1AVAC

Amy2/basi protein-protein complex from barley seed
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
181
structure length
181
Chain Sequence
ADPPPVHDTDGHELRADANYYVLSANRAHGGGLTMAPGHGRHCPLFVSQDPNGQHDGFPVRITPYGVAPSDKIIRLSTDVRISFRAYTTCLQSTEWHIDSELAAGRRHVITGPVKDPSPSGRENAFRIEKYSGAEVHEYKLMSCGDWCQDLGVFRDLKGGAWFLGATEPYHVVVFKKAPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARLEY ALPHA-AMYLASE 2(CV MENUET)
publication title Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution.
pubmed doi rcsb
molecule tags Hydrolase inhibition
total genus 38
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1avaC00
1TP0A 2D22A 2Y9WC 4HR6C 5F8WA 3MPPG 2Q9XA 1K5VA 3MALA 2K43A 3FGMA 3UD9A 3BAOA 3UD7A 3N7KA 3ZXGA 1K5UA 3UJ4A 4IY8A 2VXTI 4D0ZA 3FFZA 3CRHA 3IM6A 3FJIA 1IJTA 4GAFA 2D23A 5DSSB 5BXTA 4IQPA 2DRYA 2KKIA 3BA7A 5D62A 3JRRA 1F31A 4LO2A 31BIA 2F8XC 3AKHA 4LO2C 4KEKA 4LO8B 3I29B 3CRGA 1RMLA 5D63A 3AH4A 1CE7B 1DZDA 3CA0A 3WO2A 3C9ZA 4I1BA 3AH2A 3I2XA 1IHKA 3HSMA 3K1XA 2Z49A 1MD6A 1M16A 4P0JA 4OEGA 3FJCA 1Q03A 1ISYA 2WBCA 3CQAA 3H6QA 1S0DA 1XG6A 2I1BA 3FUQA 1IT0A 4II0A 3WMVA 1XZZA 1SR4A 2D43A 3NBCA 5FZUA 4ZA3B 2X2TA 3OBRA 4ZLBB 3IM7A 3F1RA 2GZBA 2AFGA 2K4AB 4G9NA 2Y9FA 2BEBA 2DRZA 2BEAA 3OBTA 1G9BA 3KMVA 5JMCA 3WO3A 3VUOA 4J2YA 4Z8SB 3ZC8A 2P39A 1G9CA 1S0CA 5BP5C 1S0LA 2IWTB 4X39A 3A22A 3Q7XA 4I4XA 3FJBA 3BAHA 3FJ8A 3CA3A 1FWVA 3AKGA 4EFPA 4LO0A 3CA1A 4XFTA 4A7KA 3FJJA 2WRYA 3AJ6A 4OEEA 3V79C 2VSAA 4I0YA 3BAVA 1D0HA 4LO7B 4I2SA 1Z0HA 3F62B 1HWMB 1HWPB 2AXMA 4JQ0A 4AN6A 2XOAA 2KI6B 2R9KB 2KH2A 4QC4A 4QO3A 1XHBA 1AVXB 4XFUA 3I2AA 4XFSA 5FZYA 2K8RA 1HKNA 1FWUA 1JY0A 4R6UB 5BXPA 2HWAA 1G9AA 2HWMA 4DENA 4DEPA 1GGPB 1ISVA 1V6VA 3HOMA 3IAGC 5JLVA 4EFQA 2QN4A 4OWLA 3BADA 3LTQA 3N7LA 1JQZA 2VSEA 1OQLB 2VLCA 1PUMB 4LO3C 4ZOTA 2RSTA 1E0OA 4LO1A 3H6RA 2HZ9A 4TLPA 1UPSA 3BTAA 5GAQA 3IIRA 4GP0A 1JT4A 1WBCA 5FZZA 1W3GA 3VT1A 2ESUA 1PWAA 1FMMS 2VU9A 2NZ9A 3AZVA 1W3FA 3BAUA 2ZQNA 1II4A 2QYIB 3TC2A 1FMZA 4P0KA 41BIA 4USPA 3Q7YA 1AVAC 3VT2A 1BLDA 4IZXA 1JT3A 1T9FA 4JRAA 1RZOB 3HN1A 3AKFA 3H6RB 3B9UA 3A07A 3AH1A 4I4VA 4OWJA 4X3AA 3CU1B 1JT7A 2ERMA 4I4SA 5B2HA 3WMUA 1ISZA 5DVHA 4ZFYB 3OGGA 1Q1UA 1PC8B 4L4IA 1TWMA 1HWOB 4J23B 3O4CA 4KBBA 4QD2C 4F83A 9ILBA 1TOOA 1AXMA 3CA6A 2ET2A 2NVHA 2NP0A 3OGFA 4QALA 1TTUA 1S0EA 2NTDA 4XKIA 1AF9A 4AN7B 5BXRA 3FJFA 4J2XA 4H04A 3VEQA 2J3PA 4OEFA 3O4OA 1DIWA 3FJAA 1V6XA 3BRFA 1R8NA 4ZFUB 3V0AA 4QBCA 4L4HA 1FGAA 2YUGA 1FV2A 5I1BA 3JUTA 1TIEA 4I4QA 3P6IA 1DFQA 1WBAA 3VWCA 4F34A 3WO4A 2BFHA 2D1ZA 4X38A 2VXRA 3NBNA 4H9WA 3HMYA 5BP5A 2IHOA 3ILAA 5F8YA 1IRPA 2F2FA 2GO2A 3E8LC 2Y9GA 1IOBA 2F2FC 3SNVA 1PZZA 4I4OA 3UD8A 4IZEA 4D8HA 1ISXA 3QR5A 1WD4A 3O4AA 4Q91A 2E4MA 4JP0A 2X2SA 4KEJA 2VUAA 2E4MC 5EC5A 1JT5A 3BRGC 3NJ5A 4HA2A 2D7IA 3FUOA 3WA1A 4HJJA 1R8OA 6I1BA 3N0KA 3FJKA 2FDBM 5DZUA 3RMXA 1DZCA 1BFBA 3FJDA 1DQOA 4KC3A 3OJ2A 7I1BA 3OJVA 4FVVA 4I4RA 2P23A 2Z48A 3O49A 4OWKA 4EFRA 3R4SA 4FGFA 3AJ5A 1Z4SA 2AQZA 4ZFWB 2D20A 3O4DA 4J2KA 4LO3A 1Q04A 3W9TA 2M49A 2LIEA 2NM1A 3LLPA 4WBCA 4I6IA 1S0GA 2MLLB 8I1BA 3RTJB 4JKQA 1T4QA 3BX1C 3RSJA 1FQ9A 4I1EA 1I1EA 3BB2A 5BQUC 1S0FA 3P6JA 4GOYA 3A23A 5FNWA 3HBWA 2NYYA 4A7YA 4Q9GA 3S8JA 3CAHA 5E24E 4QKSA 5EHAA 1YF8B 3VT0A 2MIBA 3PG0A 4ZKTB 3BA5A 1BFGA 1V6WA 4EEEB 3O5WB 1AVUA 4P0LA 2RQ9A 1A8DA 1HWNB 1N4KA 3Q7WA 1IILA 2FFVA 2AAIB 1J0SA 3O4BA 4Z9WB 5HPZA 2LIQA 3VSFA 4OUJA 4DCKC 1JLXA 1ILR1 1IRAX 2DS0A 4Q9PA 3BA4A 1DJSB 3RTIB 1ITBA 3WINA 1BLAA 1ONKB 3O3QA 3WINC 1CVSA 4I37A 1HIBA 3POKA 4ZBVB 3ZX7A 1BFFA 3FJHA 3HALA 4OW4A 1QQKA 1YTOA 4I4PA 2FFUA 1SZ6B 1DFCA 3PUBA 1NUNA 3P53A 1G82A 3PMEA 2ZQOA 1YBIA 4QD2B 4ZGRB 1EV2A 4X37A 4EB2B 2D44A 3RMYA 2D24A 1TWEA 3NBDA 1RG8A 1YYNA 4IY9A 4GOVA 1QQLA 1EYLA 5D61A 2UUSA 1NZKA 4J2SA 4PC4A 3UJ0A 5G00A 3ZC9A 1QXMA 3AZWA 1I1BA 4EKXB 1SR4C 4IYBA 5BVPI 3D7WB 4QBVA 4YOLA 5F8SA 5EG6C 4P6AA 1KNMA 1JLYA 3A21A 3QYDA 3O44A 3EF2A 4GAIA 1YXWA 3V0AB 1JTCA 3R4UA 3FJ9A 4G6MA 3CA5A 3V0BA 4LO7C 2FGFA 2Y9XE 3CA4A 3ZXDA 1BFCA 4ISQA 4JKXB 4G1RA 1BARA 3OJMA 1M2TB 4IHZA 3IM5A 3NBEA 4A7ZA 1G9DA 1WD3A 1V6UA 4I3NA 3AKIA 2FO1A 2MC2A 3UDAA 1HCEA 5DUYA 1P63A 1HCDA 1AFCA 1BASA 21BIA 3N7JA 3FJEA 2L5XA 3BAGA 4LO0C 1BA7A 2Q3NB 2HW9A 4CJMA 4D0TA 1MC9A 4I4YA 3V0BB 1FN0A 4QKRA 4USOA 1Z2VA 1DQGA 3T8SA 1EPWA 2DREA 1L2HA 4ISRA 5FNXA 4G6JA 2ZR1B 3VSZA 2KLLA 1ISWA 1DLLA 3PHZA 2RG9B 4G9MA 5BQUA 1W3AA 4I7IA 1S0BA 4JAWA 1XYFA 2D7RA 3BRDA 5F90A 4I96A 3H6SE 4LO1C 1AVWB 3CRIA 4KEIA 2KI4A 1VCLA 1FV3A 1PUUB 4I4UA 4ENDA 1EVTA 4JPZA 5BXSA 4I8MA 5BOWA 3S8KA 1RY7A 1ABRB 4GP3A 4IONA 3BAQA 3N7MA 1TFMB
chains in the Genus database with same CATH superfamily
1TP0A 2D22A 2Y9WC 4HR6C 5F8WA 3MPPG 2Q9XA 1K5VA 3MALA 2K43A 3FGMA 3UD9A 3BAOA 3UD7A 3N7KA 3ZXGA 1K5UA 3UJ4A 4IY8A 2VXTI 4D0ZA 3FFZA 3CRHA 3IM6A 3FJIA 1IJTA 4GAFA 2D23A 5DSSB 5BXTA 4IQPA 2DRYA 2KKIA 3BA7A 5D62A 3JRRA 1F31A 4LO2A 31BIA 2F8XC 3AKHA 4LO2C 4KEKA 4LO8B 3I29B 3CRGA 1RMLA 5D63A 3AH4A 1CE7B 1DZDA 4MZGB 3CA0A 3WO2A 3C9ZA 4I1BA 3AH2A 3I2XA 1IHKA 3HSMA 3K1XA 2Z49A 1MD6A 1M16A 4P0JA 4OEGA 3FJCA 1Q03A 1ISYA 2WBCA 3CQAA 3H6QA 1S0DA 1XG6A 2I1BA 3FUQA 1IT0A 4II0A 3WMVA 1XZZA 1SR4A 2D43A 3NBCA 5FZUA 4ZA3B 2X2TA 3OBRA 4ZLBB 3IM7A 3F1RA 2GZBA 2AFGA 2K4AB 4G9NA 2Y9FA 2BEBA 2DRZA 2BEAA 3OBTA 1G9BA 3KMVA 5JMCA 3WO3A 3VUOA 4J2YA 4Z8SB 3ZC8A 2P39A 1G9CA 1S0CA 5BP5C 1S0LA 2IWTB 4X39A 3A22A 3Q7XA 4I4XA 3FJBA 3BAHA 3FJ8A 3CA3A 4UY4A 1FWVA 3AKGA 4EFPA 4LO0A 3CA1A 4XFTA 4A7KA 3FJJA 2WRYA 3AJ6A 4OEEA 3V79C 2VSAA 4I0YA 3BAVA 1D0HA 4LO7B 4I2SA 1Z0HA 3F62B 1HWMB 1HWPB 2AXMA 4JQ0A 4AN6A 2XOAA 2KI6B 2R9KB 2KH2A 4QC4A 4QO3A 1XHBA 1AVXB 4XFUA 3I2AA 4XFSA 5FZYA 2K8RA 1HKNA 1FWUA 1JY0A 4R6UB 5BXPA 2HWAA 1G9AA 2HWMA 4DENA 4DEPA 1GGPB 1ISVA 1V6VA 3HOMA 3IAGC 5JLVA 4EFQA 2QN4A 4OWLA 3BADA 3LTQA 3N7LA 1JQZA 2VSEA 1OQLB 2VLCA 1PUMB 4LO3C 4ZOTA 2RSTA 1E0OA 4LO1A 3H6RA 2HZ9A 4TLPA 1UPSA 3BTAA 5GAQA 3IIRA 4GP0A 1JT4A 1WBCA 5FZZA 1W3GA 3VT1A 2ESUA 1PWAA 1FMMS 2VU9A 2NZ9A 3AZVA 1W3FA 3BAUA 2ZQNA 1II4A 2QYIB 3TC2A 1FMZA 4P0KA 41BIA 4USPA 3Q7YA 1AVAC 3VT2A 1BLDA 4IZXA 1JT3A 1T9FA 4JRAA 1RZOB 3HN1A 3AKFA 3H6RB 3B9UA 3A07A 3AH1A 4I4VA 4OWJA 4X3AA 3CU1B 1JT7A 2ERMA 4I4SA 5B2HA 3WMUA 1ISZA 5DVHA 4ZFYB 3OGGA 1Q1UA 1PC8B 4L4IA 1TWMA 1HWOB 4J23B 3O4CA 4KBBA 4QD2C 4F83A 9ILBA 1TOOA 1AXMA 3CA6A 2ET2A 2NVHA 2NP0A 3OGFA 4QALA 1TTUA 1S0EA 2NTDA 4XKIA 1AF9A 4AN7B 5BXRA 3FJFA 4J2XA 4H04A 3VEQA 2J3PA 4OEFA 3O4OA 1DIWA 3FJAA 1V6XA 4MZFB 3BRFA 1R8NA 4ZFUB 3V0AA 4QBCA 4L4HA 1FGAA 2YUGA 1FV2A 5I1BA 3JUTA 1TIEA 4I4QA 3P6IA 1DFQA 1WBAA 3VWCA 4F34A 3WO4A 2BFHA 2D1ZA 4X38A 2VXRA 3NBNA 4H9WA 3HMYA 5BP5A 2IHOA 3ILAA 5F8YA 1IRPA 2F2FA 2GO2A 3E8LC 2Y9GA 1IOBA 2F2FC 3SNVA 1PZZA 4I4OA 3UD8A 4IZEA 4D8HA 1ISXA 3QR5A 1WD4A 3O4AA 4Q91A 2E4MA 4JP0A 2X2SA 4KEJA 2VUAA 2E4MC 5EC5A 1JT5A 3BRGC 3NJ5A 4HA2A 2D7IA 3FUOA 3WA1A 4HJJA 1R8OA 6I1BA 3N0KA 3FJKA 2FDBM 5DZUA 3RMXA 1DZCA 1BFBA 3FJDA 1DQOA 4KC3A 3OJ2A 7I1BA 3OJVA 4FVVA 4I4RA 2P23A 2Z48A 3O49A 4OWKA 4H75A 4EFRA 3R4SA 4FGFA 3AJ5A 1Z4SA 2AQZA 4ZFWB 2D20A 3O4DA 4J2KA 4LO3A 1Q04A 3W9TA 2M49A 2LIEA 2NM1A 3LLPA 4WBCA 4I6IA 1S0GA 2MLLB 8I1BA 3RTJB 4JKQA 1T4QA 3BX1C 3RSJA 1FQ9A 4I1EA 1I1EA 3BB2A 5BQUC 1S0FA 3P6JA 4GOYA 3A23A 4MZHA 5FNWA 3HBWA 2NYYA 4A7YA 4Q9GA 3S8JA 3CAHA 5E24E 4QKSA 5EHAA 1YF8B 3VT0A 2MIBA 3PG0A 4ZKTB 3BA5A 1BFGA 1V6WA 4EEEB 3O5WB 1AVUA 4P0LA 2RQ9A 1A8DA 1HWNB 1N4KA 3Q7WA 1IILA 2FFVA 2AAIB 1J0SA 3O4BA 4Z9WB 5HPZA 2LIQA 3VSFA 4OUJA 4DCKC 1JLXA 1ILR1 1IRAX 2DS0A 4Q9PA 3BA4A 1DJSB 3RTIB 1ITBA 3WINA 1BLAA 1ONKB 3O3QA 3WINC 1CVSA 4I37A 1HIBA 3POKA 4ZBVB 3ZX7A 1BFFA 3FJHA 3HALA 4OW4A 1QQKA 1YTOA 4I4PA 2FFUA 1SZ6B 1DFCA 3PUBA 1NUNA 3P53A 1G82A 3PMEA 2ZQOA 1YBIA 4QD2B 4ZGRB 1EV2A 4X37A 4EB2B 2D44A 3RMYA 2D24A 1TWEA 3NBDA 1RG8A 1YYNA 4IY9A 4GOVA 1QQLA 1EYLA 5D61A 2UUSA 1NZKA 4J2SA 4PC4A 3UJ0A 5G00A 3ZC9A 1QXMA 3AZWA 1I1BA 4EKXB 2NS2A 1SR4C 4IYBA 5BVPI 3D7WB 4QBVA 4YOLA 5F8SA 5EG6C 4P6AA 1KNMA 1JLYA 3A21A 3QYDA 3O44A 3EF2A 4GAIA 1YXWA 3V0AB 1JTCA 3R4UA 3FJ9A 4G6MA 3CA5A 3V0BA 4LO7C 2FGFA 2Y9XE 3CA4A 3ZXDA 1BFCA 4ISQA 4JKXB 4G1RA 1BARA 3OJMA 1M2TB 4IHZA 3IM5A 3NBEA 4A7ZA 1G9DA 1WD3A 1V6UA 4I3NA 3AKIA 2FO1A 2MC2A 3UDAA 1HCEA 5DUYA 1P63A 1HCDA 1AFCA 1BASA 21BIA 3N7JA 3FJEA 2L5XA 3BAGA 4LO0C 1BA7A 2Q3NB 2HW9A 4CJMA 4D0TA 1MC9A 4I4YA 3V0BB 1FN0A 4QKRA 4USOA 1Z2VA 1DQGA 3T8SA 1EPWA 2DREA 1L2HA 4ISRA 5FNXA 4G6JA 2ZR1B 3VSZA 2KLLA 1ISWA 1DLLA 3PHZA 2RG9B 4G9MA 5BQUA 1W3AA 4I7IA 1S0BA 4JAWA 1XYFA 2D7RA 3BRDA 5F90A 4I96A 3H6SE 4LO1C 1AVWB 3CRIA 4KEIA 2KI4A 1VCLA 1FV3A 1PUUB 4I4UA 4ENDA 1EVTA 4JPZA 5BXSA 4I8MA 5BOWA 3S8KA 1RY7A 1ABRB 4GP3A 4IONA 3BAQA 3N7MA 1TFMB
chains in the Genus database with same CATH topology
1TP0A 2D22A 2Y9WC 4HR6C 5F8WA 3MPPG 2Q9XA 1K5VA 3MALA 2K43A 3FGMA 3UD9A 3BAOA 3UD7A 3N7KA 3ZXGA 1K5UA 3UJ4A 4IY8A 2VXTI 4D0ZA 3FFZA 3CRHA 3IM6A 3FJIA 1IJTA 4GAFA 2D23A 5DSSB 5BXTA 4IQPA 2DRYA 2KKIA 3BA7A 5D62A 3JRRA 1F31A 4LO2A 31BIA 2F8XC 3AKHA 4LO2C 4KEKA 4LO8B 3I29B 3CRGA 1RMLA 5D63A 3AH4A 1CE7B 1DZDA 4MZGB 3CA0A 3WO2A 3C9ZA 4I1BA 3AH2A 3I2XA 1IHKA 3HSMA 3K1XA 2Z49A 1MD6A 1M16A 4P0JA 4OEGA 3FJCA 1Q03A 1ISYA 2WBCA 3CQAA 3H6QA 1S0DA 1XG6A 2I1BA 3FUQA 1IT0A 4II0A 3WMVA 1XZZA 1SR4A 2D43A 3NBCA 5FZUA 4ZA3B 2X2TA 3OBRA 4ZLBB 3IM7A 3F1RA 2GZBA 2AFGA 2K4AB 4G9NA 2Y9FA 2BEBA 2DRZA 2BEAA 3OBTA 1G9BA 3KMVA 5JMCA 3WO3A 3VUOA 4J2YA 4Z8SB 3ZC8A 2P39A 1G9CA 1S0CA 5BP5C 1S0LA 2IWTB 4X39A 3A22A 3Q7XA 4I4XA 3FJBA 3BAHA 3FJ8A 3CA3A 4UY4A 1FWVA 3AKGA 4EFPA 4LO0A 3CA1A 4XFTA 4A7KA 3FJJA 2WRYA 3AJ6A 4OEEA 3V79C 2VSAA 4I0YA 3BAVA 1D0HA 4LO7B 4I2SA 1Z0HA 3F62B 1HWMB 1HWPB 2AXMA 4JQ0A 4AN6A 2XOAA 2KI6B 2R9KB 2KH2A 4QC4A 4QO3A 1XHBA 1AVXB 4XFUA 3I2AA 4XFSA 5FZYA 2K8RA 1HKNA 1FWUA 1JY0A 4R6UB 5BXPA 2HWAA 1G9AA 2HWMA 4DENA 4DEPA 1GGPB 1ISVA 1V6VA 3HOMA 3IAGC 5JLVA 4EFQA 2QN4A 4OWLA 3BADA 3LTQA 3N7LA 1JQZA 2VSEA 1OQLB 2VLCA 1PUMB 4LO3C 4ZOTA 2RSTA 1E0OA 4LO1A 3H6RA 2HZ9A 4TLPA 1UPSA 3BTAA 5GAQA 3IIRA 4GP0A 1JT4A 1WBCA 5FZZA 1W3GA 3VT1A 2ESUA 1PWAA 1FMMS 2VU9A 2NZ9A 3AZVA 1W3FA 3BAUA 2ZQNA 1II4A 2QYIB 3TC2A 1FMZA 4P0KA 41BIA 4USPA 3Q7YA 1AVAC 3VT2A 1BLDA 4IZXA 1JT3A 1T9FA 4JRAA 1RZOB 3HN1A 3AKFA 3H6RB 3B9UA 3A07A 3AH1A 4I4VA 4OWJA 4X3AA 3CU1B 1JT7A 2ERMA 4I4SA 5B2HA 3WMUA 1ISZA 5DVHA 4ZFYB 3OGGA 1Q1UA 1PC8B 4L4IA 1TWMA 1HWOB 4J23B 3O4CA 4KBBA 4QD2C 4F83A 9ILBA 1TOOA 1AXMA 3CA6A 2ET2A 2NVHA 2NP0A 3OGFA 4QALA 1TTUA 1S0EA 2NTDA 4XKIA 1AF9A 4AN7B 5BXRA 3FJFA 4J2XA 4H04A 3VEQA 2J3PA 4OEFA 3O4OA 1DIWA 3FJAA 1V6XA 4MZFB 3BRFA 1R8NA 4ZFUB 3V0AA 4QBCA 4L4HA 1FGAA 2YUGA 1FV2A 5I1BA 3JUTA 1TIEA 4I4QA 3P6IA 1DFQA 1WBAA 3VWCA 4F34A 3WO4A 2BFHA 2D1ZA 4X38A 2VXRA 3NBNA 4H9WA 3HMYA 5BP5A 2IHOA 3ILAA 5F8YA 1IRPA 2F2FA 2GO2A 3E8LC 2Y9GA 1IOBA 2F2FC 3SNVA 1PZZA 4I4OA 3UD8A 4IZEA 4D8HA 1ISXA 3QR5A 1WD4A 3O4AA 4Q91A 2E4MA 4JP0A 2X2SA 4KEJA 2VUAA 2E4MC 5EC5A 1JT5A 3BRGC 3NJ5A 4HA2A 2D7IA 3FUOA 3WA1A 4HJJA 1R8OA 6I1BA 3N0KA 3FJKA 2FDBM 5DZUA 3RMXA 1DZCA 1BFBA 3FJDA 1DQOA 4KC3A 3OJ2A 7I1BA 3OJVA 4FVVA 4I4RA 2P23A 2Z48A 3O49A 4OWKA 4H75A 4EFRA 3R4SA 4FGFA 3AJ5A 1Z4SA 2AQZA 4ZFWB 2D20A 3O4DA 4J2KA 4LO3A 1Q04A 3W9TA 2M49A 2LIEA 2NM1A 3LLPA 4WBCA 4I6IA 1S0GA 2MLLB 8I1BA 3RTJB 4JKQA 1T4QA 3BX1C 3RSJA 1FQ9A 4I1EA 1I1EA 3BB2A 5BQUC 1S0FA 3P6JA 4GOYA 3A23A 4MZHA 5FNWA 3HBWA 2NYYA 4A7YA 4Q9GA 3S8JA 3CAHA 5E24E 4QKSA 5EHAA 1YF8B 3VT0A 2MIBA 3PG0A 4ZKTB 3BA5A 1BFGA 1V6WA 4EEEB 3O5WB 1AVUA 4P0LA 2RQ9A 1A8DA 1HWNB 1N4KA 3Q7WA 1IILA 2FFVA 2AAIB 1J0SA 3O4BA 4Z9WB 5HPZA 2LIQA 3VSFA 4OUJA 4DCKC 1JLXA 1ILR1 1IRAX 2DS0A 4Q9PA 3BA4A 1DJSB 3RTIB 1ITBA 3WINA 1BLAA 1ONKB 3O3QA 3WINC 1CVSA 4I37A 1HIBA 3POKA 4ZBVB 3ZX7A 1BFFA 3FJHA 3HALA 4OW4A 1QQKA 1YTOA 4I4PA 2FFUA 1SZ6B 1DFCA 3PUBA 1NUNA 3P53A 1G82A 3PMEA 2ZQOA 1YBIA 4QD2B 4ZGRB 1EV2A 4X37A 4EB2B 2D44A 3RMYA 2D24A 1TWEA 3NBDA 1RG8A 1YYNA 4IY9A 4GOVA 1QQLA 1EYLA 5D61A 2UUSA 1NZKA 4J2SA 4PC4A 3UJ0A 5G00A 3ZC9A 1QXMA 3AZWA 1I1BA 4EKXB 2NS2A 1SR4C 4IYBA 5BVPI 3D7WB 4QBVA 4YOLA 5F8SA 5EG6C 4P6AA 1KNMA 1JLYA 3A21A 3QYDA 3O44A 3EF2A 4GAIA 1YXWA 3V0AB 1JTCA 3R4UA 3FJ9A 4G6MA 3CA5A 3V0BA 4LO7C 2FGFA 2Y9XE 3CA4A 3ZXDA 1BFCA 4ISQA 4JKXB 4G1RA 1BARA 3OJMA 1M2TB 4IHZA 3IM5A 3NBEA 4A7ZA 1G9DA 1WD3A 1V6UA 4I3NA 3AKIA 2FO1A 2MC2A 3UDAA 1HCEA 5DUYA 1P63A 1HCDA 1AFCA 1BASA 21BIA 3N7JA 3FJEA 2L5XA 3BAGA 4LO0C 1BA7A 2Q3NB 2HW9A 4CJMA 4D0TA 1MC9A 4I4YA 3V0BB 1FN0A 4QKRA 4USOA 1Z2VA 1DQGA 3T8SA 1EPWA 2DREA 1L2HA 4ISRA 5FNXA 4G6JA 2ZR1B 3VSZA 2KLLA 1ISWA 1DLLA 3PHZA 2RG9B 4G9MA 5BQUA 1W3AA 4I7IA 1S0BA 4JAWA 1XYFA 2D7RA 3BRDA 5F90A 4I96A 3H6SE 4LO1C 1AVWB 3CRIA 4KEIA 2KI4A 1VCLA 1FV3A 1PUUB 4I4UA 4ENDA 1EVTA 4JPZA 5BXSA 4I8MA 5BOWA 3S8KA 1RY7A 1ABRB 4GP3A 4IONA 3BAQA 3N7MA 1TFMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP0 A;  2D22 A;  2Y9W C;  4HR6 C;  5F8W A;  3MPP G;  2Q9X A;  1K5V A;  3MAL A;  2K43 A;  3FGM A;  3UD9 A;  3BAO A;  3UD7 A;  3N7K A;  3ZXG A;  1K5U A;  3UJ4 A;  4IY8 A;  2VXT I;  4D0Z A;  3FFZ A;  3CRH A;  3IM6 A;  3FJI A;  1IJT A;  4GAF A;  2D23 A;  5DSS B;  5BXT A;  4IQP A;  2DRY A;  2KKI A;  3BA7 A;  5D62 A;  3JRR A;  1F31 A;  4LO2 A;  31BI A;  2F8X C;  3AKH A;  4LO2 C;  4KEK A;  4LO8 B;  3I29 B;  3CRG A;  1RML A;  5D63 A;  3AH4 A;  1CE7 B;  1DZD A;  3CA0 A;  3WO2 A;  3C9Z A;  4I1B A;  3AH2 A;  3I2X A;  1IHK A;  3HSM A;  3K1X A;  2Z49 A;  1MD6 A;  1M16 A;  4P0J A;  4OEG A;  3FJC A;  1Q03 A;  1ISY A;  2WBC A;  3CQA A;  3H6Q A;  1S0D A;  1XG6 A;  2I1B A;  3FUQ A;  1IT0 A;  4II0 A;  3WMV A;  1XZZ A;  1SR4 A;  2D43 A;  3NBC A;  5FZU A;  4ZA3 B;  2X2T A;  3OBR A;  4ZLB B;  3IM7 A;  3F1R A;  2GZB A;  2AFG A;  2K4A B;  4G9N A;  2Y9F A;  2BEB A;  2DRZ A;  2BEA A;  3OBT A;  1G9B A;  3KMV A;  5JMC A;  3WO3 A;  3VUO A;  4J2Y A;  4Z8S B;  3ZC8 A;  2P39 A;  1G9C A;  1S0C A;  5BP5 C;  1S0L A;  2IWT B;  4X39 A;  3A22 A;  3Q7X A;  4I4X A;  3FJB A;  3BAH A;  3FJ8 A;  3CA3 A;  1FWV A;  3AKG A;  4EFP A;  4LO0 A;  3CA1 A;  4XFT A;  4A7K A;  3FJJ A;  2WRY A;  3AJ6 A;  4OEE A;  3V79 C;  2VSA A;  4I0Y A;  3BAV A;  1D0H A;  4LO7 B;  4I2S A;  1Z0H A;  3F62 B;  1HWM B;  1HWP B;  2AXM A;  4JQ0 A;  4AN6 A;  2XOA A;  2KI6 B;  2R9K B;  2KH2 A;  4QC4 A;  4QO3 A;  1XHB A;  1AVX B;  4XFU A;  3I2A A;  4XFS A;  5FZY A;  2K8R A;  1HKN A;  1FWU A;  1JY0 A;  4R6U B;  5BXP A;  2HWA A;  1G9A A;  2HWM A;  4DEN A;  4DEP A;  1GGP B;  1ISV A;  1V6V A;  3HOM A;  3IAG C;  5JLV A;  4EFQ A;  2QN4 A;  4OWL A;  3BAD A;  3LTQ A;  3N7L A;  1JQZ A;  2VSE A;  1OQL B;  2VLC A;  1PUM B;  4LO3 C;  4ZOT A;  2RST A;  1E0O A;  4LO1 A;  3H6R A;  2HZ9 A;  4TLP A;  1UPS A;  3BTA A;  5GAQ A;  3IIR A;  4GP0 A;  1JT4 A;  1WBC A;  5FZZ A;  1W3G A;  3VT1 A;  2ESU A;  1PWA A;  1FMM S;  2VU9 A;  2NZ9 A;  3AZV A;  1W3F A;  3BAU A;  2ZQN A;  1II4 A;  2QYI B;  3TC2 A;  1FMZ A;  4P0K A;  41BI A;  4USP A;  3Q7Y A;  1AVA C;  3VT2 A;  1BLD A;  4IZX A;  1JT3 A;  1T9F A;  4JRA A;  1RZO B;  3HN1 A;  3AKF A;  3H6R B;  3B9U A;  3A07 A;  3AH1 A;  4I4V A;  4OWJ A;  4X3A A;  3CU1 B;  1JT7 A;  2ERM A;  4I4S A;  5B2H A;  3WMU A;  1ISZ A;  5DVH A;  4ZFY B;  3OGG A;  1Q1U A;  1PC8 B;  4L4I A;  1TWM A;  1HWO B;  4J23 B;  3O4C A;  4KBB A;  4QD2 C;  4F83 A;  9ILB A;  1TOO A;  1AXM A;  3CA6 A;  2ET2 A;  2NVH A;  2NP0 A;  3OGF A;  4QAL A;  1TTU A;  1S0E A;  2NTD A;  4XKI A;  1AF9 A;  4AN7 B;  5BXR A;  3FJF A;  4J2X A;  4H04 A;  3VEQ A;  2J3P A;  4OEF A;  3O4O A;  1DIW A;  3FJA A;  1V6X A;  3BRF A;  1R8N A;  4ZFU B;  3V0A A;  4QBC A;  4L4H A;  1FGA A;  2YUG A;  1FV2 A;  5I1B A;  3JUT A;  1TIE A;  4I4Q A;  3P6I A;  1DFQ A;  1WBA A;  3VWC A;  4F34 A;  3WO4 A;  2BFH A;  2D1Z A;  4X38 A;  2VXR A;  3NBN A;  4H9W A;  3HMY A;  5BP5 A;  2IHO A;  3ILA A;  5F8Y A;  1IRP A;  2F2F A;  2GO2 A;  3E8L C;  2Y9G A;  1IOB A;  2F2F C;  3SNV A;  1PZZ A;  4I4O A;  3UD8 A;  4IZE A;  4D8H A;  1ISX A;  3QR5 A;  1WD4 A;  3O4A A;  4Q91 A;  2E4M A;  4JP0 A;  2X2S A;  4KEJ A;  2VUA A;  2E4M C;  5EC5 A;  1JT5 A;  3BRG C;  3NJ5 A;  4HA2 A;  2D7I A;  3FUO A;  3WA1 A;  4HJJ A;  1R8O A;  6I1B A;  3N0K A;  3FJK A;  2FDB M;  5DZU A;  3RMX A;  1DZC A;  1BFB A;  3FJD A;  1DQO A;  4KC3 A;  3OJ2 A;  7I1B A;  3OJV A;  4FVV A;  4I4R A;  2P23 A;  2Z48 A;  3O49 A;  4OWK A;  4EFR A;  3R4S A;  4FGF A;  3AJ5 A;  1Z4S A;  2AQZ A;  4ZFW B;  2D20 A;  3O4D A;  4J2K A;  4LO3 A;  1Q04 A;  3W9T A;  2M49 A;  2LIE A;  2NM1 A;  3LLP A;  4WBC A;  4I6I A;  1S0G A;  2MLL B;  8I1B A;  3RTJ B;  4JKQ A;  1T4Q A;  3BX1 C;  3RSJ A;  1FQ9 A;  4I1E A;  1I1E A;  3BB2 A;  5BQU C;  1S0F A;  3P6J A;  4GOY A;  3A23 A;  5FNW A;  3HBW A;  2NYY A;  4A7Y A;  4Q9G A;  3S8J A;  3CAH A;  5E24 E;  4QKS A;  5EHA A;  1YF8 B;  3VT0 A;  2MIB A;  3PG0 A;  4ZKT B;  3BA5 A;  1BFG A;  1V6W A;  4EEE B;  3O5W B;  1AVU A;  4P0L A;  2RQ9 A;  1A8D A;  1HWN B;  1N4K A;  3Q7W A;  1IIL A;  2FFV A;  2AAI B;  1J0S A;  3O4B A;  4Z9W B;  5HPZ A;  2LIQ A;  3VSF A;  4OUJ A;  4DCK C;  1JLX A;  1ILR 1;  1IRA X;  2DS0 A;  4Q9P A;  3BA4 A;  1DJS B;  3RTI B;  1ITB A;  3WIN A;  1BLA A;  1ONK B;  3O3Q A;  3WIN C;  1CVS A;  4I37 A;  1HIB A;  3POK A;  4ZBV B;  3ZX7 A;  1BFF A;  3FJH A;  3HAL A;  4OW4 A;  1QQK A;  1YTO A;  4I4P A;  2FFU A;  1SZ6 B;  1DFC A;  3PUB A;  1NUN A;  3P53 A;  1G82 A;  3PME A;  2ZQO A;  1YBI A;  4QD2 B;  4ZGR B;  1EV2 A;  4X37 A;  4EB2 B;  2D44 A;  3RMY A;  2D24 A;  1TWE A;  3NBD A;  1RG8 A;  1YYN A;  4IY9 A;  4GOV A;  1QQL A;  1EYL A;  5D61 A;  2UUS A;  1NZK A;  4J2S A;  4PC4 A;  3UJ0 A;  5G00 A;  3ZC9 A;  1QXM A;  3AZW A;  1I1B A;  4EKX B;  1SR4 C;  4IYB A;  5BVP I;  3D7W B;  4QBV A;  4YOL A;  5F8S A;  5EG6 C;  4P6A A;  1KNM A;  1JLY A;  3A21 A;  3QYD A;  3O44 A;  3EF2 A;  4GAI A;  1YXW A;  3V0A B;  1JTC A;  3R4U A;  3FJ9 A;  4G6M A;  3CA5 A;  3V0B A;  4LO7 C;  2FGF A;  2Y9X E;  3CA4 A;  3ZXD A;  1BFC A;  4ISQ A;  4JKX B;  4G1R A;  1BAR A;  3OJM A;  1M2T B;  4IHZ A;  3IM5 A;  3NBE A;  4A7Z A;  1G9D A;  1WD3 A;  1V6U A;  4I3N A;  3AKI A;  2FO1 A;  2MC2 A;  3UDA A;  1HCE A;  5DUY A;  1P63 A;  1HCD A;  1AFC A;  1BAS A;  21BI A;  3N7J A;  3FJE A;  2L5X A;  3BAG A;  4LO0 C;  1BA7 A;  2Q3N B;  2HW9 A;  4CJM A;  4D0T A;  1MC9 A;  4I4Y A;  3V0B B;  1FN0 A;  4QKR A;  4USO A;  1Z2V A;  1DQG A;  3T8S A;  1EPW A;  2DRE A;  1L2H A;  4ISR A;  5FNX A;  4G6J A;  2ZR1 B;  3VSZ A;  2KLL A;  1ISW A;  1DLL A;  3PHZ A;  2RG9 B;  4G9M A;  5BQU A;  1W3A A;  4I7I A;  1S0B A;  4JAW A;  1XYF A;  2D7R A;  3BRD A;  5F90 A;  4I96 A;  3H6S E;  4LO1 C;  1AVW B;  3CRI A;  4KEI A;  2KI4 A;  1VCL A;  1FV3 A;  1PUU B;  4I4U A;  4END A;  1EVT A;  4JPZ A;  5BXS A;  4I8M A;  5BOW A;  3S8K A;  1RY7 A;  1ABR B;  4GP3 A;  4ION A;  3BAQ A;  3N7M A;  1TFM B; 
#chains in the Genus database with same CATH topology
 1TP0 A;  2D22 A;  2Y9W C;  4HR6 C;  5F8W A;  3MPP G;  2Q9X A;  1K5V A;  3MAL A;  2K43 A;  3FGM A;  3UD9 A;  3BAO A;  3UD7 A;  3N7K A;  3ZXG A;  1K5U A;  3UJ4 A;  4IY8 A;  2VXT I;  4D0Z A;  3FFZ A;  3CRH A;  3IM6 A;  3FJI A;  1IJT A;  4GAF A;  2D23 A;  5DSS B;  5BXT A;  4IQP A;  2DRY A;  2KKI A;  3BA7 A;  5D62 A;  3JRR A;  1F31 A;  4LO2 A;  31BI A;  2F8X C;  3AKH A;  4LO2 C;  4KEK A;  4LO8 B;  3I29 B;  3CRG A;  1RML A;  5D63 A;  3AH4 A;  1CE7 B;  1DZD A;  4MZG B;  3CA0 A;  3WO2 A;  3C9Z A;  4I1B A;  3AH2 A;  3I2X A;  1IHK A;  3HSM A;  3K1X A;  2Z49 A;  1MD6 A;  1M16 A;  4P0J A;  4OEG A;  3FJC A;  1Q03 A;  1ISY A;  2WBC A;  3CQA A;  3H6Q A;  1S0D A;  1XG6 A;  2I1B A;  3FUQ A;  1IT0 A;  4II0 A;  3WMV A;  1XZZ A;  1SR4 A;  2D43 A;  3NBC A;  5FZU A;  4ZA3 B;  2X2T A;  3OBR A;  4ZLB B;  3IM7 A;  3F1R A;  2GZB A;  2AFG A;  2K4A B;  4G9N A;  2Y9F A;  2BEB A;  2DRZ A;  2BEA A;  3OBT A;  1G9B A;  3KMV A;  5JMC A;  3WO3 A;  3VUO A;  4J2Y A;  4Z8S B;  3ZC8 A;  2P39 A;  1G9C A;  1S0C A;  5BP5 C;  1S0L A;  2IWT B;  4X39 A;  3A22 A;  3Q7X A;  4I4X A;  3FJB A;  3BAH A;  3FJ8 A;  3CA3 A;  4UY4 A;  1FWV A;  3AKG A;  4EFP A;  4LO0 A;  3CA1 A;  4XFT A;  4A7K A;  3FJJ A;  2WRY A;  3AJ6 A;  4OEE A;  3V79 C;  2VSA A;  4I0Y A;  3BAV A;  1D0H A;  4LO7 B;  4I2S A;  1Z0H A;  3F62 B;  1HWM B;  1HWP B;  2AXM A;  4JQ0 A;  4AN6 A;  2XOA A;  2KI6 B;  2R9K B;  2KH2 A;  4QC4 A;  4QO3 A;  1XHB A;  1AVX B;  4XFU A;  3I2A A;  4XFS A;  5FZY A;  2K8R A;  1HKN A;  1FWU A;  1JY0 A;  4R6U B;  5BXP A;  2HWA A;  1G9A A;  2HWM A;  4DEN A;  4DEP A;  1GGP B;  1ISV A;  1V6V A;  3HOM A;  3IAG C;  5JLV A;  4EFQ A;  2QN4 A;  4OWL A;  3BAD A;  3LTQ A;  3N7L A;  1JQZ A;  2VSE A;  1OQL B;  2VLC A;  1PUM B;  4LO3 C;  4ZOT A;  2RST A;  1E0O A;  4LO1 A;  3H6R A;  2HZ9 A;  4TLP A;  1UPS A;  3BTA A;  5GAQ A;  3IIR A;  4GP0 A;  1JT4 A;  1WBC A;  5FZZ A;  1W3G A;  3VT1 A;  2ESU A;  1PWA A;  1FMM S;  2VU9 A;  2NZ9 A;  3AZV A;  1W3F A;  3BAU A;  2ZQN A;  1II4 A;  2QYI B;  3TC2 A;  1FMZ A;  4P0K A;  41BI A;  4USP A;  3Q7Y A;  1AVA C;  3VT2 A;  1BLD A;  4IZX A;  1JT3 A;  1T9F A;  4JRA A;  1RZO B;  3HN1 A;  3AKF A;  3H6R B;  3B9U A;  3A07 A;  3AH1 A;  4I4V A;  4OWJ A;  4X3A A;  3CU1 B;  1JT7 A;  2ERM A;  4I4S A;  5B2H A;  3WMU A;  1ISZ A;  5DVH A;  4ZFY B;  3OGG A;  1Q1U A;  1PC8 B;  4L4I A;  1TWM A;  1HWO B;  4J23 B;  3O4C A;  4KBB A;  4QD2 C;  4F83 A;  9ILB A;  1TOO A;  1AXM A;  3CA6 A;  2ET2 A;  2NVH A;  2NP0 A;  3OGF A;  4QAL A;  1TTU A;  1S0E A;  2NTD A;  4XKI A;  1AF9 A;  4AN7 B;  5BXR A;  3FJF A;  4J2X A;  4H04 A;  3VEQ A;  2J3P A;  4OEF A;  3O4O A;  1DIW A;  3FJA A;  1V6X A;  4MZF B;  3BRF A;  1R8N A;  4ZFU B;  3V0A A;  4QBC A;  4L4H A;  1FGA A;  2YUG A;  1FV2 A;  5I1B A;  3JUT A;  1TIE A;  4I4Q A;  3P6I A;  1DFQ A;  1WBA A;  3VWC A;  4F34 A;  3WO4 A;  2BFH A;  2D1Z A;  4X38 A;  2VXR A;  3NBN A;  4H9W A;  3HMY A;  5BP5 A;  2IHO A;  3ILA A;  5F8Y A;  1IRP A;  2F2F A;  2GO2 A;  3E8L C;  2Y9G A;  1IOB A;  2F2F C;  3SNV A;  1PZZ A;  4I4O A;  3UD8 A;  4IZE A;  4D8H A;  1ISX A;  3QR5 A;  1WD4 A;  3O4A A;  4Q91 A;  2E4M A;  4JP0 A;  2X2S A;  4KEJ A;  2VUA A;  2E4M C;  5EC5 A;  1JT5 A;  3BRG C;  3NJ5 A;  4HA2 A;  2D7I A;  3FUO A;  3WA1 A;  4HJJ A;  1R8O A;  6I1B A;  3N0K A;  3FJK A;  2FDB M;  5DZU A;  3RMX A;  1DZC A;  1BFB A;  3FJD A;  1DQO A;  4KC3 A;  3OJ2 A;  7I1B A;  3OJV A;  4FVV A;  4I4R A;  2P23 A;  2Z48 A;  3O49 A;  4OWK A;  4H75 A;  4EFR A;  3R4S A;  4FGF A;  3AJ5 A;  1Z4S A;  2AQZ A;  4ZFW B;  2D20 A;  3O4D A;  4J2K A;  4LO3 A;  1Q04 A;  3W9T A;  2M49 A;  2LIE A;  2NM1 A;  3LLP A;  4WBC A;  4I6I A;  1S0G A;  2MLL B;  8I1B A;  3RTJ B;  4JKQ A;  1T4Q A;  3BX1 C;  3RSJ A;  1FQ9 A;  4I1E A;  1I1E A;  3BB2 A;  5BQU C;  1S0F A;  3P6J A;  4GOY A;  3A23 A;  4MZH A;  5FNW A;  3HBW A;  2NYY A;  4A7Y A;  4Q9G A;  3S8J A;  3CAH A;  5E24 E;  4QKS A;  5EHA A;  1YF8 B;  3VT0 A;  2MIB A;  3PG0 A;  4ZKT B;  3BA5 A;  1BFG A;  1V6W A;  4EEE B;  3O5W B;  1AVU A;  4P0L A;  2RQ9 A;  1A8D A;  1HWN B;  1N4K A;  3Q7W A;  1IIL A;  2FFV A;  2AAI B;  1J0S A;  3O4B A;  4Z9W B;  5HPZ A;  2LIQ A;  3VSF A;  4OUJ A;  4DCK C;  1JLX A;  1ILR 1;  1IRA X;  2DS0 A;  4Q9P A;  3BA4 A;  1DJS B;  3RTI B;  1ITB A;  3WIN A;  1BLA A;  1ONK B;  3O3Q A;  3WIN C;  1CVS A;  4I37 A;  1HIB A;  3POK A;  4ZBV B;  3ZX7 A;  1BFF A;  3FJH A;  3HAL A;  4OW4 A;  1QQK A;  1YTO A;  4I4P A;  2FFU A;  1SZ6 B;  1DFC A;  3PUB A;  1NUN A;  3P53 A;  1G82 A;  3PME A;  2ZQO A;  1YBI A;  4QD2 B;  4ZGR B;  1EV2 A;  4X37 A;  4EB2 B;  2D44 A;  3RMY A;  2D24 A;  1TWE A;  3NBD A;  1RG8 A;  1YYN A;  4IY9 A;  4GOV A;  1QQL A;  1EYL A;  5D61 A;  2UUS A;  1NZK A;  4J2S A;  4PC4 A;  3UJ0 A;  5G00 A;  3ZC9 A;  1QXM A;  3AZW A;  1I1B A;  4EKX B;  2NS2 A;  1SR4 C;  4IYB A;  5BVP I;  3D7W B;  4QBV A;  4YOL A;  5F8S A;  5EG6 C;  4P6A A;  1KNM A;  1JLY A;  3A21 A;  3QYD A;  3O44 A;  3EF2 A;  4GAI A;  1YXW A;  3V0A B;  1JTC A;  3R4U A;  3FJ9 A;  4G6M A;  3CA5 A;  3V0B A;  4LO7 C;  2FGF A;  2Y9X E;  3CA4 A;  3ZXD A;  1BFC A;  4ISQ A;  4JKX B;  4G1R A;  1BAR A;  3OJM A;  1M2T B;  4IHZ A;  3IM5 A;  3NBE A;  4A7Z A;  1G9D A;  1WD3 A;  1V6U A;  4I3N A;  3AKI A;  2FO1 A;  2MC2 A;  3UDA A;  1HCE A;  5DUY A;  1P63 A;  1HCD A;  1AFC A;  1BAS A;  21BI A;  3N7J A;  3FJE A;  2L5X A;  3BAG A;  4LO0 C;  1BA7 A;  2Q3N B;  2HW9 A;  4CJM A;  4D0T A;  1MC9 A;  4I4Y A;  3V0B B;  1FN0 A;  4QKR A;  4USO A;  1Z2V A;  1DQG A;  3T8S A;  1EPW A;  2DRE A;  1L2H A;  4ISR A;  5FNX A;  4G6J A;  2ZR1 B;  3VSZ A;  2KLL A;  1ISW A;  1DLL A;  3PHZ A;  2RG9 B;  4G9M A;  5BQU A;  1W3A A;  4I7I A;  1S0B A;  4JAW A;  1XYF A;  2D7R A;  3BRD A;  5F90 A;  4I96 A;  3H6S E;  4LO1 C;  1AVW B;  3CRI A;  4KEI A;  2KI4 A;  1VCL A;  1FV3 A;  1PUU B;  4I4U A;  4END A;  1EVT A;  4JPZ A;  5BXS A;  4I8M A;  5BOW A;  3S8K A;  1RY7 A;  1ABR B;  4GP3 A;  4ION A;  3BAQ A;  3N7M A;  1TFM B; 
#chains in the Genus database with same CATH homology
 1TP0 A;  2D22 A;  2Y9W C;  4HR6 C;  5F8W A;  3MPP G;  2Q9X A;  1K5V A;  3MAL A;  2K43 A;  3FGM A;  3UD9 A;  3BAO A;  3UD7 A;  3N7K A;  3ZXG A;  1K5U A;  3UJ4 A;  4IY8 A;  2VXT I;  4D0Z A;  3FFZ A;  3CRH A;  3IM6 A;  3FJI A;  1IJT A;  4GAF A;  2D23 A;  5DSS B;  5BXT A;  4IQP A;  2DRY A;  2KKI A;  3BA7 A;  5D62 A;  3JRR A;  1F31 A;  4LO2 A;  31BI A;  2F8X C;  3AKH A;  4LO2 C;  4KEK A;  4LO8 B;  3I29 B;  3CRG A;  1RML A;  5D63 A;  3AH4 A;  1CE7 B;  1DZD A;  4MZG B;  3CA0 A;  3WO2 A;  3C9Z A;  4I1B A;  3AH2 A;  3I2X A;  1IHK A;  3HSM A;  3K1X A;  2Z49 A;  1MD6 A;  1M16 A;  4P0J A;  4OEG A;  3FJC A;  1Q03 A;  1ISY A;  2WBC A;  3CQA A;  3H6Q A;  1S0D A;  1XG6 A;  2I1B A;  3FUQ A;  1IT0 A;  4II0 A;  3WMV A;  1XZZ A;  1SR4 A;  2D43 A;  3NBC A;  5FZU A;  4ZA3 B;  2X2T A;  3OBR A;  4ZLB B;  3IM7 A;  3F1R A;  2GZB A;  2AFG A;  2K4A B;  4G9N A;  2Y9F A;  2BEB A;  2DRZ A;  2BEA A;  3OBT A;  1G9B A;  3KMV A;  5JMC A;  3WO3 A;  3VUO A;  4J2Y A;  4Z8S B;  3ZC8 A;  2P39 A;  1G9C A;  1S0C A;  5BP5 C;  1S0L A;  2IWT B;  4X39 A;  3A22 A;  3Q7X A;  4I4X A;  3FJB A;  3BAH A;  3FJ8 A;  3CA3 A;  4UY4 A;  1FWV A;  3AKG A;  4EFP A;  4LO0 A;  3CA1 A;  4XFT A;  4A7K A;  3FJJ A;  2WRY A;  3AJ6 A;  4OEE A;  3V79 C;  2VSA A;  4I0Y A;  3BAV A;  1D0H A;  4LO7 B;  4I2S A;  1Z0H A;  3F62 B;  1HWM B;  1HWP B;  2AXM A;  4JQ0 A;  4AN6 A;  2XOA A;  2KI6 B;  2R9K B;  2KH2 A;  4QC4 A;  4QO3 A;  1XHB A;  1AVX B;  4XFU A;  3I2A A;  4XFS A;  5FZY A;  2K8R A;  1HKN A;  1FWU A;  1JY0 A;  4R6U B;  5BXP A;  2HWA A;  1G9A A;  2HWM A;  4DEN A;  4DEP A;  1GGP B;  1ISV A;  1V6V A;  3HOM A;  3IAG C;  5JLV A;  4EFQ A;  2QN4 A;  4OWL A;  3BAD A;  3LTQ A;  3N7L A;  1JQZ A;  2VSE A;  1OQL B;  2VLC A;  1PUM B;  4LO3 C;  4ZOT A;  2RST A;  1E0O A;  4LO1 A;  3H6R A;  2HZ9 A;  4TLP A;  1UPS A;  3BTA A;  5GAQ A;  3IIR A;  4GP0 A;  1JT4 A;  1WBC A;  5FZZ A;  1W3G A;  3VT1 A;  2ESU A;  1PWA A;  1FMM S;  2VU9 A;  2NZ9 A;  3AZV A;  1W3F A;  3BAU A;  2ZQN A;  1II4 A;  2QYI B;  3TC2 A;  1FMZ A;  4P0K A;  41BI A;  4USP A;  3Q7Y A;  1AVA C;  3VT2 A;  1BLD A;  4IZX A;  1JT3 A;  1T9F A;  4JRA A;  1RZO B;  3HN1 A;  3AKF A;  3H6R B;  3B9U A;  3A07 A;  3AH1 A;  4I4V A;  4OWJ A;  4X3A A;  3CU1 B;  1JT7 A;  2ERM A;  4I4S A;  5B2H A;  3WMU A;  1ISZ A;  5DVH A;  4ZFY B;  3OGG A;  1Q1U A;  1PC8 B;  4L4I A;  1TWM A;  1HWO B;  4J23 B;  3O4C A;  4KBB A;  4QD2 C;  4F83 A;  9ILB A;  1TOO A;  1AXM A;  3CA6 A;  2ET2 A;  2NVH A;  2NP0 A;  3OGF A;  4QAL A;  1TTU A;  1S0E A;  2NTD A;  4XKI A;  1AF9 A;  4AN7 B;  5BXR A;  3FJF A;  4J2X A;  4H04 A;  3VEQ A;  2J3P A;  4OEF A;  3O4O A;  1DIW A;  3FJA A;  1V6X A;  4MZF B;  3BRF A;  1R8N A;  4ZFU B;  3V0A A;  4QBC A;  4L4H A;  1FGA A;  2YUG A;  1FV2 A;  5I1B A;  3JUT A;  1TIE A;  4I4Q A;  3P6I A;  1DFQ A;  1WBA A;  3VWC A;  4F34 A;  3WO4 A;  2BFH A;  2D1Z A;  4X38 A;  2VXR A;  3NBN A;  4H9W A;  3HMY A;  5BP5 A;  2IHO A;  3ILA A;  5F8Y A;  1IRP A;  2F2F A;  2GO2 A;  3E8L C;  2Y9G A;  1IOB A;  2F2F C;  3SNV A;  1PZZ A;  4I4O A;  3UD8 A;  4IZE A;  4D8H A;  1ISX A;  3QR5 A;  1WD4 A;  3O4A A;  4Q91 A;  2E4M A;  4JP0 A;  2X2S A;  4KEJ A;  2VUA A;  2E4M C;  5EC5 A;  1JT5 A;  3BRG C;  3NJ5 A;  4HA2 A;  2D7I A;  3FUO A;  3WA1 A;  4HJJ A;  1R8O A;  6I1B A;  3N0K A;  3FJK A;  2FDB M;  5DZU A;  3RMX A;  1DZC A;  1BFB A;  3FJD A;  1DQO A;  4KC3 A;  3OJ2 A;  7I1B A;  3OJV A;  4FVV A;  4I4R A;  2P23 A;  2Z48 A;  3O49 A;  4OWK A;  4H75 A;  4EFR A;  3R4S A;  4FGF A;  3AJ5 A;  1Z4S A;  2AQZ A;  4ZFW B;  2D20 A;  3O4D A;  4J2K A;  4LO3 A;  1Q04 A;  3W9T A;  2M49 A;  2LIE A;  2NM1 A;  3LLP A;  4WBC A;  4I6I A;  1S0G A;  2MLL B;  8I1B A;  3RTJ B;  4JKQ A;  1T4Q A;  3BX1 C;  3RSJ A;  1FQ9 A;  4I1E A;  1I1E A;  3BB2 A;  5BQU C;  1S0F A;  3P6J A;  4GOY A;  3A23 A;  4MZH A;  5FNW A;  3HBW A;  2NYY A;  4A7Y A;  4Q9G A;  3S8J A;  3CAH A;  5E24 E;  4QKS A;  5EHA A;  1YF8 B;  3VT0 A;  2MIB A;  3PG0 A;  4ZKT B;  3BA5 A;  1BFG A;  1V6W A;  4EEE B;  3O5W B;  1AVU A;  4P0L A;  2RQ9 A;  1A8D A;  1HWN B;  1N4K A;  3Q7W A;  1IIL A;  2FFV A;  2AAI B;  1J0S A;  3O4B A;  4Z9W B;  5HPZ A;  2LIQ A;  3VSF A;  4OUJ A;  4DCK C;  1JLX A;  1ILR 1;  1IRA X;  2DS0 A;  4Q9P A;  3BA4 A;  1DJS B;  3RTI B;  1ITB A;  3WIN A;  1BLA A;  1ONK B;  3O3Q A;  3WIN C;  1CVS A;  4I37 A;  1HIB A;  3POK A;  4ZBV B;  3ZX7 A;  1BFF A;  3FJH A;  3HAL A;  4OW4 A;  1QQK A;  1YTO A;  4I4P A;  2FFU A;  1SZ6 B;  1DFC A;  3PUB A;  1NUN A;  3P53 A;  1G82 A;  3PME A;  2ZQO A;  1YBI A;  4QD2 B;  4ZGR B;  1EV2 A;  4X37 A;  4EB2 B;  2D44 A;  3RMY A;  2D24 A;  1TWE A;  3NBD A;  1RG8 A;  1YYN A;  4IY9 A;  4GOV A;  1QQL A;  1EYL A;  5D61 A;  2UUS A;  1NZK A;  4J2S A;  4PC4 A;  3UJ0 A;  5G00 A;  3ZC9 A;  1QXM A;  3AZW A;  1I1B A;  4EKX B;  2NS2 A;  1SR4 C;  4IYB A;  5BVP I;  3D7W B;  4QBV A;  4YOL A;  5F8S A;  5EG6 C;  4P6A A;  1KNM A;  1JLY A;  3A21 A;  3QYD A;  3O44 A;  3EF2 A;  4GAI A;  1YXW A;  3V0A B;  1JTC A;  3R4U A;  3FJ9 A;  4G6M A;  3CA5 A;  3V0B A;  4LO7 C;  2FGF A;  2Y9X E;  3CA4 A;  3ZXD A;  1BFC A;  4ISQ A;  4JKX B;  4G1R A;  1BAR A;  3OJM A;  1M2T B;  4IHZ A;  3IM5 A;  3NBE A;  4A7Z A;  1G9D A;  1WD3 A;  1V6U A;  4I3N A;  3AKI A;  2FO1 A;  2MC2 A;  3UDA A;  1HCE A;  5DUY A;  1P63 A;  1HCD A;  1AFC A;  1BAS A;  21BI A;  3N7J A;  3FJE A;  2L5X A;  3BAG A;  4LO0 C;  1BA7 A;  2Q3N B;  2HW9 A;  4CJM A;  4D0T A;  1MC9 A;  4I4Y A;  3V0B B;  1FN0 A;  4QKR A;  4USO A;  1Z2V A;  1DQG A;  3T8S A;  1EPW A;  2DRE A;  1L2H A;  4ISR A;  5FNX A;  4G6J A;  2ZR1 B;  3VSZ A;  2KLL A;  1ISW A;  1DLL A;  3PHZ A;  2RG9 B;  4G9M A;  5BQU A;  1W3A A;  4I7I A;  1S0B A;  4JAW A;  1XYF A;  2D7R A;  3BRD A;  5F90 A;  4I96 A;  3H6S E;  4LO1 C;  1AVW B;  3CRI A;  4KEI A;  2KI4 A;  1VCL A;  1FV3 A;  1PUU B;  4I4U A;  4END A;  1EVT A;  4JPZ A;  5BXS A;  4I8M A;  5BOW A;  3S8K A;  1RY7 A;  1ABR B;  4GP3 A;  4ION A;  3BAQ A;  3N7M A;  1TFM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...