5T8SA

Crystal structure of a s-adenosylmethionine synthase from neisseria gonorrhoeae with bound s-adenosylmethionine, amp, pyrophosphate, phosphate, and magnesium
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
Knots found
sequence length
388
structure length
388
Chain Sequence
SEYLFTSESVSEGHPDKVADQVSDAILDAILAQDPKARVAAETLVNTGLCVLAGEITTTAQVDYIKVARETIKRIGYNSSELGFDANGCAVGVYYDQQSPDIAQGVNEGEGIDLNQGAGDQGLMFGYACDETPTLMPFAIYYSHRLMQRQSELRKDGRLPWLRPDAKAQLTVVYDSETGKVKRIDTVVLSTQHDPAISQEELSKAVIEQIIKPVLPPELLTDETKYLINPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYACRYVAKNIVAAGLATQCQIQVSYAIGVAEPTSISIDTFGTGKISEEKLIALVCEHFDLRPKGIVQMLDLLRPIYGKSAAYGHFGREEPEFTWERTDKAASLKAAAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a S-adenosylmethionine Synthase from Neisseria gonorrhoeae with bound S-adenosylmethionine, AMP, Pyrophosphate, Phosphate, and Magnesium
rcsb
source organism Neisseria gonorrhoeae (strain atcc 700825 / fa 1090)
molecule tags Transferase
molecule keywords S-adenosylmethionine synthase
total genus 137
structure length 388
sequence length 388
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.5.1.6: Methionine adenosyltransferase.
pdb deposition date 2016-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00438 S-AdoMet_synt_N S-adenosylmethionine synthetase, N-terminal domain
A PF02772 S-AdoMet_synt_M S-adenosylmethionine synthetase, central domain
A PF02773 S-AdoMet_synt_C S-adenosylmethionine synthetase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA01
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA02
3.30.300.10 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 5t8sA03
4L7IA 4LE5A 2YWBA 4L4QA 4ODJA 1O90A 1XRCA 3RV2A 1MXAA 2YWCA 5A1IA 3A4IA 1XRAA 2DPLA 2OBVA 5T8TA 1MXCA 5A19A 4KTTA 1FUGA 5T8SA 1O92A 1GPMA 1QM4A 5A1GA 5H9UA 4NDNA 3SO4A 1MXBA 4L2ZA 1P7LA 3UOWA 2P02A 1O9TA 1XRBA 3TDEA 1O93A 4HPVA 1RG9A 3TQIA 4KTVA 4WS9A 3S82A 3IMLA 4K0BA
chains in the Genus database with same CATH superfamily
4L7IA 3TUFA 2D1QA 2KDNA 4RM3A 2Y27A 5DV9A 5KEIA 4DR3C 4JI1C 1KKGA 3A9VA 4R1LA 5A1IA 3KXWA 4DV0C 2E8CA 2JMPA 4D56A 3NYQA 2Y4NA 3JAMD 1JOSA 3GR0A 2WP0C 4JI3C 4X65C 4PROC 1HH2P 4LF9C 3IMLA 3LAXA 2F4VC 3R9WA 3UEBA 3RG2A 4DUZC 1O90A 4ZLPA 5BSTA 4LF7C 3T1YC 2CY1A 4KTTA 1ML8A 5K85A 4L2ZA 2OPLB 3FCCA 2E7GA 3B7WA 2UUCC 4DR6C 3LNOA 1MDFA 1T5DX 3VNRA 5LCIA 5ADZA 2ZM6C 4GXQA 2MMAB 4LFAC 4YHHC 4ISBA 3AF5A 4RVNA 1XHJA 4G1IA 2ZZNA 5KYTA 2CXCA 2ONFA 4YY3C 3PESA 3OTOC 2JNVA 2PT7G 2VQEC 4JI5C 4ZJZA 3LUSA 3L95X 4NOZA 4JI0C 4G36A 4LE5A 2MCQA 2WD9A 2XR1A 1IBKC 1ZB9A 5CZVA 5KYVA 3AY0A 3GKUA 4B3SC 4DV1C 2ASBA 1EGAA 1P4EA 4JYAC 2EGTA 4BCAA 1V25A 2HJGA 1IB8A 1HNZC 4EATA 2PN2A 5CZXA 3J81D 3NYRA 3R44A 5AE1A 5JRHA 4B3RC 4DV7C 2UUBC 4DV6C 4PUIA 4BC7A 4RM2A 2UXDC 2E8FA 4NXMC 5K8FA 3UOWA 3CW9A 1XNQC 3K6RA 2E5LC 3TQIA 2E0GA 4R1MA 2M5HA 3IEVA 1N32C 4X62C 2ATWA 2YX1A 1WCJA 3EQ6A 4BBYA 2QVYX 3A4IA 3CQ2A 2MM9A 1MXCA 4DR1C 3PROC 1USPB 5T8SA 5BURA 4PUGA 4JV5C 4IZ6A 5BSVA 1O93A 4DUYC 4RMNA 4LF4C 1USPA 1VLAA 1N33C 2M5OA 2PROA 3CW8X 4DCUA 2Z51A 4GXRA 2OPLA 4OXIA 1QWIA 4DR7C 1QM4A 2OO4A 2P2JA 2P2BA 1LQLA 4DCSA 4DR2C 5AE3A 3O2EA 2QVXX 1V26A 2UU9C 4B3TC 1PG4A 2VQFC 3CQ1A 3DHVA 3DLPX 2BJOA 2P2QA 3UX3A 3ETOA 3GPCA 2HHHC 2KZ0A 2NCLA 3E7WA 1AMUA 1N34C 2V7BA 1UKKA 1UWDA 4BSZA 3N2QA 4WS9A 4DV3C 1YJ7A 2YCBA 2QL8A 2ZZMA 4L4QA 5BSRA 4LFBC 1NYEA 3RV2A 5BSUA 4I9FA 1VEHA 2OBVA 5T8TA 5A2QD 1IBMC 1FLOA 4JI6C 2KZFA 2CU6A 4DG9A 5GTDA 2DHMA 4D4GA 2D1RA 4GKJC 4DG8A 1FJGC 1XMQC 2VZEA 1XRCA 3EERA 4U5YD 4RLQA 2DYJA 3LGXA 1MXAA 1WF3A 1T5HX 1IBLC 1N36C 5IFIA 4FUQA 3R9XA 4D57A 1P7LA 3L8CA 4LF8C 5AE2A 1MDBA 3TR3A 2E8EA 1MKYA 3NPDA 4GS5A 3CJEA 1PG3A 2P20A 4RLFA 3A25A 3VNQA 4XX2A 2P2MA 1M6XC 3FCEA 1ULTA 4DCTA 4G37A 4PUHA 4B3MC 1O92A 5H9UA 3SO4A 3UX2A 1O9TA 2D27A 4X66C 4AQYC 5LMNC 3TDEA 1P4EC 4LF6C 3J80D 4BC9A 4R0MA 5BUQA 4DR5C 4ODJA 5BR8C 1XMOC 4MTNA 2QVZX 2DPLA 1PA4A 4I9GA 2BH1X 3A9UA 1GPMA 5A1GA 2UUAC 3G7SA 1XNRC 5BUSA 2P02A 3IEUA 4OX9C 1PU1A 4KTVA 4LFCC 2UXBC 3ETCA 4JM1A 3DAYA 2UXCC 1HNWC 1NY8A 4LF5C 2YWCA 1MD9A 4DCVA 4X64C 1WH9A 5LMUC 1I94C 2P2FA 3GR1A 1XRBA 3I08A 1N2FA 4FTFA 2Y4OA 2D7VA 4IR7A 4JI8C 5BSMA 2QW0X 4MH4A 2D1TA 1HR0C 4RVOA 1L2FA 3E7XA 5IWAC 1BA3A 4OYCA 4DR4C 3UZ0A 5E7QA 1V60A 4WV3A 2D28C 3S82A 4K0KC 4K0BA 1K0RA 3NI2A 4D4IA 1XRAA 3H2TA 4PHTA 5A19A 3VNSA 3IPLA 4TPSB 3I07A 2AYAA 3C5EA 4NDNA 1MXBA 1J5EC 5BSWA 1HNXC 1RY2A 4DV5C 4HPVA 1RG9A 4DV4C 4JI2C 4PZPA 3CQ3A 5FLXD 2YWBA 3N54B 1M6XA 1TH5A 1XS3A 4KHPC 3LNVA 3PBKA 1LCIA 1FUGA 4DV2C 1ZB8A 4NXNC 4GKKC 2VSQA 3A26A 3T1HC 4JI4C 4FUTA 5IT9D 3AF6A 4JI7C 2D1SA
chains in the Genus database with same CATH topology
4L7IA 3TUFA 2D1QA 4RM3A 2Y27A 5DV9A 5KEIA 4DR3C 4JI1C 1KKGA 3A9VA 4R1LA 5A1IA 3KXWA 4DV0C 2E8CA 2JMPA 4D56A 3NYQA 2Y4NA 3JAMD 1JOSA 3GR0A 2WP0C 4JI3C 4X65C 4PROC 1HH2P 4LF9C 3IMLA 3LAXA 2F4VC 3R9WA 3RG2A 4DUZC 1O90A 4ZLPA 5BSTA 4LF7C 3T1YC 2CY1A 4KTTA 1ML8A 5K85A 4L2ZA 2OPLB 3FCCA 2E7GA 3B7WA 2UUCC 4DR6C 1MDFA 1T5DX 3VNRA 5ADZA 2ZM6C 4GXQA 4LFAC 4YHHC 4ISBA 3AF5A 4RVNA 4G1IA 5KYTA 2CXCA 2ONFA 4YY3C 3PESA 3OTOC 2PT7G 2VQEC 4JI5C 4ZJZA 3LUSA 3L95X 4NOZA 4JI0C 4G36A 4LE5A 2WD9A 2XR1A 1IBKC 1ZB9A 5CZVA 5KYVA 3GKUA 4B3SC 4DV1C 2ASBA 1EGAA 4JYAC 2EGTA 4BCAA 1V25A 2HJGA 1HNZC 4EATA 2PN2A 5CZXA 3J81D 3NYRA 3R44A 5AE1A 5JRHA 4B3RC 4DV7C 2UUBC 4DV6C 4BC7A 4RM2A 2UXDC 2E8FA 4NXMC 5K8FA 3UOWA 3CW9A 1XNQC 2E5LC 3TQIA 2E0GA 4R1MA 3IEVA 1N32C 4X62C 2ATWA 3EQ6A 4BBYA 2QVYX 3A4IA 1MXCA 4DR1C 3PROC 1USPB 5T8SA 5BURA 4JV5C 4IZ6A 5BSVA 1O93A 4DUYC 4RMNA 4LF4C 1USPA 1VLAA 1N33C 3CW8X 2PROA 4DCUA 4GXRA 2OPLA 4OXIA 1QWIA 4DR7C 1QM4A 2OO4A 2P2JA 2P2BA 1LQLA 4DCSA 4DR2C 5AE3A 2QVXX 1V26A 2UU9C 4B3TC 1PG4A 2VQFC 3DHVA 3DLPX 2BJOA 2P2QA 3ETOA 3GPCA 2HHHC 3E7WA 1AMUA 1N34C 2V7BA 1UKKA 4BSZA 3N2QA 4WS9A 4DV3C 1YJ7A 2YCBA 2QL8A 4L4QA 5BSRA 4LFBC 1NYEA 3RV2A 5BSUA 4I9FA 2OBVA 5T8TA 5A2QD 1IBMC 4JI6C 2KZFA 4DG9A 5GTDA 4D4GA 2D1RA 4GKJC 4DG8A 1FJGC 1XMQC 2VZEA 1XRCA 3EERA 4U5YD 4RLQA 2DYJA 3LGXA 1MXAA 1WF3A 1T5HX 1IBLC 1N36C 5IFIA 4FUQA 3R9XA 4D57A 1P7LA 3L8CA 4LF8C 5AE2A 1MDBA 2E8EA 1MKYA 3NPDA 4GS5A 3CJEA 1PG3A 2P20A 4RLFA 3VNQA 4XX2A 2P2MA 3FCEA 1ULTA 4DCTA 4G37A 4B3MC 1O92A 5H9UA 3SO4A 1O9TA 2D27A 4X66C 4AQYC 5LMNC 3TDEA 4LF6C 3J80D 4BC9A 4R0MA 5BUQA 4DR5C 4ODJA 5BR8C 1XMOC 4MTNA 2QVZX 2DPLA 1PA4A 4I9GA 2BH1X 3A9UA 1GPMA 5A1GA 2UUAC 3G7SA 1XNRC 5BUSA 2P02A 3IEUA 4OX9C 4KTVA 4LFCC 2UXBC 3ETCA 4JM1A 3DAYA 2UXCC 1HNWC 4LF5C 2YWCA 1MD9A 4DCVA 4X64C 1WH9A 5LMUC 1I94C 2P2FA 3GR1A 1XRBA 3I08A 1N2FA 4FTFA 2Y4OA 2D7VA 4IR7A 4JI8C 5BSMA 2QW0X 4MH4A 2D1TA 1HR0C 4RVOA 1L2FA 3E7XA 5IWAC 1BA3A 4OYCA 4DR4C 3UZ0A 5E7QA 4WV3A 2D28C 3S82A 4K0KC 4K0BA 1K0RA 3NI2A 4D4IA 1XRAA 3H2TA 4PHTA 5A19A 3VNSA 3IPLA 4TPSB 3I07A 2AYAA 3C5EA 4NDNA 1MXBA 1J5EC 5BSWA 1HNXC 1RY2A 4DV5C 4HPVA 1RG9A 4DV4C 4JI2C 4PZPA 5FLXD 2YWBA 3N54B 4KHPC 3LNVA 3PBKA 1LCIA 1FUGA 4DV2C 1ZB8A 4NXNC 4GKKC 2VSQA 3T1HC 4JI4C 4FUTA 5IT9D 3AF6A 4JI7C 2D1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L7I A;  4LE5 A;  2YWB A;  4L4Q A;  4ODJ A;  1O90 A;  1XRC A;  3RV2 A;  1MXA A;  2YWC A;  5A1I A;  3A4I A;  1XRA A;  2DPL A;  2OBV A;  5T8T A;  1MXC A;  5A19 A;  4KTT A;  1FUG A;  5T8S A;  1O92 A;  1GPM A;  1QM4 A;  5A1G A;  5H9U A;  4NDN A;  3SO4 A;  1MXB A;  4L2Z A;  1P7L A;  3UOW A;  2P02 A;  1O9T A;  1XRB A;  3TDE A;  1O93 A;  4HPV A;  1RG9 A;  3TQI A;  4KTV A;  4WS9 A;  3S82 A;  3IML A;  4K0B A; 
#chains in the Genus database with same CATH topology
 4L7I A;  3TUF A;  2D1Q A;  2KDN A;  4RM3 A;  2Y27 A;  5DV9 A;  5KEI A;  4DR3 C;  4JI1 C;  1KKG A;  3A9V A;  4R1L A;  5A1I A;  3KXW A;  4DV0 C;  2E8C A;  2JMP A;  4D56 A;  3NYQ A;  2Y4N A;  3JAM D;  1JOS A;  3GR0 A;  2WP0 C;  4JI3 C;  4X65 C;  4PRO C;  1HH2 P;  4LF9 C;  3IML A;  3LAX A;  2F4V C;  3R9W A;  3UEB A;  3RG2 A;  4DUZ C;  1O90 A;  4ZLP A;  5BST A;  4LF7 C;  3T1Y C;  2CY1 A;  4KTT A;  1ML8 A;  5K85 A;  4L2Z A;  2OPL B;  3FCC A;  2E7G A;  3B7W A;  2UUC C;  4DR6 C;  3LNO A;  1MDF A;  1T5D X;  3VNR A;  5LCI A;  5ADZ A;  2ZM6 C;  4GXQ A;  2MMA B;  4LFA C;  4YHH C;  4ISB A;  3AF5 A;  4RVN A;  1XHJ A;  4G1I A;  2ZZN A;  5KYT A;  2CXC A;  2ONF A;  4YY3 C;  3PES A;  3OTO C;  2JNV A;  2PT7 G;  2VQE C;  4JI5 C;  4ZJZ A;  3LUS A;  3L95 X;  4NOZ A;  4JI0 C;  4G36 A;  4LE5 A;  2MCQ A;  2WD9 A;  2XR1 A;  1IBK C;  1ZB9 A;  5CZV A;  5KYV A;  3AY0 A;  3GKU A;  4B3S C;  4DV1 C;  2ASB A;  1EGA A;  1P4E A;  4JYA C;  2EGT A;  4BCA A;  1V25 A;  2HJG A;  1IB8 A;  1HNZ C;  4EAT A;  2PN2 A;  5CZX A;  3J81 D;  3NYR A;  3R44 A;  5AE1 A;  5JRH A;  4B3R C;  4DV7 C;  2UUB C;  4DV6 C;  4PUI A;  4BC7 A;  4RM2 A;  2UXD C;  2E8F A;  4NXM C;  5K8F A;  3UOW A;  3CW9 A;  1XNQ C;  3K6R A;  2E5L C;  3TQI A;  2E0G A;  4R1M A;  2M5H A;  3IEV A;  1N32 C;  4X62 C;  2ATW A;  2YX1 A;  1WCJ A;  3EQ6 A;  4BBY A;  2QVY X;  3A4I A;  3CQ2 A;  2MM9 A;  1MXC A;  4DR1 C;  3PRO C;  1USP B;  5T8S A;  5BUR A;  4PUG A;  4JV5 C;  4IZ6 A;  5BSV A;  1O93 A;  4DUY C;  4RMN A;  4LF4 C;  1USP A;  1VLA A;  1N33 C;  2M5O A;  2PRO A;  3CW8 X;  4DCU A;  2Z51 A;  4GXR A;  2OPL A;  4OXI A;  1QWI A;  4DR7 C;  1QM4 A;  2OO4 A;  2P2J A;  2P2B A;  1LQL A;  4DCS A;  4DR2 C;  5AE3 A;  3O2E A;  2QVX X;  1V26 A;  2UU9 C;  4B3T C;  1PG4 A;  2VQF C;  3CQ1 A;  3DHV A;  3DLP X;  2BJO A;  2P2Q A;  3UX3 A;  3ETO A;  3GPC A;  2HHH C;  2KZ0 A;  2NCL A;  3E7W A;  1AMU A;  1N34 C;  2V7B A;  1UKK A;  1UWD A;  4BSZ A;  3N2Q A;  4WS9 A;  4DV3 C;  1YJ7 A;  2YCB A;  2QL8 A;  2ZZM A;  4L4Q A;  5BSR A;  4LFB C;  1NYE A;  3RV2 A;  5BSU A;  4I9F A;  1VEH A;  2OBV A;  5T8T A;  5A2Q D;  1IBM C;  1FLO A;  4JI6 C;  2KZF A;  2CU6 A;  4DG9 A;  5GTD A;  2DHM A;  4D4G A;  2D1R A;  4GKJ C;  4DG8 A;  1FJG C;  1XMQ C;  2VZE A;  1XRC A;  3EER A;  4U5Y D;  4RLQ A;  2DYJ A;  3LGX A;  1MXA A;  1WF3 A;  1T5H X;  1IBL C;  1N36 C;  5IFI A;  4FUQ A;  3R9X A;  4D57 A;  1P7L A;  3L8C A;  4LF8 C;  5AE2 A;  1MDB A;  3TR3 A;  2E8E A;  1MKY A;  3NPD A;  4GS5 A;  3CJE A;  1PG3 A;  2P20 A;  4RLF A;  3A25 A;  3VNQ A;  4XX2 A;  2P2M A;  1M6X C;  3FCE A;  1ULT A;  4DCT A;  4G37 A;  4PUH A;  4B3M C;  1O92 A;  5H9U A;  3SO4 A;  3UX2 A;  1O9T A;  2D27 A;  4X66 C;  4AQY C;  5LMN C;  3TDE A;  1P4E C;  4LF6 C;  3J80 D;  4BC9 A;  4R0M A;  5BUQ A;  4DR5 C;  4ODJ A;  5BR8 C;  1XMO C;  4MTN A;  2QVZ X;  2DPL A;  1PA4 A;  4I9G A;  2BH1 X;  3A9U A;  1GPM A;  5A1G A;  2UUA C;  3G7S A;  1XNR C;  5BUS A;  2P02 A;  3IEU A;  4OX9 C;  1PU1 A;  4KTV A;  4LFC C;  2UXB C;  3ETC A;  4JM1 A;  3DAY A;  2UXC C;  1HNW C;  1NY8 A;  4LF5 C;  2YWC A;  1MD9 A;  4DCV A;  4X64 C;  1WH9 A;  5LMU C;  1I94 C;  2P2F A;  3GR1 A;  1XRB A;  3I08 A;  1N2F A;  4FTF A;  2Y4O A;  2D7V A;  4IR7 A;  4JI8 C;  5BSM A;  2QW0 X;  4MH4 A;  2D1T A;  1HR0 C;  4RVO A;  1L2F A;  3E7X A;  5IWA C;  1BA3 A;  4OYC A;  4DR4 C;  3UZ0 A;  5E7Q A;  1V60 A;  4WV3 A;  2D28 C;  3S82 A;  4K0K C;  4K0B A;  1K0R A;  3NI2 A;  4D4I A;  1XRA A;  3H2T A;  4PHT A;  5A19 A;  3VNS A;  3IPL A;  4TPS B;  3I07 A;  2AYA A;  3C5E A;  4NDN A;  1MXB A;  1J5E C;  5BSW A;  1HNX C;  1RY2 A;  4DV5 C;  4HPV A;  1RG9 A;  4DV4 C;  4JI2 C;  4PZP A;  3CQ3 A;  5FLX D;  2YWB A;  3N54 B;  1M6X A;  1TH5 A;  1XS3 A;  4KHP C;  3LNV A;  3PBK A;  1LCI A;  1FUG A;  4DV2 C;  1ZB8 A;  4NXN C;  4GKK C;  2VSQ A;  3A26 A;  3T1H C;  4JI4 C;  4FUT A;  5IT9 D;  3AF6 A;  4JI7 C;  2D1S A; 
#chains in the Genus database with same CATH homology
 4L7I A;  3TUF A;  2D1Q A;  4RM3 A;  2Y27 A;  5DV9 A;  5KEI A;  4DR3 C;  4JI1 C;  1KKG A;  3A9V A;  4R1L A;  5A1I A;  3KXW A;  4DV0 C;  2E8C A;  2JMP A;  4D56 A;  3NYQ A;  2Y4N A;  3JAM D;  1JOS A;  3GR0 A;  2WP0 C;  4JI3 C;  4X65 C;  4PRO C;  1HH2 P;  4LF9 C;  3IML A;  3LAX A;  2F4V C;  3R9W A;  3RG2 A;  4DUZ C;  1O90 A;  4ZLP A;  5BST A;  4LF7 C;  3T1Y C;  2CY1 A;  4KTT A;  1ML8 A;  5K85 A;  4L2Z A;  2OPL B;  3FCC A;  2E7G A;  3B7W A;  2UUC C;  4DR6 C;  1MDF A;  1T5D X;  3VNR A;  5ADZ A;  2ZM6 C;  4GXQ A;  4LFA C;  4YHH C;  4ISB A;  3AF5 A;  4RVN A;  4G1I A;  5KYT A;  2CXC A;  2ONF A;  4YY3 C;  3PES A;  3OTO C;  2PT7 G;  2VQE C;  4JI5 C;  4ZJZ A;  3LUS A;  3L95 X;  4NOZ A;  4JI0 C;  4G36 A;  4LE5 A;  2WD9 A;  2XR1 A;  1IBK C;  1ZB9 A;  5CZV A;  5KYV A;  3GKU A;  4B3S C;  4DV1 C;  2ASB A;  1EGA A;  4JYA C;  2EGT A;  4BCA A;  1V25 A;  2HJG A;  1HNZ C;  4EAT A;  2PN2 A;  5CZX A;  3J81 D;  3NYR A;  3R44 A;  5AE1 A;  5JRH A;  4B3R C;  4DV7 C;  2UUB C;  4DV6 C;  4BC7 A;  4RM2 A;  2UXD C;  2E8F A;  4NXM C;  5K8F A;  3UOW A;  3CW9 A;  1XNQ C;  2E5L C;  3TQI A;  2E0G A;  4R1M A;  3IEV A;  1N32 C;  4X62 C;  2ATW A;  3EQ6 A;  4BBY A;  2QVY X;  3A4I A;  1MXC A;  4DR1 C;  3PRO C;  1USP B;  5T8S A;  5BUR A;  4JV5 C;  4IZ6 A;  5BSV A;  1O93 A;  4DUY C;  4RMN A;  4LF4 C;  1USP A;  1VLA A;  1N33 C;  3CW8 X;  2PRO A;  4DCU A;  4GXR A;  2OPL A;  4OXI A;  1QWI A;  4DR7 C;  1QM4 A;  2OO4 A;  2P2J A;  2P2B A;  1LQL A;  4DCS A;  4DR2 C;  5AE3 A;  2QVX X;  1V26 A;  2UU9 C;  4B3T C;  1PG4 A;  2VQF C;  3DHV A;  3DLP X;  2BJO A;  2P2Q A;  3ETO A;  3GPC A;  2HHH C;  3E7W A;  1AMU A;  1N34 C;  2V7B A;  1UKK A;  4BSZ A;  3N2Q A;  4WS9 A;  4DV3 C;  1YJ7 A;  2YCB A;  2QL8 A;  4L4Q A;  5BSR A;  4LFB C;  1NYE A;  3RV2 A;  5BSU A;  4I9F A;  2OBV A;  5T8T A;  5A2Q D;  1IBM C;  4JI6 C;  2KZF A;  4DG9 A;  5GTD A;  4D4G A;  2D1R A;  4GKJ C;  4DG8 A;  1FJG C;  1XMQ C;  2VZE A;  1XRC A;  3EER A;  4U5Y D;  4RLQ A;  2DYJ A;  3LGX A;  1MXA A;  1WF3 A;  1T5H X;  1IBL C;  1N36 C;  5IFI A;  4FUQ A;  3R9X A;  4D57 A;  1P7L A;  3L8C A;  4LF8 C;  5AE2 A;  1MDB A;  2E8E A;  1MKY A;  3NPD A;  4GS5 A;  3CJE A;  1PG3 A;  2P20 A;  4RLF A;  3VNQ A;  4XX2 A;  2P2M A;  3FCE A;  1ULT A;  4DCT A;  4G37 A;  4B3M C;  1O92 A;  5H9U A;  3SO4 A;  1O9T A;  2D27 A;  4X66 C;  4AQY C;  5LMN C;  3TDE A;  4LF6 C;  3J80 D;  4BC9 A;  4R0M A;  5BUQ A;  4DR5 C;  4ODJ A;  5BR8 C;  1XMO C;  4MTN A;  2QVZ X;  2DPL A;  1PA4 A;  4I9G A;  2BH1 X;  3A9U A;  1GPM A;  5A1G A;  2UUA C;  3G7S A;  1XNR C;  5BUS A;  2P02 A;  3IEU A;  4OX9 C;  4KTV A;  4LFC C;  2UXB C;  3ETC A;  4JM1 A;  3DAY A;  2UXC C;  1HNW C;  4LF5 C;  2YWC A;  1MD9 A;  4DCV A;  4X64 C;  1WH9 A;  5LMU C;  1I94 C;  2P2F A;  3GR1 A;  1XRB A;  3I08 A;  1N2F A;  4FTF A;  2Y4O A;  2D7V A;  4IR7 A;  4JI8 C;  5BSM A;  2QW0 X;  4MH4 A;  2D1T A;  1HR0 C;  4RVO A;  1L2F A;  3E7X A;  5IWA C;  1BA3 A;  4OYC A;  4DR4 C;  3UZ0 A;  5E7Q A;  4WV3 A;  2D28 C;  3S82 A;  4K0K C;  4K0B A;  1K0R A;  3NI2 A;  4D4I A;  1XRA A;  3H2T A;  4PHT A;  5A19 A;  3VNS A;  3IPL A;  4TPS B;  3I07 A;  2AYA A;  3C5E A;  4NDN A;  1MXB A;  1J5E C;  5BSW A;  1HNX C;  1RY2 A;  4DV5 C;  4HPV A;  1RG9 A;  4DV4 C;  4JI2 C;  4PZP A;  5FLX D;  2YWB A;  3N54 B;  4KHP C;  3LNV A;  3PBK A;  1LCI A;  1FUG A;  4DV2 C;  1ZB8 A;  4NXN C;  4GKK C;  2VSQ A;  3T1H C;  4JI4 C;  4FUT A;  5IT9 D;  3AF6 A;  4JI7 C;  2D1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...