5T8SA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
388
structure length
388
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
total genus 137
structure length 388
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA03
1P7LA 3IMLA 4L7IA 1MXAA 1O92A 4HPVA 5A19A 1O90A 3S82A 5A1IA 4L4QA 3A4IA 2DPLA 1XRAA 5T8SA 1FUGA 3SO4A 5A1GA 3TQIA 2YWCA 1O9TA 4L2ZA 4NDNA 2P02A 4KTTA 1MXBA 1XRCA 1XRBA 4WS9A 3RV2A 3UOWA 1GPMA 4LE5A 4KTVA 2YWBA 1RG9A 4ODJA 2OBVA 4K0BA 5H9UA 3TDEA 1O93A 5T8TA 1QM4A 1MXCA
chains in the Genus database with same CATH superfamily
4TPSB 3PROC 1MXAA 4MH4A 1ML8A 4HPVA 5JRHA 3PESA 1MKYA 2D1RA 5T8SA 3IPLA 4ZLPA 2ZZMA 3IEVA 2HJGA 1KKGA 4LF6C 5LMNC 2OPLB 2ZM6C 4LF7C 1WH9A 1P4EC 4DG8A 3J80D 5E7QA 5KYTA 4JM1A 2VQEC 4JV5C 4L4QA 2ATWA 3A4IA 4JI1C 1FUGA 4NDNA 2UXCC 1PG3A 2DYJA 4D57A 5BSUA 4B3SC 3VNQA 4LF4C 5BR8C 2NCLA 2PROA 5T8TA 4LF9C 4JI0C 3UZ0A 5AE2A 2PT7G 3N54B 3ETCA 3K6RA 1LQLA 3JAMD 3E7WA 2P2BA 2YCBA 3LNVA 2YWCA 4B3MC 5LMUC 2P2FA 3CW9A 4DV3C 2DHMA 2UXDC 4DCVA 1M6XC 1AMUA 5BSRA 3B7WA 3E7XA 3NYQA 4G1IA 2UUCC 2CXCA 3VNRA 4DV1C 3S82A 1USPA 2P2JA 3LAXA 3J81D 1HNXC 2AYAA 2M5HA 5AE3A 2QL8A 2EGTA 1N32C 4RM2A 2Y4OA 1BA3A 2D7VA 4PZPA 4NXMC 5BURA 2OBVA 1J5EC 1IBKC 3A9UA 3NPDA 4WV3A 4LFAC 4LFBC 2Y4NA 1O90A 3DLPX 5K85A 4BBYA 1FLOA 1V26A 1YJ7A 3VNSA 1XNQC 4DR6C 4ISBA 2D1SA 3T1HC 4X62C 1XHJA 5BSVA 1V25A 5K8FA 4LFCC 3LNOA 2KZ0A 2ASBA 1MXCA 3CQ3A 3AF6A 5IWAC 2P20A 3FCEA 5A1IA 4FUTA 2DPLA 4U5YD 1PA4A 1T5DX 1XRCA 1HR0C 1GPMA 1K0RA 3GR0A 2QVYX 2Y27A 3LGXA 4IR7A 2WD9A 4JYAC 2OO4A 1FJGC 2WP0C 4PUGA 4D4GA 5AE1A 1N34C 3DHVA 2MCQA 2E8EA 4MTNA 4PUIA 3NYRA 1IB8A 5KEIA 4GXQA 4PROC 4DCTA 3TUFA 1HH2P 2VQFC 2P2QA 4K0BA 4DV0C 3TDEA 1VEHA 3H2TA 4L7IA 2QVXX 2F4VC 4GKJC 2D28C 4RVOA 2UUBC 2E0GA 2QW0X 1PU1A 3A25A 4I9GA 5GTDA 1N2FA 3UX3A 3RV2A 4DR3C 3DAYA 1T5HX 4PUHA 4ODJA 1O93A 4RMNA 4DG9A 1P7LA 4DR4C 1MDFA 2JMPA 3KXWA 2E8CA 4DUYC 2E5LC 2CY1A 5BSWA 2VZEA 4BSZA 4EATA 2VSQA 4X65C 3R9XA 4B3RC 4JI8C 2CU6A 5FLXD 2MM9A 5CZXA 4X64C 3CJEA 2QVZX 2YWBA 2E7GA 3GKUA 3I07A 3PBKA 1M6XA 1QM4A 2YX1A 2KZFA 5BUQA 4NOZA 4OX9C 1QWIA 2JNVA 1ZB8A 3AF5A 3O2EA 5IT9D 3G7SA 3SO4A 4RM3A 3TR3A 4R0MA 4L2ZA 1ZB9A 1MXBA 1XRBA 2BJOA 5IFIA 4PHTA 4GS5A 4DUZC 3L95X 4FTFA 3A9VA 1L2FA 1UKKA 4G37A 4BCAA 4YY3C 1I94C 1NYEA 4DR1C 3NI2A 1P4EA 4RLQA 1O9TA 4DR7C 1WCJA 4WS9A 3LUSA 4LE5A 4BC9A 4KTVA 1TH5A 5BSTA 3CQ1A 4X66C 4OXIA 1O92A 3FCCA 4DR5C 3GR1A 3EQ6A 4YHHC 3C5EA 1HNZC 4R1LA 2M5OA 5ADZA 2HHHC 1MD9A 2UU9C 4DV7C 4DCSA 1N36C 1XNRC 1RG9A 4OYCA 2D1QA 4JI7C 3ETOA 4JI3C 4XX2A 4K0KC 1UWDA 4DV5C 4B3TC 5A2QD 3EERA 4JI4C 5A1GA 4DV4C 3L8CA 4D56A 5KYVA 2BH1X 3UOWA 2V7BA 3AY0A 2ZZNA 2Z51A 1MDBA 2ONFA 1VLAA 5H9UA 4AQYC 4DCUA 3RG2A 3OTOC 2E8FA 5A19A 4GKKC 3N2QA 4D4IA 4GXRA 2OPLA 1LCIA 3A26A 4NXNC 4JI5C 2MMAB 4ZJZA 1V60A 2UXBC 5BUSA 1IBLC 4DV2C 4KHPC 1XMQC 1WF3A 5DV9A 5LCIA 4LF8C 1IBMC 4DR2C 4FUQA 2UUAC 1XRAA 2KDNA 3GPCA 4DV6C 5CZVA 1HNWC 2P02A 4KTTA 3T1YC 2P2MA 3UEBA 4IZ6A 3R9WA 2D1TA 1XMOC 3IMLA 4G36A 4RLFA 2D27A 1JOSA 1PG4A 4JI6C 2XR1A 3I08A 1EGAA 1ULTA 2PN2A 4LF5C 4I9FA 1N33C 3TQIA 1NY8A 3UX2A 4RVNA 1RY2A 3CQ2A 1XS3A 3IEUA 5BSMA 3CW8X 4BC7A 3R44A 1USPB 4JI2C 4R1MA
chains in the Genus database with same CATH topology
4TPSB 3PROC 1MXAA 4MH4A 1ML8A 4HPVA 5JRHA 3PESA 1MKYA 2D1RA 5T8SA 3IPLA 4ZLPA 3IEVA 2HJGA 1KKGA 4LF6C 5LMNC 2OPLB 2ZM6C 4LF7C 1WH9A 4DG8A 3J80D 5E7QA 5KYTA 4JM1A 2VQEC 4JV5C 4L4QA 2ATWA 3A4IA 4JI1C 1FUGA 4NDNA 2UXCC 1PG3A 2DYJA 4D57A 5BSUA 4B3SC 3VNQA 4LF4C 5BR8C 2PROA 5T8TA 4LF9C 4JI0C 3UZ0A 5AE2A 2PT7G 3N54B 3ETCA 1LQLA 3JAMD 3E7WA 2P2BA 2YCBA 3LNVA 2YWCA 4B3MC 5LMUC 2P2FA 3CW9A 4DV3C 2UXDC 4DCVA 1AMUA 5BSRA 3B7WA 3E7XA 3NYQA 4G1IA 2UUCC 2CXCA 3VNRA 4DV1C 3S82A 1USPA 2P2JA 3LAXA 3J81D 1HNXC 2AYAA 5AE3A 2QL8A 2EGTA 1N32C 4RM2A 2Y4OA 1BA3A 2D7VA 4PZPA 4NXMC 5BURA 2OBVA 1J5EC 1IBKC 3A9UA 3NPDA 4WV3A 4LFAC 4LFBC 2Y4NA 1O90A 3DLPX 5K85A 4BBYA 1V26A 1YJ7A 3VNSA 1XNQC 4DR6C 4ISBA 2D1SA 3T1HC 4X62C 5BSVA 1V25A 5K8FA 4LFCC 2ASBA 1MXCA 3AF6A 5IWAC 2P20A 3FCEA 5A1IA 4FUTA 2DPLA 4U5YD 1PA4A 1T5DX 1XRCA 1HR0C 1GPMA 1K0RA 3GR0A 2QVYX 2Y27A 3LGXA 4IR7A 2WD9A 4JYAC 2OO4A 1FJGC 2WP0C 4D4GA 5AE1A 1N34C 3DHVA 2E8EA 4MTNA 3NYRA 5KEIA 4GXQA 4PROC 4DCTA 3TUFA 1HH2P 2VQFC 2P2QA 4K0BA 4DV0C 3TDEA 3H2TA 4L7IA 2QVXX 2F4VC 4GKJC 2D28C 4RVOA 2UUBC 2E0GA 2QW0X 4I9GA 5GTDA 1N2FA 3RV2A 4DR3C 3DAYA 1T5HX 4ODJA 1O93A 4RMNA 4DG9A 1P7LA 4DR4C 1MDFA 2JMPA 3KXWA 2E8CA 4DUYC 2E5LC 2CY1A 5BSWA 2VZEA 4BSZA 4EATA 2VSQA 4X65C 3R9XA 4B3RC 4JI8C 5FLXD 5CZXA 4X64C 3CJEA 2QVZX 2YWBA 2E7GA 3GKUA 3I07A 3PBKA 1QM4A 2KZFA 5BUQA 4NOZA 4OX9C 1QWIA 1ZB8A 3AF5A 5IT9D 3G7SA 3SO4A 4RM3A 4R0MA 4L2ZA 1ZB9A 1MXBA 1XRBA 2BJOA 5IFIA 4PHTA 4GS5A 4DUZC 3L95X 4FTFA 3A9VA 1L2FA 1UKKA 4G37A 4BCAA 4YY3C 1I94C 1NYEA 4DR1C 3NI2A 4RLQA 1O9TA 4DR7C 4WS9A 3LUSA 4LE5A 4BC9A 4KTVA 5BSTA 4X66C 4OXIA 1O92A 3FCCA 4DR5C 3GR1A 3EQ6A 4YHHC 3C5EA 1HNZC 4R1LA 5ADZA 2HHHC 1MD9A 2UU9C 4DV7C 4DCSA 1N36C 1XNRC 1RG9A 4OYCA 2D1QA 4JI7C 3ETOA 4JI3C 4XX2A 4K0KC 4DV5C 4B3TC 5A2QD 3EERA 4JI4C 5A1GA 4DV4C 3L8CA 4D56A 5KYVA 2BH1X 3UOWA 2V7BA 1MDBA 2ONFA 1VLAA 5H9UA 4AQYC 4DCUA 3RG2A 3OTOC 2E8FA 5A19A 4GKKC 3N2QA 4D4IA 4GXRA 2OPLA 1LCIA 4NXNC 4JI5C 4ZJZA 2UXBC 5BUSA 1IBLC 4DV2C 4KHPC 1XMQC 1WF3A 5DV9A 4LF8C 1IBMC 4DR2C 4FUQA 2UUAC 1XRAA 3GPCA 4DV6C 5CZVA 1HNWC 2P02A 4KTTA 3T1YC 2P2MA 4IZ6A 3R9WA 2D1TA 1XMOC 3IMLA 4G36A 4RLFA 2D27A 1JOSA 1PG4A 4JI6C 2XR1A 3I08A 1EGAA 1ULTA 2PN2A 4LF5C 4I9FA 1N33C 3TQIA 4RVNA 1RY2A 3IEUA 5BSMA 3CW8X 4BC7A 3R44A 1USPB 4JI2C 4R1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7L A;  3IML A;  4L7I A;  1MXA A;  1O92 A;  4HPV A;  5A19 A;  1O90 A;  3S82 A;  5A1I A;  4L4Q A;  3A4I A;  2DPL A;  1XRA A;  5T8S A;  1FUG A;  3SO4 A;  5A1G A;  3TQI A;  2YWC A;  1O9T A;  4L2Z A;  4NDN A;  2P02 A;  4KTT A;  1MXB A;  1XRC A;  1XRB A;  4WS9 A;  3RV2 A;  3UOW A;  1GPM A;  4LE5 A;  4KTV A;  2YWB A;  1RG9 A;  4ODJ A;  2OBV A;  4K0B A;  5H9U A;  3TDE A;  1O93 A;  5T8T A;  1QM4 A;  1MXC A; 
#chains in the Genus database with same CATH topology
 4TPS B;  3PRO C;  1MXA A;  4MH4 A;  1ML8 A;  4HPV A;  5JRH A;  3PES A;  1MKY A;  2D1R A;  5T8S A;  3IPL A;  4ZLP A;  2ZZM A;  3IEV A;  2HJG A;  1KKG A;  4LF6 C;  5LMN C;  2OPL B;  2ZM6 C;  4LF7 C;  1WH9 A;  1P4E C;  4DG8 A;  3J80 D;  5E7Q A;  5KYT A;  4JM1 A;  2VQE C;  4JV5 C;  4L4Q A;  2ATW A;  3A4I A;  4JI1 C;  1FUG A;  4NDN A;  2UXC C;  1PG3 A;  2DYJ A;  4D57 A;  5BSU A;  4B3S C;  3VNQ A;  4LF4 C;  5BR8 C;  2NCL A;  2PRO A;  5T8T A;  4LF9 C;  4JI0 C;  3UZ0 A;  5AE2 A;  2PT7 G;  3N54 B;  3ETC A;  3K6R A;  1LQL A;  3JAM D;  3E7W A;  2P2B A;  2YCB A;  3LNV A;  2YWC A;  4B3M C;  5LMU C;  2P2F A;  3CW9 A;  4DV3 C;  2DHM A;  2UXD C;  4DCV A;  1M6X C;  1AMU A;  5BSR A;  3B7W A;  3E7X A;  3NYQ A;  4G1I A;  2UUC C;  2CXC A;  3VNR A;  4DV1 C;  3S82 A;  1USP A;  2P2J A;  3LAX A;  3J81 D;  1HNX C;  2AYA A;  2M5H A;  5AE3 A;  2QL8 A;  2EGT A;  1N32 C;  4RM2 A;  2Y4O A;  1BA3 A;  2D7V A;  4PZP A;  4NXM C;  5BUR A;  2OBV A;  1J5E C;  1IBK C;  3A9U A;  3NPD A;  4WV3 A;  4LFA C;  4LFB C;  2Y4N A;  1O90 A;  3DLP X;  5K85 A;  4BBY A;  1FLO A;  1V26 A;  1YJ7 A;  3VNS A;  1XNQ C;  4DR6 C;  4ISB A;  2D1S A;  3T1H C;  4X62 C;  1XHJ A;  5BSV A;  1V25 A;  5K8F A;  4LFC C;  3LNO A;  2KZ0 A;  2ASB A;  1MXC A;  3CQ3 A;  3AF6 A;  5IWA C;  2P20 A;  3FCE A;  5A1I A;  4FUT A;  2DPL A;  4U5Y D;  1PA4 A;  1T5D X;  1XRC A;  1HR0 C;  1GPM A;  1K0R A;  3GR0 A;  2QVY X;  2Y27 A;  3LGX A;  4IR7 A;  2WD9 A;  4JYA C;  2OO4 A;  1FJG C;  2WP0 C;  4PUG A;  4D4G A;  5AE1 A;  1N34 C;  3DHV A;  2MCQ A;  2E8E A;  4MTN A;  4PUI A;  3NYR A;  1IB8 A;  5KEI A;  4GXQ A;  4PRO C;  4DCT A;  3TUF A;  1HH2 P;  2VQF C;  2P2Q A;  4K0B A;  4DV0 C;  3TDE A;  1VEH A;  3H2T A;  4L7I A;  2QVX X;  2F4V C;  4GKJ C;  2D28 C;  4RVO A;  2UUB C;  2E0G A;  2QW0 X;  1PU1 A;  3A25 A;  4I9G A;  5GTD A;  1N2F A;  3UX3 A;  3RV2 A;  4DR3 C;  3DAY A;  1T5H X;  4PUH A;  4ODJ A;  1O93 A;  4RMN A;  4DG9 A;  1P7L A;  4DR4 C;  1MDF A;  2JMP A;  3KXW A;  2E8C A;  4DUY C;  2E5L C;  2CY1 A;  5BSW A;  2VZE A;  4BSZ A;  4EAT A;  2VSQ A;  4X65 C;  3R9X A;  4B3R C;  4JI8 C;  2CU6 A;  5FLX D;  2MM9 A;  5CZX A;  4X64 C;  3CJE A;  2QVZ X;  2YWB A;  2E7G A;  3GKU A;  3I07 A;  3PBK A;  1M6X A;  1QM4 A;  2YX1 A;  2KZF A;  5BUQ A;  4NOZ A;  4OX9 C;  1QWI A;  2JNV A;  1ZB8 A;  3AF5 A;  3O2E A;  5IT9 D;  3G7S A;  3SO4 A;  4RM3 A;  3TR3 A;  4R0M A;  4L2Z A;  1ZB9 A;  1MXB A;  1XRB A;  2BJO A;  5IFI A;  4PHT A;  4GS5 A;  4DUZ C;  3L95 X;  4FTF A;  3A9V A;  1L2F A;  1UKK A;  4G37 A;  4BCA A;  4YY3 C;  1I94 C;  1NYE A;  4DR1 C;  3NI2 A;  1P4E A;  4RLQ A;  1O9T A;  4DR7 C;  1WCJ A;  4WS9 A;  3LUS A;  4LE5 A;  4BC9 A;  4KTV A;  1TH5 A;  5BST A;  3CQ1 A;  4X66 C;  4OXI A;  1O92 A;  3FCC A;  4DR5 C;  3GR1 A;  3EQ6 A;  4YHH C;  3C5E A;  1HNZ C;  4R1L A;  2M5O A;  5ADZ A;  2HHH C;  1MD9 A;  2UU9 C;  4DV7 C;  4DCS A;  1N36 C;  1XNR C;  1RG9 A;  4OYC A;  2D1Q A;  4JI7 C;  3ETO A;  4JI3 C;  4XX2 A;  4K0K C;  1UWD A;  4DV5 C;  4B3T C;  5A2Q D;  3EER A;  4JI4 C;  5A1G A;  4DV4 C;  3L8C A;  4D56 A;  5KYV A;  2BH1 X;  3UOW A;  2V7B A;  3AY0 A;  2ZZN A;  2Z51 A;  1MDB A;  2ONF A;  1VLA A;  5H9U A;  4AQY C;  4DCU A;  3RG2 A;  3OTO C;  2E8F A;  5A19 A;  4GKK C;  3N2Q A;  4D4I A;  4GXR A;  2OPL A;  1LCI A;  3A26 A;  4NXN C;  4JI5 C;  2MMA B;  4ZJZ A;  1V60 A;  2UXB C;  5BUS A;  1IBL C;  4DV2 C;  4KHP C;  1XMQ C;  1WF3 A;  5DV9 A;  5LCI A;  4LF8 C;  1IBM C;  4DR2 C;  4FUQ A;  2UUA C;  1XRA A;  2KDN A;  3GPC A;  4DV6 C;  5CZV A;  1HNW C;  2P02 A;  4KTT A;  3T1Y C;  2P2M A;  3UEB A;  4IZ6 A;  3R9W A;  2D1T A;  1XMO C;  3IML A;  4G36 A;  4RLF A;  2D27 A;  1JOS A;  1PG4 A;  4JI6 C;  2XR1 A;  3I08 A;  1EGA A;  1ULT A;  2PN2 A;  4LF5 C;  4I9F A;  1N33 C;  3TQI A;  1NY8 A;  3UX2 A;  4RVN A;  1RY2 A;  3CQ2 A;  1XS3 A;  3IEU A;  5BSM A;  3CW8 X;  4BC7 A;  3R44 A;  1USP B;  4JI2 C;  4R1M A; 
#chains in the Genus database with same CATH homology
 4TPS B;  3PRO C;  1MXA A;  4MH4 A;  1ML8 A;  4HPV A;  5JRH A;  3PES A;  1MKY A;  2D1R A;  5T8S A;  3IPL A;  4ZLP A;  3IEV A;  2HJG A;  1KKG A;  4LF6 C;  5LMN C;  2OPL B;  2ZM6 C;  4LF7 C;  1WH9 A;  4DG8 A;  3J80 D;  5E7Q A;  5KYT A;  4JM1 A;  2VQE C;  4JV5 C;  4L4Q A;  2ATW A;  3A4I A;  4JI1 C;  1FUG A;  4NDN A;  2UXC C;  1PG3 A;  2DYJ A;  4D57 A;  5BSU A;  4B3S C;  3VNQ A;  4LF4 C;  5BR8 C;  2PRO A;  5T8T A;  4LF9 C;  4JI0 C;  3UZ0 A;  5AE2 A;  2PT7 G;  3N54 B;  3ETC A;  1LQL A;  3JAM D;  3E7W A;  2P2B A;  2YCB A;  3LNV A;  2YWC A;  4B3M C;  5LMU C;  2P2F A;  3CW9 A;  4DV3 C;  2UXD C;  4DCV A;  1AMU A;  5BSR A;  3B7W A;  3E7X A;  3NYQ A;  4G1I A;  2UUC C;  2CXC A;  3VNR A;  4DV1 C;  3S82 A;  1USP A;  2P2J A;  3LAX A;  3J81 D;  1HNX C;  2AYA A;  5AE3 A;  2QL8 A;  2EGT A;  1N32 C;  4RM2 A;  2Y4O A;  1BA3 A;  2D7V A;  4PZP A;  4NXM C;  5BUR A;  2OBV A;  1J5E C;  1IBK C;  3A9U A;  3NPD A;  4WV3 A;  4LFA C;  4LFB C;  2Y4N A;  1O90 A;  3DLP X;  5K85 A;  4BBY A;  1V26 A;  1YJ7 A;  3VNS A;  1XNQ C;  4DR6 C;  4ISB A;  2D1S A;  3T1H C;  4X62 C;  5BSV A;  1V25 A;  5K8F A;  4LFC C;  2ASB A;  1MXC A;  3AF6 A;  5IWA C;  2P20 A;  3FCE A;  5A1I A;  4FUT A;  2DPL A;  4U5Y D;  1PA4 A;  1T5D X;  1XRC A;  1HR0 C;  1GPM A;  1K0R A;  3GR0 A;  2QVY X;  2Y27 A;  3LGX A;  4IR7 A;  2WD9 A;  4JYA C;  2OO4 A;  1FJG C;  2WP0 C;  4D4G A;  5AE1 A;  1N34 C;  3DHV A;  2E8E A;  4MTN A;  3NYR A;  5KEI A;  4GXQ A;  4PRO C;  4DCT A;  3TUF A;  1HH2 P;  2VQF C;  2P2Q A;  4K0B A;  4DV0 C;  3TDE A;  3H2T A;  4L7I A;  2QVX X;  2F4V C;  4GKJ C;  2D28 C;  4RVO A;  2UUB C;  2E0G A;  2QW0 X;  4I9G A;  5GTD A;  1N2F A;  3RV2 A;  4DR3 C;  3DAY A;  1T5H X;  4ODJ A;  1O93 A;  4RMN A;  4DG9 A;  1P7L A;  4DR4 C;  1MDF A;  2JMP A;  3KXW A;  2E8C A;  4DUY C;  2E5L C;  2CY1 A;  5BSW A;  2VZE A;  4BSZ A;  4EAT A;  2VSQ A;  4X65 C;  3R9X A;  4B3R C;  4JI8 C;  5FLX D;  5CZX A;  4X64 C;  3CJE A;  2QVZ X;  2YWB A;  2E7G A;  3GKU A;  3I07 A;  3PBK A;  1QM4 A;  2KZF A;  5BUQ A;  4NOZ A;  4OX9 C;  1QWI A;  1ZB8 A;  3AF5 A;  5IT9 D;  3G7S A;  3SO4 A;  4RM3 A;  4R0M A;  4L2Z A;  1ZB9 A;  1MXB A;  1XRB A;  2BJO A;  5IFI A;  4PHT A;  4GS5 A;  4DUZ C;  3L95 X;  4FTF A;  3A9V A;  1L2F A;  1UKK A;  4G37 A;  4BCA A;  4YY3 C;  1I94 C;  1NYE A;  4DR1 C;  3NI2 A;  4RLQ A;  1O9T A;  4DR7 C;  4WS9 A;  3LUS A;  4LE5 A;  4BC9 A;  4KTV A;  5BST A;  4X66 C;  4OXI A;  1O92 A;  3FCC A;  4DR5 C;  3GR1 A;  3EQ6 A;  4YHH C;  3C5E A;  1HNZ C;  4R1L A;  5ADZ A;  2HHH C;  1MD9 A;  2UU9 C;  4DV7 C;  4DCS A;  1N36 C;  1XNR C;  1RG9 A;  4OYC A;  2D1Q A;  4JI7 C;  3ETO A;  4JI3 C;  4XX2 A;  4K0K C;  4DV5 C;  4B3T C;  5A2Q D;  3EER A;  4JI4 C;  5A1G A;  4DV4 C;  3L8C A;  4D56 A;  5KYV A;  2BH1 X;  3UOW A;  2V7B A;  1MDB A;  2ONF A;  1VLA A;  5H9U A;  4AQY C;  4DCU A;  3RG2 A;  3OTO C;  2E8F A;  5A19 A;  4GKK C;  3N2Q A;  4D4I A;  4GXR A;  2OPL A;  1LCI A;  4NXN C;  4JI5 C;  4ZJZ A;  2UXB C;  5BUS A;  1IBL C;  4DV2 C;  4KHP C;  1XMQ C;  1WF3 A;  5DV9 A;  4LF8 C;  1IBM C;  4DR2 C;  4FUQ A;  2UUA C;  1XRA A;  3GPC A;  4DV6 C;  5CZV A;  1HNW C;  2P02 A;  4KTT A;  3T1Y C;  2P2M A;  4IZ6 A;  3R9W A;  2D1T A;  1XMO C;  3IML A;  4G36 A;  4RLF A;  2D27 A;  1JOS A;  1PG4 A;  4JI6 C;  2XR1 A;  3I08 A;  1EGA A;  1ULT A;  2PN2 A;  4LF5 C;  4I9F A;  1N33 C;  3TQI A;  4RVN A;  1RY2 A;  3IEU A;  5BSM A;  3CW8 X;  4BC7 A;  3R44 A;  1USP B;  4JI2 C;  4R1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...