I;  3R9X A;  2JNY A;  4DR3 C;  5IP9 I;  1N34 C;  1YUA A;  1ZB8 A;  1N33 C;  4GKK C;  5C3E I;  2HJG A;  1TWF I;  5LMU C;  2DE7 A;  4NBG A;  1DL6 A;  4DR2 C;  3S2H I;  2E7G A;  1XMO C;  4DCU A;  4DR6 C;  4MH4 A;  2JA5 I;  4DV1 C;  2JA7 I;  2UXD C;  3VB9 A;  4X6A I;  2NVQ I;  2VUM I;  4BY7 I;  1TWC I;  3VMI A;  5FLM I;  1JOS A;  2ASB A;  3PO3 I;  1WH9 A;  3J81 D;  2QL8 A;  1HNZ C;  3GTK I;  4JI0 C;  1J5E C;  1HNW C;  2VQF C;  2RBL A;  1HNX C;  1XNR C;  3S1N I;  3LUS A;  1Y1V I;  4QTU A;  4X62 C;  4NB9 A;  4NBB A;  4A3L I;  2CY1 A;  2E8E A;  1TWA I;  5C44 I;  1SFO I;  2E2I I;  2R92 I;  4KHP C;  1ML8 A;  1IBL C;  3GTG I;  4DV4 C;  3EER A;  4DCS A;  3H0G I;  3HOY I;  4BSZ A;  3I4N I;  1VLA A;  4LF6 C;  1MKY A;  1HR0 C;  2UUC C;  4GKJ C;  4X64 C;  3GTQ I;  2KZF A;  5C4J I;  2DE5 A;  1RLY A;  2R93 I;  1X3Z A;  4A3G I;  2CXC A;  3S1Q I;  2YCB A;  3R9W A;  4LFC C;  5BR8 C;  2ATW A;  2DYJ A;  4A3I I;  4LF5 C;  2OPL B;  3PO3 S;  1NUI A;  5IP7 I;  2E5L C;  4AQY C;  5IT9 D;  3HOV I;  4JI1 C;  1QYP A;  1LQL A;  1XNQ C;  4JI8 C;  1Y1V S;  4JI7 C;  3VMG A;  2ONF A;  2DE6 A;  3S2D I;  3Q87 A;  1L2F A;  1WW9 A;  4JI5 C;  3OTO C;  4DUZ C;  4A3M I;  2OPL A;  4DR5 C;  2UXC C;  4DV3 C;  1WCM I;  2JA6 I;  4DV5 C;  4YY3 C;  5IWA C;  1RO4 A;  4XX2 A;  1TFI A;  2R7Z I;  2KPI A;  1PFT A;  4MTN A;  2NVT I;  4DV2 C;  3HOZ I;  4LF4 C;  3S17 I;  4NBE A;  4A3K I;  4BBR I;  4DR4 C;  1N32 C;  1HH2 P;  3FKI I;  1IBK C;  4JI2 C;  2UUA C;  4DV6 C;  2P3Y A;  2BJO A;  1K0R A;  4A3C I;  4NXM C;  2E8F A;  3AF5 A;  3CJE A;  1R9T I;  3S14 I;  4NBF A;  2D7V A;  4LF8 C;  4NBA A;  4B3S C;  2AKL A;  3GTL I;  2JA8 I;  2ZM6 C;  1NYE A;  2B63 I;  3J80 D;  1I50 I;  3HOX I;  5C4X I;  3CQZ I;  1I94 C;  4JYA C;  4QTT A;  4X65 C;  2UXB C;  4K0K C;  1X3W A;  1I3Q I;  1TWG I;  1QWI A;  4OX9 C;  3U50 C;  1K83 I;  2NVX I;  3GTM I;  1KKG A;  1XMQ C;  3S1M I;  5CM2 M;  4B3R C;  4LF9 C;  2E2H I;  2E2J I;  3M4O I;  2YU9 I;  4JI6 C;  3ESW A;  2PT7 G;  4BXX I;  3I4M I;  5FLX D;  1TWH I;  3H3V J;  3RZO I;  4NXN C;  4A3B I;  3M3Y I;  4A93 I;  3S16 I;  4LFA C;  4NBH A;  4LFB C;  3I07 A;  4LF7 C;  1Y1W I;  3AF6 A;  3S15 I;  4A3E I;  1EGA A;  4NOZ A;  3HOU I;  2HHH C;  5LMN C;  3IEV A;  3GTJ I;  4B3M C;  1WF3 A;  1L1O C;  3GCF A;  4A3F I;  1USP B;  4YHH C;  1I6H I;  4NBC A;  4Y52 I;  3VMH A;  2NVY I;  4Y7N I;  4A3J I;  1PA4 A;  4DCT A;  3PO2 I;  3HOW I;  4DCV A;  2JR6 A;  4BY1 I;  1N2F A;  2UU9 C;  4JI3 C;  2F4V C;  4JI4 C;  4BBS I;  2VQE C;  3GTO I;  4A3D I;  3GTM S;  3JAM D;  1ZB9 A;  2UUB C;  2E8C A;  1FJG C; 
#chains in the Genus database with same CATH topology
 1USP A;  3JAM f;  1O93 A;  3RZD I;  5A2Q D;  1KRL A;  1IBM C;  4DV0 C;  2JNV A;  1K73 2;  5BUQ A;  4JM1 A;  3VNR A;  3GKQ A;  3NH8 A;  5A1G A;  4I9G A;  2D1R A;  3NFZ A;  5A2Q f;  1Q81 1;  2Y27 A;  3EQ6 A;  2QKD A;  5A19 A;  2JMP A;  2OTL 1;  3TQI A;  1YJN 1;  3IX0 A;  3CQ1 A;  1YI2 1;  4DR7 C;  2D28 C;  2F4O A;  3CD6 1;  2F4M A;  1XHJ A;  4DUY C;  5BSM A;  1UKK A;  3A4I A;  4X66 C;  2PK7 A;  4GXQ A;  4RVF A;  2JIO A;  4GS5 A;  2XR1 A;  3IR7 A;  3UX2 A;  2PN2 A;  3IEU A;  3LNO A;  4RLF A;  3I55 Z;  2JUB A;  5H9U A;  4DV7 C;  1VQ6 1;  1M90 1;  2G2K A;  4NB8 A;  2K5R A;  2HF1 A;  3T1Y C;  4ISB A;  2QLV B;  5K8F A;  3G71 1;  1AMU A;  3S1R I;  3D6W A;  4MRI A;  2OTJ Z;  4NBD A;  4MXU A;  3AY0 A;  1N36 C;  4DR1 C;  1VQO Z;  3CCV Z;  3GTP I;  3GKU A;  1MXA A;  4JV5 C;  2WD9 A;  1PU1 A;  3MZK B;  1N8R 2;  2LFU A;  3CCE 1;  3T1H C;  2J6A A;  2JS4 A;  1O90 A;  4D57 A;  5ADZ A;  2EGT A;  5CZX A;  4B3T C;  3D9X A;  5KYV A;  3K7A I;  3R9X A;  3OW2 Y;  3E7W A;  1Q7Y 1;  2Y4O A;  1TH5 A;  1P4E C;  2JNY A;  4NH1 C;  3J80 b;  3CCR 1;  3CME Z;  4DR3 C;  1LCI A;  1YJW 1;  5IP9 I;  5DV9 A;  1N34 C;  1RO0 A;  1YUA A;  1VQ7 Z;  1ZB8 A;  1VQ9 1;  3VNQ A;  1N33 C;  4GKK C;  2JIQ A;  2MMA B;  5C3E I;  1YHQ 1;  2VUG A;  3CC4 1;  1YIT 1;  4RM3 A;  3EED A;  2QA4 1;  1S72 Z;  2HJG A;  3CCM 1;  1TWF I;  2H85 A;  5LMU C;  2DE7 A;  3A26 A;  4NBG A;  1YJN Z;  5E7Q A;  4DG8 A;  1DL6 A;  4DR2 C;  1M1K 2;  3S2H I;  2E7G A;  1XMO C;  1WJ2 A;  3E7X A;  3N2Q A;  4DCU A;  3TUF A;  4DR6 C;  4MH4 A;  3G7S A;  5BST A;  2JA5 I;  1VQL 1;  4DV1 C;  2YAD A;  2JA7 I;  4RS4 A;  3VB9 A;  3ETC A;  4X6A I;  2UXD C;  2NVQ I;  2VUM I;  4HGY A;  4WS9 A;  4BY7 I;  1TWC I;  3VMI A;  5FLM I;  3CC2 1;  3IF8 A;  1JOS A;  2ASB A;  3PO3 I;  3GR1 A;  1WH9 A;  3TR3 A;  3J81 D;  3R44 A;  2QL8 A;  2YX1 A;  1YIJ Z;  4NDN A;  1GPM A;  2V8K A;  3CCU 1;  1HNZ C;  3GTK I;  3J81 f;  1W2B Z;  4JI0 C;  1J5E C;  1KC8 1;  3G71 Z;  2QRC B;  2OO4 A;  1HNW C;  5FLX b;  3P5J B;  3NI2 A;  2VQF C;  3CCS 1;  2RBL A;  1M6X C;  4PUH A;  1HNX C;  2D27 A;  5T64 A;  1Q82 1;  3S1N I;  1Q86 1;  1XNR C;  3LUS A;  4MD7 A;  1VQ5 1;  1Y1V I;  1T5H X;  3O2E A;  4QTU A;  1T5D X;  4X62 C;  1V60 A;  1XRB A;  3CQ3 A;  4NB9 A;  4R1M A;  4NBB A;  4L4Q A;  3KXW A;  4A3L I;  2CY1 A;  2E8E A;  3MON A;  1K8A 2;  1TWA I;  1YJ7 A;  1KD1 2;  2OZK A;  5C44 I;  1SFO I;  2ZZM A;  2E2I I;  1RG9 A;  4RVG A;  1P4E A;  2R92 I;  4KHP C;  1YJ9 1;  1P9N A;  4KTT A;  1ML8 A;  1RQF A;  1VQP Z;  1IBL C;  4S1T A;  3LAX A;  3A9V A;  2W04 A;  3GTG I;  4DV4 C;  3EER A;  2QRD B;  2VZE A;  4DCS A;  1S7M A;  4R0M A;  2R6M A;  5CZV A;  3G6E Z;  3H0G I;  3HOY I;  1QVF Y;  3KIH A;  3CCM Z;  3I4N I;  2GTI A;  4ODJ A;  4BSZ A;  1K73 1;  1VLA A;  4LF6 C;  4I9F A;  1MKY A;  2E7Z A;  5LCI A;  1HR0 C;  1Q16 A;  2UUC C;  1P7L A;  3I56 1;  4GKJ C;  3DAY A;  3CCQ Z;  1VQ4 1;  4X64 C;  1QVG Y;  2OBV A;  4OYC A;  3CPW Y;  3GTQ I;  4HPV A;  1QM4 A;  2KZF A;  4RM2 A;  5AN9 F;  4PUG A;  5C4J I;  2DE5 A;  2K3R A;  1NY8 A;  2M6N A;  1V25 A;  4HH4 A;  3G4S Z;  1RLY A;  4BBY A;  1NJI 2;  2R93 I;  1X3Z A;  1QVF Z;  2W03 A;  3CMA Z;  3I08 A;  4A3G I;  3DHV A;  3FCC A;  3NDJ A;  3DLP X;  3CC7 1;  4FUT A;  4E32 A;  3NYR A;  2VSQ A;  3JAM b;  2CXC A;  3S1Q I;  5BUR A;  3CPW Z;  2YCB A;  3R9W A;  3LGX A;  1VQ5 Z;  4LFC C;  5BR8 C;  2ATW A;  5A2Q b;  2DYJ A;  2M48 A;  4A3I I;  2QEX Z;  1N8R 1;  2V3V A;  5LL6 f;  4K0B A;  4LF5 C;  2M5O A;  4MD9 A;  2OPL B;  3H2T A;  3PO3 S;  2Z51 A;  5BSU A;  2MCQ A;  1NUI A;  5IP7 I;  4G1I A;  4GXR A;  2E5L C;  4IR7 A;  3N54 B;  5KYT A;  1O9T A;  2P2F A;  1K9M 2;  4E2Z A;  3CCL Z;  2KDN A;  2GTH A;  4AQY C;  1VQ8 1;  5BSR A;  3HOV I;  2I3C A;  5IT9 D;  4JI1 C;  4D4I A;  1QYP A;  1Q7Y 2;  1LQL A;  4RVH A;  1JWH C;  1ZH1 A;  1VQM 1;  4NFR A;  5IT9 f;  5A1I A;  4JI8 C;  3C5E A;  4OXI A;  1XNQ C;  1Y1V S;  2PMZ A;  3OW2 Z;  4L7I A;  2OTL Z;  4JI7 C;  1RNI A;  1YI2 Z;  4PZP A;  3VMG A;  2ONF A;  3CD6 Z;  2Y0S A;  3TE5 B;  2DE6 A;  3S2D I;  4PHT A;  3Q87 A;  3ETO A;  2WB1 A;  3FQQ A;  1L2F A;  1WW9 A;  3I56 Z;  1VQ4 Z;  4U5Y D;  2VPX A;  1XRA A;  4JI5 C;  1M1K 1;  3OTO C;  4DUZ C;  4A3M I;  1Y8C A;  2OPL A;  3NYQ A;  2HU9 A;  4DR5 C;  3GPC A;  2UXC C;  4RLQ A;  4DV3 C;  1AA6 A;  1VQ6 Z;  5T8S A;  1Z01 A;  1WCM I;  4D56 A;  4HGZ A;  4MON A;  2VF1 A;  2JA6 I;  4LE5 A;  5AE1 A;  3UZ0 A;  3L95 X;  2QVX X;  2QVY X;  3PBK A;  4EAT A;  1YUK A;  4DV5 C;  4WV3 A;  4YY3 C;  5IWA C;  1RO4 A;  1FUG A;  4XX2 A;  1KQS Y;  1XS3 A;  4RMN A;  1TFI A;  2V8I A;  5D1P A;  2KPI A;  2VPW A;  2PM9 A;  2R7Z I;  2BH1 X;  1FDI A;  1PFT A;  4TNU A;  3I55 1;  2O4H A;  3CCE Z;  1IB8 A;  4MTN A;  1ULT A;  3NH5 A;  2NVT I;  5IT9 b;  4DV2 C;  3HOZ I;  4LF4 C;  2Q4Z A;  3S17 I;  4FUQ A;  4NBE A;  3NPD A;  3HKZ A;  1Q86 2;  4A3K I;  2OTJ 1;  1BA3 A;  4BBR I;  3D2L A;  4DR4 C;  1N32 C;  2QW0 X;  4CL1 A;  2ZZN A;  1HH2 P;  1VQO 1;  3FKI I;  3CCR Z;  3CXC Y;  3CW9 A;  1K8A 1;  1IBK C;  1YJW Z;  3NH4 A;  1WCJ A;  3BG0 B;  4JI2 C;  2OOY B;  2UUA C;  4DV6 C;  2VPY A;  3QWU A;  1KD1 1;  5K85 A;  2P3Y A;  2Q51 A;  4E2X A;  1FJG C;  1VQ9 Z;  2BJO A;  1K0R A;  1V26 A;  4MD8 A;  4A3C I;  4NXM C;  1YHQ Z;  2AYD A;  2LIY A;  3CC4 Z;  2E8F A;  1YIT Z;  3A9U A;  3AF5 A;  3FQM A;  3IPL A;  2QA4 Z;  3UX3 A;  3CJE A;  1XRC A;  4RVO A;  2D1T A;  5KEI A;  1R9T I;  3S14 I;  3J81 b;  2YWB A;  3CME 1;  3UEB A;  4NBF A;  2D7V A;  1FLO A;  5BSW A;  1MDB A;  2V7B A;  1VQ7 1;  3CXC Z;  1Q81 2;  1VQL Z;  4LF8 C;  4NBA A;  3L8C A;  4B3S C;  2AKL A;  3S82 A;  3GTL I;  1JJ2 Y;  2JA8 I;  3CCJ 1;  2P2M A;  5IFI A;  1S72 1;  3RG2 A;  2P2B A;  3CC2 Z;  2ZM6 C;  3IFU A;  2LEX A;  3VTN A;  2VPZ A;  2WAQ A;  4RVD A;  1NYE A;  2B63 I;  1VQN 1;  2AYA A;  3J80 D;  2CU6 A;  1I50 I;  3HOX I;  2DHM A;  1Z03 A;  5C4X I;  3RV2 A;  3CCU Z;  3CQZ I;  1MXC A;  2RIQ A;  4G37 A;  3J80 f;  2E0G A;  3MZL B;  3A25 A;  1I94 C;  4DGL A;  4JYA C;  4QTT A;  2YWC A;  3PRO C;  4X65 C;  4R1L A;  2UXB C;  1PG4 A;  3CCS Z;  1X3W A;  1NJI 1;  3GR0 A;  4K0K C;  1I3Q I;  4BCA A;  4IZ6 A;  2P20 A;  1TWG I;  1M90 2;  4L2Z A;  1QWI A;  1QVG Z;  1M6X A;  4OX9 C;  3U50 C;  1K83 I;  1JJ2 Z;  1VQK 1;  2NVX I;  3GTM I;  1YIJ 1;  3TDH B;  2NAP A;  5JRH A;  1NP6 A;  2Y4N A;  1XMQ C;  1KKG A;  3S1M I;  1MD9 A;  5CM2 M;  3CQ2 A;  4AYB A;  4B3R C;  1WZN A;  1WII A;  3SO4 A;  2E2H I;  4E33 A;  1MDF A;  4LF9 C;  4G36 A;  2E2J I;  5BUS A;  3IML A;  1YJ9 Z;  3M4O I;  5T67 A;  2IZ3 A;  4BC9 A;  2P2J A;  5T8T A;  2YU9 I;  2P28 A;  4ZJZ A;  4JI6 C;  4E30 A;  3UOW A;  1K9M 1;  1UWD A;  3ESW A;  4E2W A;  5AE2 A;  4E31 A;  2PT7 G;  2MM9 A;  4BXX I;  3I4M I;  5FLX D;  1TWH I;  3H3V J;  5AE3 A;  4DQY B;  3RZO I;  4NXN C;  4A3B I;  3M3Y I;  1VEH A;  2RPR A;  3K6R A;  4A93 I;  2IV2 X;  4D4G A;  3S16 I;  5FLX f;  5GTD A;  4BC7 A;  2QRE B;  2P2Q A;  4LFA C;  1Z02 A;  1VQP 1;  2JIR A;  4NBH A;  1MXB A;  2PRO A;  4LFB C;  3I07 A;  2D1S A;  2DPL A;  4LF7 C;  2GU2 A;  2QVZ X;  1Y1W I;  3AF6 A;  3S15 I;  4A3E I;  5T6B A;  3CCJ Z;  1RY2 A;  3G6E 1;  5D1O B;  1FDO A;  2JIM A;  2RT9 A;  4KTV A;  3PES A;  2D1Q A;  1VQN Z;  1EGA A;  4NOZ A;  3HOU I;  1W2B Y;  2HHH C;  3CW8 X;  2WP0 C;  2NCL A;  2QR1 B;  4E2Y A;  1QXF A;  2IZ4 A;  5LMN C;  3IEV A;  2O53 A;  3CCQ 1;  3CC7 Z;  3GTJ I;  3KIF A;  2E9H A;  3TDE A;  4B3M C;  1WF3 A;  4TPS B;  2KI7 B;  4ZLP A;  5BSV A;  1L1O C;  3NDI A;  3GCF A;  1KC8 2;  4A3F I;  3FCE A;  4DK1 A;  1VQK Z;  1USP B;  3G4S 1;  4YHH C;  1X0T A;  1I6H I;  3J7A 4;  2KZ0 A;  4NBC A;  3CMA 1;  1Q82 2;  4Y52 I;  3VMH A;  4EWC A;  2NVY I;  4Y7N I;  1PG3 A;  1RO2 A;  4A3J I;  1PA4 A;  4DCT A;  3PO2 I;  3CCV 1;  2ZAE B;  2V45 A;  3HOW I;  4RVN A;  4DCV A;  2JR6 A;  4BY1 I;  1N2F A;  2RHB A;  5D1O A;  2UU9 C;  2OOX B;  4JI3 C;  4DG9 A;  2F4V C;  2M5H A;  1SIW A;  4JI4 C;  1VQ8 Z;  1KQS Z;  4BBS I;  3F3P C;  4PRO C;  3LNV A;  2JMO A;  3VNS A;  2VQE C;  1QF8 A;  2V8J A;  1VQM Z;  2P02 A;  2QEX 1;  3GTO I;  4RV9 A;  4A3D I;  1O92 A;  4FTF A;  3GTM S;  3JAM D;  1ZB9 A;  3F3F C;  2UUB C;  4PUI A;  3CCL 1;  2E8C A;  3T4N B;  3BG1 B;  2JIP A;  3B7W A; 
#chains in the Genus database with same CATH homology
 1USP A;  3JAM f;  1O93 A;  3RZD I;  5A2Q D;  1KRL A;  1IBM C;  4DV0 C;  1K73 2;  5BUQ A;  4JM1 A;  3VNR A;  3GKQ A;  3NH8 A;  5A1G A;  4I9G A;  2D1R A;  3NFZ A;  5A2Q f;  1Q81 1;  2Y27 A;  3EQ6 A;  2QKD A;  5A19 A;  2JMP A;  2OTL 1;  3TQI A;  1YJN 1;  3IX0 A;  4DR7 C;  1YI2 1;  2D28 C;  2F4O A;  3CD6 1;  2F4M A;  4DUY C;  5BSM A;  1UKK A;  3A4I A;  4X66 C;  2PK7 A;  4GXQ A;  4RVF A;  4GS5 A;  2XR1 A;  2PN2 A;  3IEU A;  4RLF A;  3I55 Z;  2JUB A;  5H9U A;  4DV7 C;  1VQ6 1;  1M90 1;  2G2K A;  4NB8 A;  2K5R A;  2HF1 A;  3T1Y C;  4ISB A;  2QLV B;  5K8F A;  3G71 1;  1AMU A;  3S1R I;  3D6W A;  4MRI A;  2OTJ Z;  4NBD A;  4MXU A;  1N36 C;  4DR1 C;  1VQO Z;  3CCV Z;  3GTP I;  3GKU A;  1MXA A;  4JV5 C;  2WD9 A;  3MZK B;  1N8R 2;  2LFU A;  3CCE 1;  3T1H C;  2J6A A;  2JS4 A;  1O90 A;  4D57 A;  5ADZ A;  2EGT A;  5CZX A;  4B3T C;  3D9X A;  5KYV A;  3K7A I;  3R9X A;  3OW2 Y;  3E7W A;  1Q7Y 1;  2Y4O A;  2JNY A;  4NH1 C;  3J80 b;  3CCR 1;  3CME Z;  4DR3 C;  1LCI A;  1YJW 1;  5IP9 I;  5DV9 A;  1N34 C;  1RO0 A;  1YUA A;  1VQ7 Z;  1ZB8 A;  1VQ9 1;  3VNQ A;  1N33 C;  4GKK C;  5C3E I;  1YHQ 1;  2VUG A;  3CC4 1;  1YIT 1;  4RM3 A;  3EED A;  2QA4 1;  1S72 Z;  2HJG A;  3CCM 1;  1TWF I;  2H85 A;  5LMU C;  2DE7 A;  4NBG A;  1YJN Z;  5E7Q A;  4DG8 A;  1DL6 A;  4DR2 C;  1M1K 2;  3S2H I;  2E7G A;  1XMO C;  4DCU A;  3E7X A;  3N2Q A;  3TUF A;  4DR6 C;  4MH4 A;  3G7S A;  5BST A;  2JA5 I;  1VQL 1;  4DV1 C;  2YAD A;  2JA7 I;  4RS4 A;  3VB9 A;  3ETC A;  4X6A I;  2UXD C;  2NVQ I;  2VUM I;  4HGY A;  4WS9 A;  4BY7 I;  1TWC I;  3VMI A;  5FLM I;  3CC2 1;  3IF8 A;  1JOS A;  2ASB A;  3PO3 I;  3GR1 A;  1WH9 A;  3J81 D;  3R44 A;  2QL8 A;  1YIJ Z;  4NDN A;  1GPM A;  2V8K A;  3CCU 1;  1HNZ C;  3GTK I;  3J81 f;  1W2B Z;  4JI0 C;  1J5E C;  1KC8 1;  3G71 Z;  2QRC B;  2OO4 A;  1HNW C;  5FLX b;  3P5J B;  3NI2 A;  2VQF C;  3CCS 1;  2RBL A;  1HNX C;  1XNR C;  2D27 A;  5T64 A;  1Q82 1;  3S1N I;  1Q86 1;  3LUS A;  4MD7 A;  1VQ5 1;  1Y1V I;  1T5H X;  4QTU A;  1T5D X;  4X62 C;  1XRB A;  4NB9 A;  4R1M A;  4NBB A;  4L4Q A;  3KXW A;  4A3L I;  2CY1 A;  2E8E A;  3MON A;  1K8A 2;  1TWA I;  1YJ7 A;  1KD1 2;  2OZK A;  5C44 I;  1SFO I;  2E2I I;  1RG9 A;  4RVG A;  2R92 I;  4KHP C;  1YJ9 1;  1P9N A;  4KTT A;  1ML8 A;  1RQF A;  1VQP Z;  1IBL C;  4S1T A;  3LAX A;  3A9V A;  2W04 A;  3GTG I;  4DV4 C;  3EER A;  2QRD B;  2VZE A;  4DCS A;  1S7M A;  4R0M A;  2R6M A;  5CZV A;  3G6E Z;  3H0G I;  3HOY I;  1QVF Y;  3KIH A;  3CCM Z;  3I4N I;  2GTI A;  4ODJ A;  4BSZ A;  1K73 1;  1VLA A;  4LF6 C;  4I9F A;  1MKY A;  1HR0 C;  2UUC C;  1P7L A;  3I56 1;  4GKJ C;  3DAY A;  3CCQ Z;  1VQ4 1;  4X64 C;  1QVG Y;  2OBV A;  4OYC A;  3CPW Y;  3GTQ I;  4HPV A;  1QM4 A;  2KZF A;  4RM2 A;  5AN9 F;  5C4J I;  2DE5 A;  2K3R A;  2M6N A;  1V25 A;  4HH4 A;  3G4S Z;  1RLY A;  4BBY A;  1NJI 2;  2R93 I;  1X3Z A;  1QVF Z;  2W03 A;  3CMA Z;  3I08 A;  4A3G I;  3DHV A;  3FCC A;  3NDJ A;  3DLP X;  3CC7 1;  4FUT A;  4E32 A;  3NYR A;  2VSQ A;  3JAM b;  2CXC A;  3S1Q I;  5BUR A;  3CPW Z;  2YCB A;  3R9W A;  3LGX A;  1VQ5 Z;  4LFC C;  5BR8 C;  2ATW A;  5A2Q b;  2DYJ A;  2M48 A;  4A3I I;  2QEX Z;  1N8R 1;  5LL6 f;  4K0B A;  4LF5 C;  4MD9 A;  2OPL B;  3H2T A;  3PO3 S;  5BSU A;  1NUI A;  5IP7 I;  4G1I A;  4GXR A;  2E5L C;  4IR7 A;  3N54 B;  5KYT A;  1O9T A;  2P2F A;  1K9M 2;  4E2Z A;  3CCL Z;  2GTH A;  4AQY C;  1VQ8 1;  5BSR A;  3HOV I;  2I3C A;  5IT9 D;  4JI1 C;  4D4I A;  1QYP A;  1Q7Y 2;  1LQL A;  4RVH A;  1JWH C;  1ZH1 A;  1VQM 1;  4NFR A;  5IT9 f;  5A1I A;  4JI8 C;  3C5E A;  4OXI A;  1XNQ C;  1Y1V S;  2PMZ A;  3OW2 Z;  4L7I A;  2OTL Z;  4JI7 C;  1RNI A;  1YI2 Z;  4PZP A;  3VMG A;  2ONF A;  3CD6 Z;  2Y0S A;  3TE5 B;  2DE6 A;  3S2D I;  4PHT A;  3Q87 A;  3ETO A;  2WB1 A;  3FQQ A;  1L2F A;  1WW9 A;  3I56 Z;  1VQ4 Z;  4U5Y D;  1XRA A;  4JI5 C;  1M1K 1;  3OTO C;  4DUZ C;  4A3M I;  2OPL A;  3NYQ A;  2HU9 A;  4DR5 C;  3GPC A;  2UXC C;  4RLQ A;  4DV3 C;  1VQ6 Z;  5T8S A;  1Z01 A;  1WCM I;  4D56 A;  4HGZ A;  4MON A;  2VF1 A;  2JA6 I;  4LE5 A;  5AE1 A;  3UZ0 A;  3L95 X;  2QVX X;  2QVY X;  3PBK A;  4EAT A;  1YUK A;  4DV5 C;  4WV3 A;  4YY3 C;  5IWA C;  1RO4 A;  1FUG A;  4XX2 A;  1KQS Y;  4RMN A;  1TFI A;  2V8I A;  5D1P A;  2KPI A;  2R7Z I;  2PM9 A;  2BH1 X;  1PFT A;  4TNU A;  3I55 1;  2O4H A;  3CCE Z;  4MTN A;  1ULT A;  3NH5 A;  2NVT I;  5IT9 b;  4DV2 C;  3HOZ I;  4LF4 C;  2Q4Z A;  3S17 I;  4FUQ A;  4NBE A;  3NPD A;  3HKZ A;  1Q86 2;  4A3K I;  2OTJ 1;  1BA3 A;  4BBR I;  4DR4 C;  1N32 C;  2QW0 X;  4CL1 A;  1HH2 P;  1VQO 1;  3FKI I;  3CCR Z;  3CXC Y;  3CW9 A;  1K8A 1;  1IBK C;  1YJW Z;  3NH4 A;  3BG0 B;  4JI2 C;  2OOY B;  2UUA C;  4DV6 C;  3QWU A;  1KD1 1;  5K85 A;  2P3Y A;  2Q51 A;  4E2X A;  1VQ9 Z;  2BJO A;  1K0R A;  1V26 A;  4MD8 A;  4A3C I;  4NXM C;  1YHQ Z;  3CC4 Z;  2LIY A;  2E8F A;  3A9U A;  1YIT Z;  3AF5 A;  3IPL A;  3FQM A;  2QA4 Z;  3CJE A;  1XRC A;  4RVO A;  2D1T A;  5KEI A;  1R9T I;  3S14 I;  3J81 b;  2YWB A;  3CME 1;  4NBF A;  2D7V A;  5BSW A;  1MDB A;  2V7B A;  1VQ7 1;  3CXC Z;  1Q81 2;  1VQL Z;  4LF8 C;  4NBA A;  3L8C A;  4B3S C;  2AKL A;  3S82 A;  3GTL I;  1JJ2 Y;  2JA8 I;  3CCJ 1;  2P2M A;  5IFI A;  1S72 1;  3RG2 A;  2P2B A;  3CC2 Z;  2ZM6 C;  3IFU A;  3VTN A;  2WAQ A;  4RVD A;  1NYE A;  2B63 I;  1VQN 1;  2AYA A;  3J80 D;  1I50 I;  3HOX I;  1Z03 A;  5C4X I;  3RV2 A;  3CCU Z;  3CQZ I;  1MXC A;  2RIQ A;  4G37 A;  3J80 f;  2E0G A;  3MZL B;  1I94 C;  4DGL A;  4JYA C;  4QTT A;  2YWC A;  3PRO C;  4X65 C;  4R1L A;  2UXB C;  1PG4 A;  3CCS Z;  1X3W A;  1NJI 1;  3GR0 A;  4K0K C;  1I3Q I;  4BCA A;  4IZ6 A;  2P20 A;  1TWG I;  1M90 2;  4L2Z A;  1QWI A;  1QVG Z;  4OX9 C;  3U50 C;  1K83 I;  1JJ2 Z;  1VQK 1;  2NVX I;  3GTM I;  1YIJ 1;  3TDH B;  5JRH A;  1NP6 A;  2Y4N A;  1XMQ C;  1KKG A;  3S1M I;  1MD9 A;  5CM2 M;  4AYB A;  4B3R C;  1WII A;  3SO4 A;  2E2H I;  4E33 A;  1MDF A;  4LF9 C;  4G36 A;  2E2J I;  5BUS A;  3IML A;  1YJ9 Z;  3M4O I;  5T67 A;  2IZ3 A;  4BC9 A;  2P2J A;  5T8T A;  2YU9 I;  2P28 A;  4ZJZ A;  4JI6 C;  4E30 A;  3UOW A;  1K9M 1;  3ESW A;  4E2W A;  5AE2 A;  4E31 A;  2PT7 G;  4BXX I;  3I4M I;  5FLX D;  1TWH I;  3H3V J;  5AE3 A;  4DQY B;  3RZO I;  4NXN C;  4A3B I;  3M3Y I;  2RPR A;  4A93 I;  4D4G A;  3S16 I;  5FLX f;  5GTD A;  4BC7 A;  2QRE B;  2P2Q A;  4LFA C;  1Z02 A;  1VQP 1;  4NBH A;  1MXB A;  2PRO A;  4LFB C;  3I07 A;  2D1S A;  2DPL A;  4LF7 C;  2GU2 A;  2QVZ X;  1Y1W I;  3AF6 A;  3S15 I;  4A3E I;  5T6B A;  3CCJ Z;  1RY2 A;  3G6E 1;  5D1O B;  2RT9 A;  4KTV A;  3PES A;  2D1Q A;  1VQN Z;  1EGA A;  4NOZ A;  3HOU I;  1W2B Y;  2HHH C;  3CW8 X;  2WP0 C;  2QR1 B;  4E2Y A;  2IZ4 A;  5LMN C;  3IEV A;  2O53 A;  3CCQ 1;  3CC7 Z;  3GTJ I;  3KIF A;  2E9H A;  3TDE A;  4B3M C;  1WF3 A;  4TPS B;  2KI7 B;  4ZLP A;  5BSV A;  1L1O C;  3NDI A;  3GCF A;  1KC8 2;  4A3F I;  3FCE A;  4DK1 A;  1VQK Z;  1USP B;  3G4S 1;  4YHH C;  1X0T A;  1I6H I;  3J7A 4;  4NBC A;  3CMA 1;  1Q82 2;  4Y52 I;  3VMH A;  4EWC A;  2NVY I;  4Y7N I;  1PG3 A;  1RO2 A;  4A3J I;  1PA4 A;  4DCT A;  3PO2 I;  3CCV 1;  2ZAE B;  3HOW I;  4RVN A;  4DCV A;  2JR6 A;  4BY1 I;  1N2F A;  2RHB A;  5D1O A;  2UU9 C;  2OOX B;  4JI3 C;  4DG9 A;  2F4V C;  4JI4 C;  1VQ8 Z;  1KQS Z;  4BBS I;  3F3P C;  4PRO C;  3LNV A;  2JMO A;  3VNS A;  2VQE C;  1QF8 A;  2V8J A;  1VQM Z;  2P02 A;  2QEX 1;  3GTO I;  4RV9 A;  4A3D I;  1O92 A;  4FTF A;  3GTM S;  3JAM D;  1ZB9 A;  3F3F C;  2UUB C;  3CCL 1;  2E8C A;  3T4N B;  3BG1 B;  1FJG C;  3B7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...