3VEAA

Crystal structure of matp-mats23mer
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MKYQQLENLESGWKWAYLVKKHREGEAITRHIENSAAQDAVEQLMKLENEPVKVQEWIDAHMNVNLATRMKQTIRARRKRHFNAEHQHTRKKSIDLEFLVWQRLAVLARRRGNTLSDTVVQLIEDAERKEKYASQMSSLKQDLKDILDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Dna binding protein/dna
molecule keywords Macrodomain Ter protein
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06303 MatP MatP N-terminal domain
A PF17414 MatP_C MatP C-terminal ribbon-helix-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3veaA02
1.20.1270.380 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3veaA01
1IRQA 2BJ1A 2BJ7A 1U9PA 3VEAA 1QTGA 2WVDA 2JXHA 2BJ9A 3OD2A 3QOQA 1EA4A 1Q5VA 2CAXA 2BNWA 3VW4A 1MYLA 2K29A 2BSQE 2KELA 3FT7A 1BAZA 2BJ3A 2GPEA 1B01A 3FMTA 2K9IA 1B28A 1ARQA 2CPGA 2K6LA 2WVFA 2CAJA 2CADA 2K1OA 2WVEA 3H87C 1BDTA 4D8JA 2CA9A 2HZAA 2RBFA 4ME7E 3GXQA 2JXIA 1PARA 3LGHA 1X93A 2WVBA 2AY0A 1MNTA 2HZVA 1BDVA 1MYKA 2K5JA 2BNZA 2BJ8A 4HV0A 2JXGA 1ARRA 4FXEA 2BA3A 1P94A 2H1OE 1NLAA 3VEBA 2WVCA
chains in the Genus database with same CATH superfamily
3NO7A 1DKZA 3G5OA 5E84A 3EJTA 2KELA 4FZPA 2GPEA 4NSWA 2CADA 2YKTA 2OO2A 3CZSA 2JXIA 3EJQA 2FYVA 3LGHA 2WYHA 1MNTA 4AZ7A 4FZSA 4FXEA 1I4TA 4AZCA 3D4ZA 3G9GA 3O3OB 3OD2A 3CVRA 4LRVA 4JNFA 4F00A 4EZSA 2K9IA 4MJWA 2CPGA 3HAIA 1ZYLA 2YLLA 3CV5A 4HR1A 3H87C 4H8SA 2Z0NA 3UR0A 1R34A 1HTYA 1E9VA 2NCZA 1HXKA 2C08A 2EFLA 4E81A 2N3KA 3DDGA 1TQVA 3DX0A 3ACOA 3F7WA 1SU8A 5KBPA 5FIGA 3DPOA 1LQ7A 2F7QA 3SFGA 4KIKB 1W9MA 4UDXX 4R5GA 4R5JA 2EFKA 2UUTA 3ER9B 1O7DB 4R5IA 4EZUA 2WK4A 2Q12A 4HV0A 3LLLA 4NQIA 2JNSA 1HWWA 4AZGA 4HY9A 3HAHA 1URUA 2BSQE 4M0MA 3RPMA 4PO2A 3O3MB 2PMRA 4EZOA 3DX4A 4IM3A 1I4LA 2RAIA 3KDRA 1X93A 2PY6A 2YLAA 3DPPA 2Q13A 2HZVA 3BVWA 2BNZA 1TQSA 2LM0A 4NPHA 2BA3A 2WVCA 1E2UA 1OAOA 2BJ1A 2BJ7A 3RV1A 1QTGA 4AKVA 4DYLA 3KAWA 4ATMA 2WVFA 2RAJA 3M3WA 2RT6A 4AVMA 3NAIA 3SYVA 2JXGA 4B9QA 3VEBA 3QNJA 4AZHA 4R5LA 1IRQA 3EJSA 2YL5A 2WVDA 2BNWA 2OBMA 3FT7A 2MI7A 3SFUA 1SUFA 1B28A 3H5YA 2OW7A 1QWNA 4D8JA 2QFFA 4R5KA 1SH3A 1TQWA 2X3XA 2BJ8A 3UPFA 3D52A 1GNTA 3CZNA 3T4AG 3A98A 1EA4A 3VW4A 4F01A 2GA9D 4BNEA 2CKWA 3EJRA 3BSOA 3DDFA 3CAZA 4JWEA 2YL6A 1OG7A 2YI8A 2HZAA 1X03A 4JNEA 1DKXA 3DX1A 3UITA 3OHXM 4EZNA 3EJUA 2QKWA 2KKEA 1O7DC 3ABHA 3OWGA 1MYLA 3T49A 4H6IA 4WPEA 3BVUA 3H5XA 3QIDA 2GF4A 2D4CA 3FD9A 2Z0VA 1ARRA 1MJGA 3QE6A 3NAHA 4IWOA 1SU6A 3BUDA 2F1AA 4JN4A 1I49A 3I2WA 3GI7A 3Q84A 2LXYA 4AZ5A 2ADLA 3GXQA 2ND0A 2O0I1 3ERCC 3DX2A 2QXLA 2AY0A 1GN9A 4AZ6A 3SOGA 1TQTA 1P94A 2H1OE 2B43A 4HYBA 2YIBA 3DYTA 3QNIA 3QOQA 2WINM 4O4RA 4AZCB 4H6HA 2JNKA 4IW0A 2ELBA 3BUIA 4EZPA 3D4YA 3D2EA 1X04A 3T46A 1QWUA 4IM2A 2A2BA 2X3WA 1BDTA 1DKYA 2UUWA 2YIVX 4JL9A 1OA1A 2KHOA 2ZXQA 5C5BA 3RV0A 4LQ9A 2F7PA 4EZWA 4QPXA 2ALWA 2YL9A 2BJ9A 2CAXA 3L3PA 5C5BB 3DX3A 3IR7A 1SH0A 4AZIA 4EZXA 3FMTA 4NRUA 2K6LA 1OHNA 2WYIA 2K1OA 3ZEDA 4EZTA 3EJPA 5FLEX 1NLAA 1SIWA 1E1DA 1UPXA 3L3OM 3BVVA 3BLBA 3Q0KA 3VEAA 1R33A 2RAKA 3VKHA 3ER8C 2Q2KA 1ZWWA 1B01A 1U00A 2OBLA 4JWIA 2FICA 4EZVA 2CAJA 2F7RA 2CA9A 1R5EA 1Y2OA 2YL8A 4KIKA 3B53X 4AAIA 4JWDA 2K29A 2BJ3A 4IWQA 4HR1B 2YIAA 3PLTA 1YWMA 2ND1A 3LJPA 4EZZA 3C7NA 2X3VA 4IWPA 3BUQA 2WVBA 2K5JA 4DCNC 2OW6A 3DPQA 1WDZA 3HAJA 4I1QA 3BUPA 3BVTA 3UQSA 2H3AA 1TQUA 1BAZA 3D2FA 5TKYA 3BSNA 3B52X 2KOEA 3NNEA 2F18A 4EZQA 3D50A 3KAVA 3BUBA 1MYKA 2YI9A 4EZYA 2JBVA 3CKDA 4FM3A 1Q5VA 4LQ3A 4JLCA 1I4DA 4E3CA 3O3NB 3I01A 1SU7A 4AZBA 1ARQA 3D51A 2WVEA 2OZNB 4ME7E 2D1LA 4JWCA 3T47A 4UDYX 3LVTA 2GAFD 3T48A 3I04A 2Z8YA 4G6QA 1Q16A 1BDVA 3I39X 4WPCA 3QA8A 1U9PA 4IM0A 2JXHA 2F1BA 1PS3A 2EWFA 1GNLA 3LMFA 4FZOA 3QWEA 1JQKA 2Z0OA 3OK8A 2X5CA 2F7OA 2V0OA 1SH2A 2RBFA 3BVXA 1PARA 4EZRA 1QX1A 4NRTA 2AN7A 1OA0A 2EX3B 3B51X
chains in the Genus database with same CATH topology
2BJ1A 1DKZA 2BJ7A 4IWOA 3RV1A 1QTGA 1SU6A 4JWDA 5E84A 2K29A 2KELA 3KAWA 4JN4A 2BJ3A 4IWQA 2GPEA 4HR1B 3GI7A 2YIAA 2WVFA 2CADA 2ND1A 4EZZA 3C7NA 2RT6A 4IWPA 2JXIA 3GXQA 2ND0A 3ERCC 3LGHA 2WVBA 2QXLA 2AY0A 1GN9A 1MNTA 2K5JA 2JXGA 4FXEA 4B9QA 1P94A 2H1OE 3DPQA 3VEBA 3QNJA 4R5LA 1IRQA 4HYBA 2YIBA 3O3OB 2WVDA 3OD2A 3QOQA 2BNWA 2WINM 4JNFA 2OBMA 4F00A 3FT7A 4H6HA 3B53X 1BAZA 4IW0A 4EZSA 3D2FA 1SUFA 2K9IA 1B28A 4EZPA 2CPGA 3D2EA 1ZYLA 4HR1A 3T46A 4IM2A 5TKYA 3H87C 1BDTA 1DKYA 3B52X 4D8JA 2QFFA 4R5KA 1E9VA 2NCZA 2YIVX 4JL9A 4EZQA 1OA1A 3KAVA 4E81A 2KHOA 2N3KA 1MYKA 2BJ8A 3RV0A 3F7WA 1SU8A 2YI9A 1GNTA 5FIGA 3T4AG 3A98A 4EZWA 4EZYA 3DPOA 1EA4A 2BJ9A 3VW4A 2CAXA 4FM3A 1Q5VA 4JLCA 4F01A 2GA9D 4KIKB 1W9MA 3O3NB 4E3CA 3I01A 4EZXA 1SU7A 3FMTA 4UDXX 2EX3B 1ARQA 4R5GA 2K6LA 4R5JA 2K1OA 2WVEA 4JWEA 3ZEDA 4EZTA 2YI8A 2HZAA 3ER9B 4ME7E 4JNEA 4R5IA 5FLEX 4EZUA 1DKXA 4JWCA 3T47A 4UDYX 2GAFD 3T48A 4HV0A 3I04A 3UITA 2Z8YA 3OHXM 4G6QA 4EZNA 1NLAA 1UPXA 1E1DA 3L3OM 1BDVA 3I39X 2JNSA 3QA8A 1U9PA 3VEAA 4IM0A 2JXHA 4HY9A 3OWGA 3VKHA 1MYLA 3ER8C 2BSQE 2EWFA 1GNLA 4M0MA 4PO2A 3LMFA 1B01A 1U00A 2OBLA 3O3MB 4JWIA 4EZVA 1JQKA 3T49A 2CAJA 4H6IA 2X5CA 4EZOA 4IM3A 2CA9A 2RBFA 1PARA 3KDRA 1X93A 2PY6A 3DPPA 4EZRA 2HZVA 2BNZA 3FD9A 2LM0A 1ARRA 1MJGA 4NPHA 3B51X 2BA3A 4KIKA 1OA0A 2WVCA 1E2UA 1OAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRQ A;  2BJ1 A;  2BJ7 A;  1U9P A;  3VEA A;  1QTG A;  2WVD A;  2JXH A;  2BJ9 A;  3OD2 A;  3QOQ A;  1EA4 A;  1Q5V A;  2CAX A;  2BNW A;  3VW4 A;  1MYL A;  2K29 A;  2BSQ E;  2KEL A;  3FT7 A;  1BAZ A;  2BJ3 A;  2GPE A;  1B01 A;  3FMT A;  2K9I A;  1B28 A;  1ARQ A;  2CPG A;  2K6L A;  2WVF A;  2CAJ A;  2CAD A;  2K1O A;  2WVE A;  3H87 C;  1BDT A;  4D8J A;  2CA9 A;  2HZA A;  2RBF A;  4ME7 E;  3GXQ A;  2JXI A;  1PAR A;  3LGH A;  1X93 A;  2WVB A;  2AY0 A;  1MNT A;  2HZV A;  1BDV A;  1MYK A;  2K5J A;  2BNZ A;  2BJ8 A;  4HV0 A;  2JXG A;  1ARR A;  4FXE A;  2BA3 A;  1P94 A;  2H1O E;  1NLA A;  3VEB A;  2WVC A; 
#chains in the Genus database with same CATH topology
 3NO7 A;  1DKZ A;  3G5O A;  5E84 A;  3EJT A;  2KEL A;  4FZP A;  2GPE A;  4NSW A;  2CAD A;  2YKT A;  2OO2 A;  3CZS A;  2JXI A;  3EJQ A;  2FYV A;  3LGH A;  2WYH A;  1MNT A;  4AZ7 A;  4FZS A;  4FXE A;  1I4T A;  4AZC A;  3D4Z A;  3G9G A;  3O3O B;  3OD2 A;  3CVR A;  4LRV A;  4JNF A;  4F00 A;  4EZS A;  2K9I A;  4MJW A;  2CPG A;  3HAI A;  1ZYL A;  2YLL A;  3CV5 A;  4HR1 A;  3H87 C;  4H8S A;  2Z0N A;  3UR0 A;  1R34 A;  1HTY A;  1E9V A;  2NCZ A;  1HXK A;  2C08 A;  2EFL A;  4E81 A;  2N3K A;  3DDG A;  1TQV A;  3DX0 A;  3ACO A;  3F7W A;  1SU8 A;  5KBP A;  5FIG A;  3DPO A;  1LQ7 A;  2F7Q A;  3SFG A;  4KIK B;  1W9M A;  4UDX X;  4R5G A;  4R5J A;  2EFK A;  2UUT A;  3ER9 B;  1O7D B;  4R5I A;  4EZU A;  2WK4 A;  2Q12 A;  4HV0 A;  3LLL A;  4NQI A;  2JNS A;  1HWW A;  4AZG A;  4HY9 A;  3HAH A;  1URU A;  2BSQ E;  4M0M A;  3RPM A;  4PO2 A;  3O3M B;  2PMR A;  4EZO A;  3DX4 A;  4IM3 A;  1I4L A;  2RAI A;  3KDR A;  1X93 A;  2PY6 A;  2YLA A;  3DPP A;  2Q13 A;  2HZV A;  3BVW A;  2BNZ A;  1TQS A;  2LM0 A;  4NPH A;  2BA3 A;  2WVC A;  1E2U A;  1OAO A;  2BJ1 A;  2BJ7 A;  3RV1 A;  1QTG A;  4AKV A;  4DYL A;  3KAW A;  4ATM A;  2WVF A;  2RAJ A;  3M3W A;  2RT6 A;  4AVM A;  3NAI A;  3SYV A;  2JXG A;  4B9Q A;  3VEB A;  3QNJ A;  4AZH A;  4R5L A;  1IRQ A;  3EJS A;  2YL5 A;  2WVD A;  2BNW A;  2OBM A;  3FT7 A;  2MI7 A;  3SFU A;  1SUF A;  1B28 A;  3H5Y A;  2OW7 A;  1QWN A;  4D8J A;  2QFF A;  4R5K A;  1SH3 A;  1TQW A;  2X3X A;  2BJ8 A;  3UPF A;  3D52 A;  1GNT A;  3CZN A;  3T4A G;  3A98 A;  1EA4 A;  3VW4 A;  4F01 A;  2GA9 D;  4BNE A;  2CKW A;  3EJR A;  3BSO A;  3DDF A;  3CAZ A;  4JWE A;  2YL6 A;  1OG7 A;  2YI8 A;  2HZA A;  1X03 A;  4JNE A;  1DKX A;  3DX1 A;  3UIT A;  3OHX M;  4EZN A;  3EJU A;  2QKW A;  2KKE A;  1O7D C;  3ABH A;  3OWG A;  1MYL A;  3T49 A;  4H6I A;  4WPE A;  3BVU A;  3H5X A;  3QID A;  2GF4 A;  2D4C A;  3FD9 A;  2Z0V A;  1ARR A;  1MJG A;  3QE6 A;  3NAH A;  4IWO A;  1SU6 A;  3BUD A;  2F1A A;  4JN4 A;  1I49 A;  3I2W A;  3GI7 A;  3Q84 A;  2LXY A;  4AZ5 A;  2ADL A;  3GXQ A;  2ND0 A;  2O0I 1;  3ERC C;  3DX2 A;  2QXL A;  2AY0 A;  1GN9 A;  4AZ6 A;  3SOG A;  1TQT A;  1P94 A;  2H1O E;  2B43 A;  4HYB A;  2YIB A;  3DYT A;  3QNI A;  3QOQ A;  2WIN M;  4O4R A;  4AZC B;  4H6H A;  2JNK A;  4IW0 A;  2ELB A;  3BUI A;  4EZP A;  3D4Y A;  3D2E A;  1X04 A;  3T46 A;  1QWU A;  4IM2 A;  2A2B A;  2X3W A;  1BDT A;  1DKY A;  2UUW A;  2YIV X;  4JL9 A;  1OA1 A;  2KHO A;  2ZXQ A;  5C5B A;  3RV0 A;  4LQ9 A;  2F7P A;  4EZW A;  4QPX A;  2ALW A;  2YL9 A;  2BJ9 A;  2CAX A;  3L3P A;  5C5B B;  3DX3 A;  3IR7 A;  1SH0 A;  4AZI A;  4EZX A;  3FMT A;  4NRU A;  2K6L A;  1OHN A;  2WYI A;  2K1O A;  3ZED A;  4EZT A;  3EJP A;  5FLE X;  1NLA A;  1SIW A;  1E1D A;  1UPX A;  3L3O M;  3BVV A;  3BLB A;  3Q0K A;  3VEA A;  1R33 A;  2RAK A;  3VKH A;  3ER8 C;  2Q2K A;  1ZWW A;  1B01 A;  1U00 A;  2OBL A;  4JWI A;  2FIC A;  4EZV A;  2CAJ A;  2F7R A;  2CA9 A;  1R5E A;  1Y2O A;  2YL8 A;  4KIK A;  3B53 X;  4AAI A;  4JWD A;  2K29 A;  2BJ3 A;  4IWQ A;  4HR1 B;  2YIA A;  3PLT A;  1YWM A;  2ND1 A;  3LJP A;  4EZZ A;  3C7N A;  2X3V A;  4IWP A;  3BUQ A;  2WVB A;  2K5J A;  4DCN C;  2OW6 A;  3DPQ A;  1WDZ A;  3HAJ A;  4I1Q A;  3BUP A;  3BVT A;  3UQS A;  2H3A A;  1TQU A;  1BAZ A;  3D2F A;  5TKY A;  3BSN A;  3B52 X;  2KOE A;  3NNE A;  2F18 A;  4EZQ A;  3D50 A;  3KAV A;  3BUB A;  1MYK A;  2YI9 A;  4EZY A;  2JBV A;  3CKD A;  4FM3 A;  1Q5V A;  4LQ3 A;  4JLC A;  1I4D A;  4E3C A;  3O3N B;  3I01 A;  1SU7 A;  4AZB A;  1ARQ A;  3D51 A;  2WVE A;  2OZN B;  4ME7 E;  2D1L A;  4JWC A;  3T47 A;  4UDY X;  3LVT A;  2GAF D;  3T48 A;  3I04 A;  2Z8Y A;  4G6Q A;  1Q16 A;  1BDV A;  3I39 X;  4WPC A;  3QA8 A;  1U9P A;  4IM0 A;  2JXH A;  2F1B A;  1PS3 A;  2EWF A;  1GNL A;  3LMF A;  4FZO A;  3QWE A;  1JQK A;  2Z0O A;  3OK8 A;  2X5C A;  2F7O A;  2V0O A;  1SH2 A;  2RBF A;  3BVX A;  1PAR A;  4EZR A;  1QX1 A;  4NRT A;  2AN7 A;  1OA0 A;  2EX3 B;  3B51 X; 
#chains in the Genus database with same CATH homology
 2BJ1 A;  1DKZ A;  2BJ7 A;  4IWO A;  3RV1 A;  1QTG A;  1SU6 A;  4JWD A;  5E84 A;  2K29 A;  2KEL A;  3KAW A;  4JN4 A;  2BJ3 A;  4IWQ A;  2GPE A;  4HR1 B;  3GI7 A;  2YIA A;  2WVF A;  2CAD A;  2ND1 A;  4EZZ A;  3C7N A;  2RT6 A;  4IWP A;  2JXI A;  3GXQ A;  2ND0 A;  3ERC C;  3LGH A;  2WVB A;  2QXL A;  2AY0 A;  1GN9 A;  1MNT A;  2K5J A;  2JXG A;  4FXE A;  4B9Q A;  1P94 A;  2H1O E;  3DPQ A;  3VEB A;  3QNJ A;  4R5L A;  1IRQ A;  4HYB A;  2YIB A;  3O3O B;  2WVD A;  3OD2 A;  3QOQ A;  2BNW A;  2WIN M;  4JNF A;  2OBM A;  4F00 A;  3FT7 A;  4H6H A;  3B53 X;  1BAZ A;  4IW0 A;  4EZS A;  3D2F A;  1SUF A;  2K9I A;  1B28 A;  4EZP A;  2CPG A;  3D2E A;  1ZYL A;  4HR1 A;  3T46 A;  4IM2 A;  5TKY A;  3H87 C;  1BDT A;  1DKY A;  3B52 X;  4D8J A;  2QFF A;  4R5K A;  1E9V A;  2NCZ A;  2YIV X;  4JL9 A;  4EZQ A;  1OA1 A;  3KAV A;  4E81 A;  2KHO A;  2N3K A;  1MYK A;  2BJ8 A;  3RV0 A;  3F7W A;  1SU8 A;  2YI9 A;  1GNT A;  5FIG A;  3T4A G;  3A98 A;  4EZW A;  4EZY A;  3DPO A;  1EA4 A;  2BJ9 A;  3VW4 A;  2CAX A;  4FM3 A;  1Q5V A;  4JLC A;  4F01 A;  2GA9 D;  4KIK B;  1W9M A;  3O3N B;  4E3C A;  3I01 A;  4EZX A;  1SU7 A;  3FMT A;  4UDX X;  2EX3 B;  1ARQ A;  4R5G A;  2K6L A;  4R5J A;  2K1O A;  2WVE A;  4JWE A;  3ZED A;  4EZT A;  2YI8 A;  2HZA A;  3ER9 B;  4ME7 E;  4JNE A;  4R5I A;  5FLE X;  4EZU A;  1DKX A;  4JWC A;  3T47 A;  4UDY X;  2GAF D;  3T48 A;  4HV0 A;  3I04 A;  3UIT A;  2Z8Y A;  3OHX M;  4G6Q A;  4EZN A;  1NLA A;  1UPX A;  1E1D A;  3L3O M;  1BDV A;  3I39 X;  2JNS A;  3QA8 A;  1U9P A;  3VEA A;  4IM0 A;  2JXH A;  4HY9 A;  3OWG A;  3VKH A;  1MYL A;  3ER8 C;  2BSQ E;  2EWF A;  1GNL A;  4M0M A;  4PO2 A;  3LMF A;  1B01 A;  1U00 A;  2OBL A;  3O3M B;  4JWI A;  4EZV A;  1JQK A;  3T49 A;  2CAJ A;  4H6I A;  2X5C A;  4EZO A;  4IM3 A;  2CA9 A;  2RBF A;  1PAR A;  3KDR A;  1X93 A;  2PY6 A;  3DPP A;  4EZR A;  2HZV A;  2BNZ A;  3FD9 A;  2LM0 A;  1ARR A;  1MJG A;  4NPH A;  3B51 X;  2BA3 A;  4KIK A;  1OA0 A;  2WVC A;  1E2U A;  1OAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...