4LE5A

Structure of an unusual s-adenosylmethionine synthetase from campylobacter jejuni
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
399
structure length
388
Chain Sequence
MYLFTSEVVSAGHPDKCADIIADTIVDILLKNDKNSRVASEVFVAGNKVVIGGEVKSNHKLSKADYDNLVKDVLKNIGYDGAGHFSKEQCLHPDEVDVMVFLNEQSGETGAGDQGIMFGFASCEAEEYMPAAISYARMLCDRVYAYAKANPHELGVDIKTQVTIDYGTKANFENCKPQSIHTIVVSAPCVESMKIEDLRSLVMKLILDSNLPKELFDPNKTRILINPTGKYVNHSSLHDSGLTGRKLIVDSFGGYSPIGGGAQSSKDYTKVDRSGLYAGRWLAKNIVAAGLAKKCIVQLSYAIGVAKPTSVSVDCMGTNTSVNDDVLSDFVMQNFSLTPNWIRDKFHLDKPSKETFLYADVAARGQVGQKDYPWEKLDALEQFKKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an unusual S-adenosylmethionine synthetase from Campylobacter jejuni.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Transferase
molecule keywords S-adenosylmethionine synthetase
total genus 137
structure length 388
sequence length 399
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2013-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A03
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4le5A02
3UOWA 1RG9A 4NDNA 5T8SA 4KTVA 2YWBA 5A1IA 1MXBA 1O90A 1GPMA 1O92A 4K0BA 3TQIA 2P02A 5H9UA 3TDEA 1O9TA 1XRAA 1MXCA 4ODJA 1P7LA 1MXAA 2YWCA 4KTTA 5A1GA 1O93A 4WS9A 5T8TA 5A19A 3SO4A 1XRCA 4LE5A 2DPLA 3RV2A 3A4IA 1FUGA 4L2ZA 4HPVA 3S82A 4L4QA 1XRBA 2OBVA 3IMLA 1QM4A 4L7IA
chains in the Genus database with same CATH superfamily
5BSUA 4JV5C 4BCAA 3EERA 1MXBA 4DV2C 1PG3A 1HH2P 3AY0A 1O9TA 1XRAA 3TUFA 4DR2C 4IR7A 4GKJC 3AF5A 1XHJA 1PA4A 1UWDA 2E8CA 3I07A 2UUBC 2MM9A 4FUTA 4JI6C 4L7IA 3C5EA 3A9UA 1WF3A 4D57A 5E7QA 5BSWA 4GKKC 1IBMC 3FCCA 2V7BA 3I08A 4DCSA 2YWCA 1MXAA 1V26A 1HNXC 5T8TA 4WS9A 4DV6C 3A4IA 4X64C 4RVNA 4FUQA 4PUIA 3L8CA 2BJOA 5GTDA 2QVXX 2YWBA 5A1IA 5CZXA 3T1YC 2QW0X 4R1LA 4JYAC 2VZEA 2E7GA 3L95X 4B3MC 4RLQA 1IBLC 3DLPX 3GKUA 4PROC 4RM2A 2WD9A 3IMLA 5AE2A 5BSVA 1O90A 1O92A 5FLXD 4ISBA 2P02A 1TH5A 4LF9C 1XNRC 3ETCA 4G36A 1T5HX 1P7LA 3DAYA 3RG2A 4KTTA 5K85A 4TPSB 4DR6C 2D27A 4DR3C 1LCIA 1PG4A 1L2FA 4L4QA 2BH1X 5JRHA 3NI2A 1J5EC 4D4IA 3UOWA 1N36C 1XNQC 3A25A 4I9FA 4R1MA 3TDEA 4D56A 1MD9A 4ODJA 2UUCC 1XMQC 2HJGA 2ONFA 4B3SC 1EGAA 1YJ7A 2Y27A 4DV0C 4DCTA 2ATWA 2PN2A 1K0RA 4I9GA 2Y4OA 4DV3C 4HPVA 4K0KC 1WH9A 2OPLA 3O2EA 4LFAC 4KHPC 2YX1A 2D7VA 4RVOA 1N2FA 2F4VC 3E7XA 5A2QD 2P2QA 1RY2A 5LCIA 1KKGA 4X62C 3LGXA 3SO4A 1ML8A 3KXWA 3RV2A 4LFBC 3VNSA 4L2ZA 3JAMD 4DR5C 4MTNA 1QM4A 5IWAC 4JI1C 4LF4C 3UZ0A 4DV7C 3NYRA 5LMUC 4BSZA 3DHVA 1HNWC 2P20A 1UKKA 4RLFA 5BSTA 2UUAC 1WCJA 2JNVA 3S82A 1I94C 2P2MA 4DV4C 3N2QA 1NY8A 5IFIA 4JI0C 5CZVA 4DV1C 4NXNC 3OTOC 1AMUA 3CW9A 3LAXA 3R44A 2YCBA 4LFCC 4PUGA 1ULTA 3CQ3A 3EQ6A 2UXCC 3R9WA 3A9VA 2QVYX 5KEIA 4RMNA 2D28C 2HHHC 1PU1A 4GS5A 3TR3A 4G1IA 4DR1C 4DUYC 4DR4C 1NYEA 2M5HA 5H9UA 4JM1A 5BR8C 2P2JA 1VLAA 5A1GA 2D1QA 1O93A 4LF5C 3GPCA 2E8FA 2P2BA 4ZLPA 2M5OA 1RG9A 3B7WA 4FTFA 2CY1A 2PT7G 5BSMA 4WV3A 2D1SA 5LMNC 3N54B 3J80D 1XS3A 2UU9C 3CQ1A 2NCLA 4DV5C 4YY3C 5BSRA 4X65C 2ASBA 1XRBA 3A26A 1USPA 2E5LC 4DG9A 3GR0A 4JI4C 2AYAA 5DV9A 4KTVA 1N34C 4BC9A 4BBYA 2CXCA 3PESA 4XX2A 1LQLA 4AQYC 1MXCA 4MH4A 4PHTA 4OX9C 1XMOC 4NOZA 4OXIA 2ZZMA 3VNRA 2XR1A 4OYCA 1VEHA 4LF8C 4JI2C 2P2FA 5KYVA 3R9XA 4NDNA 3LUSA 5ADZA 2KZ0A 3PBKA 2D1TA 1M6XA 1BA3A 4NXMC 3E7WA 2JMPA 1XRCA 5BUSA 3IEUA 2OO4A 4D4GA 5KYTA 2MMAB 4B3TC 2Y4NA 3UEBA 2D1RA 2KDNA 2DHMA 2Z51A 4DG8A 4YHHC 1P4EC 1IB8A 3AF6A 1M6XC 3ETOA 2QVZX 4JI7C 4GXRA 4RM3A 1N33C 3G7SA 1JOSA 2EGTA 5K8FA 1IBKC 1FJGC 3LNOA 1FUGA 3CQ2A 4U5YD 3H2TA 1USPB 1HNZC 3FCEA 4DCUA 3CJEA 1ZB8A 3TQIA 2UXDC 2VSQA 4GXQA 3IEVA 2ZZNA 1MKYA 2CU6A 4B3RC 3IPLA 1MDBA 4LE5A 2DPLA 4G37A 4EATA 3J81D 3CW8X 5IT9D 4DCVA 1QWIA 4DR7C 4IZ6A 5AE3A 4PZPA 4ZJZA 4LF6C 3K6RA 4R0MA 2UXBC 4PUHA 5BUQA 1V60A 3T1HC 5A19A 2ZM6C 4DUZC 2E0GA 4JI3C 2PROA 3VNQA 1ZB9A 3UX3A 3NYQA 4JI8C 4X66C 5AE1A 2OBVA 2E8EA 3PROC 2VQEC 1P4EA 3NPDA 1MDFA 1N32C 5T8SA 2VQFC 4JI5C 1GPMA 2KZFA 2QL8A 4K0BA 4BC7A 3GR1A 2WP0C 2MCQA 1HR0C 5BURA 3LNVA 1V25A 4LF7C 1FLOA 1T5DX 3UX2A 2DYJA 2OPLB
chains in the Genus database with same CATH topology
5BSUA 4JV5C 4BCAA 3EERA 1MXBA 4DV2C 1PG3A 1HH2P 1O9TA 1XRAA 3TUFA 4DR2C 4IR7A 4GKJC 3AF5A 3I07A 1PA4A 2E8CA 2UUBC 4FUTA 4JI6C 4L7IA 3C5EA 3A9UA 1WF3A 4D57A 5E7QA 5BSWA 4GKKC 1IBMC 3FCCA 2V7BA 3I08A 4DCSA 2YWCA 1MXAA 1V26A 1HNXC 5T8TA 4WS9A 4DV6C 3A4IA 4X64C 4RVNA 4FUQA 3L8CA 2BJOA 5GTDA 2QVXX 2YWBA 5A1IA 5CZXA 3T1YC 2QW0X 4R1LA 4JYAC 2VZEA 2E7GA 3L95X 4B3MC 4RLQA 1IBLC 3DLPX 3GKUA 4PROC 4RM2A 2WD9A 3IMLA 5AE2A 5BSVA 1O90A 1O92A 4ISBA 5FLXD 2P02A 4LF9C 1XNRC 3ETCA 4G36A 1T5HX 1P7LA 3DAYA 3RG2A 4KTTA 5K85A 4TPSB 4DR6C 2D27A 4DR3C 1LCIA 1PG4A 1L2FA 4L4QA 2BH1X 5JRHA 3NI2A 1J5EC 4D4IA 3UOWA 1N36C 1XNQC 4I9FA 4R1MA 3TDEA 4D56A 1MD9A 4ODJA 2UUCC 1XMQC 2HJGA 2ONFA 4B3SC 1EGAA 1YJ7A 2Y27A 4DV0C 4DCTA 2ATWA 2PN2A 1K0RA 4I9GA 2Y4OA 4DV3C 4HPVA 4K0KC 1WH9A 2OPLA 4LFAC 4KHPC 2D7VA 4RVOA 1N2FA 2F4VC 3E7XA 5A2QD 2P2QA 1RY2A 1KKGA 4X62C 3LGXA 3SO4A 1ML8A 3KXWA 3RV2A 4LFBC 3VNSA 4L2ZA 3JAMD 4DR5C 4MTNA 1QM4A 5IWAC 4JI1C 4LF4C 3UZ0A 4DV7C 3NYRA 5LMUC 4BSZA 3DHVA 1HNWC 2P20A 1UKKA 4RLFA 5BSTA 2UUAC 3S82A 1I94C 2P2MA 4DV4C 3N2QA 5IFIA 4JI0C 5CZVA 4NXNC 4DV1C 1AMUA 3OTOC 3CW9A 3LAXA 3R44A 2YCBA 4LFCC 1ULTA 3EQ6A 2UXCC 3R9WA 3A9VA 2QVYX 5KEIA 4RMNA 2D28C 2HHHC 4GS5A 4G1IA 4DR1C 4DUYC 4DR4C 1NYEA 5H9UA 4JM1A 5BR8C 2P2JA 1VLAA 5A1GA 2D1QA 1O93A 4LF5C 3GPCA 2E8FA 2P2BA 4ZLPA 1RG9A 3B7WA 4FTFA 2CY1A 2PT7G 5BSMA 4WV3A 2D1SA 5LMNC 3N54B 3J80D 2UU9C 4DV5C 4YY3C 5BSRA 4X65C 2ASBA 1XRBA 1USPA 2E5LC 4DG9A 3GR0A 4JI4C 2AYAA 5DV9A 4KTVA 1N34C 4BC9A 4BBYA 2CXCA 3PESA 4XX2A 1LQLA 4AQYC 1MXCA 4MH4A 4PHTA 4OX9C 1XMOC 4NOZA 4OXIA 3VNRA 2XR1A 4OYCA 4LF8C 4JI2C 2P2FA 5KYVA 3R9XA 4NDNA 3LUSA 5ADZA 3PBKA 2D1TA 1BA3A 4NXMC 3E7WA 2JMPA 1XRCA 5BUSA 3IEUA 2OO4A 4D4GA 5KYTA 4B3TC 2Y4NA 2D1RA 4DG8A 4YHHC 3AF6A 3ETOA 2QVZX 4JI7C 4GXRA 4RM3A 1N33C 3G7SA 1JOSA 2EGTA 5K8FA 1IBKC 1FJGC 1FUGA 4U5YD 3H2TA 1USPB 1HNZC 3FCEA 4DCUA 3CJEA 1ZB8A 3TQIA 2UXDC 2VSQA 4GXQA 3IEVA 1MKYA 4B3RC 3IPLA 1MDBA 4LE5A 2DPLA 4G37A 4EATA 3J81D 3CW8X 5IT9D 4DCVA 1QWIA 4DR7C 4IZ6A 5AE3A 4PZPA 4ZJZA 4LF6C 4R0MA 2UXBC 5BUQA 3T1HC 5A19A 2ZM6C 4DUZC 2E0GA 4JI3C 2PROA 3VNQA 1ZB9A 3NYQA 4JI8C 4X66C 5AE1A 2OBVA 2E8EA 3PROC 2VQEC 3NPDA 1MDFA 1N32C 5T8SA 4JI5C 2VQFC 1GPMA 2KZFA 2QL8A 4K0BA 4BC7A 3GR1A 2WP0C 1HR0C 5BURA 3LNVA 1V25A 4LF7C 1T5DX 2DYJA 2OPLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOW A;  1RG9 A;  4NDN A;  5T8S A;  4KTV A;  2YWB A;  5A1I A;  1MXB A;  1O90 A;  1GPM A;  1O92 A;  4K0B A;  3TQI A;  2P02 A;  5H9U A;  3TDE A;  1O9T A;  1XRA A;  1MXC A;  4ODJ A;  1P7L A;  1MXA A;  2YWC A;  4KTT A;  5A1G A;  1O93 A;  4WS9 A;  5T8T A;  5A19 A;  3SO4 A;  1XRC A;  4LE5 A;  2DPL A;  3RV2 A;  3A4I A;  1FUG A;  4L2Z A;  4HPV A;  3S82 A;  4L4Q A;  1XRB A;  2OBV A;  3IML A;  1QM4 A;  4L7I A; 
#chains in the Genus database with same CATH topology
 5BSU A;  4JV5 C;  4BCA A;  3EER A;  1MXB A;  4DV2 C;  1PG3 A;  1HH2 P;  3AY0 A;  1O9T A;  1XRA A;  3TUF A;  4DR2 C;  4IR7 A;  4GKJ C;  3AF5 A;  1XHJ A;  1PA4 A;  1UWD A;  2E8C A;  3I07 A;  2UUB C;  2MM9 A;  4FUT A;  4JI6 C;  4L7I A;  3C5E A;  3A9U A;  1WF3 A;  4D57 A;  5E7Q A;  5BSW A;  4GKK C;  1IBM C;  3FCC A;  2V7B A;  3I08 A;  4DCS A;  2YWC A;  1MXA A;  1V26 A;  1HNX C;  5T8T A;  4WS9 A;  4DV6 C;  3A4I A;  4X64 C;  4RVN A;  4FUQ A;  4PUI A;  3L8C A;  2BJO A;  5GTD A;  2QVX X;  2YWB A;  5A1I A;  5CZX A;  3T1Y C;  2QW0 X;  4R1L A;  4JYA C;  2VZE A;  2E7G A;  3L95 X;  4B3M C;  4RLQ A;  1IBL C;  3DLP X;  3GKU A;  4PRO C;  4RM2 A;  2WD9 A;  3IML A;  5AE2 A;  5BSV A;  1O90 A;  1O92 A;  5FLX D;  4ISB A;  2P02 A;  1TH5 A;  4LF9 C;  1XNR C;  3ETC A;  4G36 A;  1T5H X;  1P7L A;  3DAY A;  3RG2 A;  4KTT A;  5K85 A;  4TPS B;  4DR6 C;  2D27 A;  4DR3 C;  1LCI A;  1PG4 A;  1L2F A;  4L4Q A;  2BH1 X;  5JRH A;  3NI2 A;  1J5E C;  4D4I A;  3UOW A;  1N36 C;  1XNQ C;  3A25 A;  4I9F A;  4R1M A;  3TDE A;  4D56 A;  1MD9 A;  4ODJ A;  2UUC C;  1XMQ C;  2HJG A;  2ONF A;  4B3S C;  1EGA A;  1YJ7 A;  2Y27 A;  4DV0 C;  4DCT A;  2ATW A;  2PN2 A;  1K0R A;  4I9G A;  2Y4O A;  4DV3 C;  4HPV A;  4K0K C;  1WH9 A;  2OPL A;  3O2E A;  4LFA C;  4KHP C;  2YX1 A;  2D7V A;  4RVO A;  1N2F A;  2F4V C;  3E7X A;  5A2Q D;  2P2Q A;  1RY2 A;  5LCI A;  1KKG A;  4X62 C;  3LGX A;  3SO4 A;  1ML8 A;  3KXW A;  3RV2 A;  4LFB C;  3VNS A;  4L2Z A;  3JAM D;  4DR5 C;  4MTN A;  1QM4 A;  5IWA C;  4JI1 C;  4LF4 C;  3UZ0 A;  4DV7 C;  3NYR A;  5LMU C;  4BSZ A;  3DHV A;  1HNW C;  2P20 A;  1UKK A;  4RLF A;  5BST A;  2UUA C;  1WCJ A;  2JNV A;  3S82 A;  1I94 C;  2P2M A;  4DV4 C;  3N2Q A;  1NY8 A;  5IFI A;  4JI0 C;  5CZV A;  4DV1 C;  4NXN C;  3OTO C;  1AMU A;  3CW9 A;  3LAX A;  3R44 A;  2YCB A;  4LFC C;  4PUG A;  1ULT A;  3CQ3 A;  3EQ6 A;  2UXC C;  3R9W A;  3A9V A;  2QVY X;  5KEI A;  4RMN A;  2D28 C;  2HHH C;  1PU1 A;  4GS5 A;  3TR3 A;  4G1I A;  4DR1 C;  4DUY C;  4DR4 C;  1NYE A;  2M5H A;  5H9U A;  4JM1 A;  5BR8 C;  2P2J A;  1VLA A;  5A1G A;  2D1Q A;  1O93 A;  4LF5 C;  3GPC A;  2E8F A;  2P2B A;  4ZLP A;  2M5O A;  1RG9 A;  3B7W A;  4FTF A;  2CY1 A;  2PT7 G;  5BSM A;  4WV3 A;  2D1S A;  5LMN C;  3N54 B;  3J80 D;  1XS3 A;  2UU9 C;  3CQ1 A;  2NCL A;  4DV5 C;  4YY3 C;  5BSR A;  4X65 C;  2ASB A;  1XRB A;  3A26 A;  1USP A;  2E5L C;  4DG9 A;  3GR0 A;  4JI4 C;  2AYA A;  5DV9 A;  4KTV A;  1N34 C;  4BC9 A;  4BBY A;  2CXC A;  3PES A;  4XX2 A;  1LQL A;  4AQY C;  1MXC A;  4MH4 A;  4PHT A;  4OX9 C;  1XMO C;  4NOZ A;  4OXI A;  2ZZM A;  3VNR A;  2XR1 A;  4OYC A;  1VEH A;  4LF8 C;  4JI2 C;  2P2F A;  5KYV A;  3R9X A;  4NDN A;  3LUS A;  5ADZ A;  2KZ0 A;  3PBK A;  2D1T A;  1M6X A;  1BA3 A;  4NXM C;  3E7W A;  2JMP A;  1XRC A;  5BUS A;  3IEU A;  2OO4 A;  4D4G A;  5KYT A;  2MMA B;  4B3T C;  2Y4N A;  3UEB A;  2D1R A;  2KDN A;  2DHM A;  2Z51 A;  4DG8 A;  4YHH C;  1P4E C;  1IB8 A;  3AF6 A;  1M6X C;  3ETO A;  2QVZ X;  4JI7 C;  4GXR A;  4RM3 A;  1N33 C;  3G7S A;  1JOS A;  2EGT A;  5K8F A;  1IBK C;  1FJG C;  3LNO A;  1FUG A;  3CQ2 A;  4U5Y D;  3H2T A;  1USP B;  1HNZ C;  3FCE A;  4DCU A;  3CJE A;  1ZB8 A;  3TQI A;  2UXD C;  2VSQ A;  4GXQ A;  3IEV A;  2ZZN A;  1MKY A;  2CU6 A;  4B3R C;  3IPL A;  1MDB A;  4LE5 A;  2DPL A;  4G37 A;  4EAT A;  3J81 D;  3CW8 X;  5IT9 D;  4DCV A;  1QWI A;  4DR7 C;  4IZ6 A;  5AE3 A;  4PZP A;  4ZJZ A;  4LF6 C;  3K6R A;  4R0M A;  2UXB C;  4PUH A;  5BUQ A;  1V60 A;  3T1H C;  5A19 A;  2ZM6 C;  4DUZ C;  2E0G A;  4JI3 C;  2PRO A;  3VNQ A;  1ZB9 A;  3UX3 A;  3NYQ A;  4JI8 C;  4X66 C;  5AE1 A;  2OBV A;  2E8E A;  3PRO C;  2VQE C;  1P4E A;  3NPD A;  1MDF A;  1N32 C;  5T8S A;  2VQF C;  4JI5 C;  1GPM A;  2KZF A;  2QL8 A;  4K0B A;  4BC7 A;  3GR1 A;  2WP0 C;  2MCQ A;  1HR0 C;  5BUR A;  3LNV A;  1V25 A;  4LF7 C;  1FLO A;  1T5D X;  3UX2 A;  2DYJ A;  2OPL B; 
#chains in the Genus database with same CATH homology
 5BSU A;  4JV5 C;  4BCA A;  3EER A;  1MXB A;  4DV2 C;  1PG3 A;  1HH2 P;  1O9T A;  1XRA A;  3TUF A;  4DR2 C;  4IR7 A;  4GKJ C;  3AF5 A;  3I07 A;  1PA4 A;  2E8C A;  2UUB C;  4FUT A;  4JI6 C;  4L7I A;  3C5E A;  3A9U A;  1WF3 A;  4D57 A;  5E7Q A;  5BSW A;  4GKK C;  1IBM C;  3FCC A;  2V7B A;  3I08 A;  4DCS A;  2YWC A;  1MXA A;  1V26 A;  1HNX C;  5T8T A;  4WS9 A;  4DV6 C;  3A4I A;  4X64 C;  4RVN A;  4FUQ A;  3L8C A;  2BJO A;  5GTD A;  2QVX X;  2YWB A;  5A1I A;  5CZX A;  3T1Y C;  2QW0 X;  4R1L A;  4JYA C;  2VZE A;  2E7G A;  3L95 X;  4B3M C;  4RLQ A;  1IBL C;  3DLP X;  3GKU A;  4PRO C;  4RM2 A;  2WD9 A;  3IML A;  5AE2 A;  5BSV A;  1O90 A;  1O92 A;  4ISB A;  5FLX D;  2P02 A;  4LF9 C;  1XNR C;  3ETC A;  4G36 A;  1T5H X;  1P7L A;  3DAY A;  3RG2 A;  4KTT A;  5K85 A;  4TPS B;  4DR6 C;  2D27 A;  4DR3 C;  1LCI A;  1PG4 A;  1L2F A;  4L4Q A;  2BH1 X;  5JRH A;  3NI2 A;  1J5E C;  4D4I A;  3UOW A;  1N36 C;  1XNQ C;  4I9F A;  4R1M A;  3TDE A;  4D56 A;  1MD9 A;  4ODJ A;  2UUC C;  1XMQ C;  2HJG A;  2ONF A;  4B3S C;  1EGA A;  1YJ7 A;  2Y27 A;  4DV0 C;  4DCT A;  2ATW A;  2PN2 A;  1K0R A;  4I9G A;  2Y4O A;  4DV3 C;  4HPV A;  4K0K C;  1WH9 A;  2OPL A;  4LFA C;  4KHP C;  2D7V A;  4RVO A;  1N2F A;  2F4V C;  3E7X A;  5A2Q D;  2P2Q A;  1RY2 A;  1KKG A;  4X62 C;  3LGX A;  3SO4 A;  1ML8 A;  3KXW A;  3RV2 A;  4LFB C;  3VNS A;  4L2Z A;  3JAM D;  4DR5 C;  4MTN A;  1QM4 A;  5IWA C;  4JI1 C;  4LF4 C;  3UZ0 A;  4DV7 C;  3NYR A;  5LMU C;  4BSZ A;  3DHV A;  1HNW C;  2P20 A;  1UKK A;  4RLF A;  5BST A;  2UUA C;  3S82 A;  1I94 C;  2P2M A;  4DV4 C;  3N2Q A;  5IFI A;  4JI0 C;  5CZV A;  4NXN C;  4DV1 C;  1AMU A;  3OTO C;  3CW9 A;  3LAX A;  3R44 A;  2YCB A;  4LFC C;  1ULT A;  3EQ6 A;  2UXC C;  3R9W A;  3A9V A;  2QVY X;  5KEI A;  4RMN A;  2D28 C;  2HHH C;  4GS5 A;  4G1I A;  4DR1 C;  4DUY C;  4DR4 C;  1NYE A;  5H9U A;  4JM1 A;  5BR8 C;  2P2J A;  1VLA A;  5A1G A;  2D1Q A;  1O93 A;  4LF5 C;  3GPC A;  2E8F A;  2P2B A;  4ZLP A;  1RG9 A;  3B7W A;  4FTF A;  2CY1 A;  2PT7 G;  5BSM A;  4WV3 A;  2D1S A;  5LMN C;  3N54 B;  3J80 D;  2UU9 C;  4DV5 C;  4YY3 C;  5BSR A;  4X65 C;  2ASB A;  1XRB A;  1USP A;  2E5L C;  4DG9 A;  3GR0 A;  4JI4 C;  2AYA A;  5DV9 A;  4KTV A;  1N34 C;  4BC9 A;  4BBY A;  2CXC A;  3PES A;  4XX2 A;  1LQL A;  4AQY C;  1MXC A;  4MH4 A;  4PHT A;  4OX9 C;  1XMO C;  4NOZ A;  4OXI A;  3VNR A;  2XR1 A;  4OYC A;  4LF8 C;  4JI2 C;  2P2F A;  5KYV A;  3R9X A;  4NDN A;  3LUS A;  5ADZ A;  3PBK A;  2D1T A;  1BA3 A;  4NXM C;  3E7W A;  2JMP A;  1XRC A;  5BUS A;  3IEU A;  2OO4 A;  4D4G A;  5KYT A;  4B3T C;  2Y4N A;  2D1R A;  4DG8 A;  4YHH C;  3AF6 A;  3ETO A;  2QVZ X;  4JI7 C;  4GXR A;  4RM3 A;  1N33 C;  3G7S A;  1JOS A;  2EGT A;  5K8F A;  1IBK C;  1FJG C;  1FUG A;  4U5Y D;  3H2T A;  1USP B;  1HNZ C;  3FCE A;  4DCU A;  3CJE A;  1ZB8 A;  3TQI A;  2UXD C;  2VSQ A;  4GXQ A;  3IEV A;  1MKY A;  4B3R C;  3IPL A;  1MDB A;  4LE5 A;  2DPL A;  4G37 A;  4EAT A;  3J81 D;  3CW8 X;  5IT9 D;  4DCV A;  1QWI A;  4DR7 C;  4IZ6 A;  5AE3 A;  4PZP A;  4ZJZ A;  4LF6 C;  4R0M A;  2UXB C;  5BUQ A;  3T1H C;  5A19 A;  2ZM6 C;  4DUZ C;  2E0G A;  4JI3 C;  2PRO A;  3VNQ A;  1ZB9 A;  3NYQ A;  4JI8 C;  4X66 C;  5AE1 A;  2OBV A;  2E8E A;  3PRO C;  2VQE C;  3NPD A;  1MDF A;  1N32 C;  5T8S A;  4JI5 C;  2VQF C;  1GPM A;  2KZF A;  2QL8 A;  4K0B A;  4BC7 A;  3GR1 A;  2WP0 C;  1HR0 C;  5BUR A;  3LNV A;  1V25 A;  4LF7 C;  1T5D X;  2DYJ A;  2OPL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...