1AVAC

Amy2/basi protein-protein complex from barley seed
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
181
structure length
181
Chain Sequence
b'ADPPPVHDTDGHELRADANYYVLSANRAHGGGLTMAPGHGRHCPLFVSQDPNGQHDGFPVRITPYGVAPSDKIIRLSTDVRISFRAYTTCLQSTEWHIDSELAAGRRHVITGPVKDPSPSGRENAFRIEKYSGAEVHEYKLMSCGDWCQDLGVFRDLKGGAWFLGATEPYHVVVFKKAPPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BARLEY ALPHA-AMYLASE 2(CV MENUET)
publication title Barley alpha-amylase bound to its endogenous protein inhibitor BASI: crystal structure of the complex at 1.9 A resolution.
pubmed doi rcsb
molecule tags Hydrolase inhibition
total genus 38
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1avaC00
3A21A 3QYDA 1IOBA 1HWNB 1QXMA 3N7JA 5FNWA 3A23A 3FJDA 2RQ9A 1FWVA 1Q1UA 3KMVA 3MALA 4IY8A 4GAIA 5F8YA 3ZX7A 3RTJB 2X2SA 1ITBA 1T4QA 3PG0A 2FO1A 3VT0A 4AN7B 3I29B 5D63A 2I1BA 4I4XA 2L5XA 3T8SA 4G6MA 4LO2A 2ZQOA 4LO1C 4A7ZA 1G82A 3P6JA 5DZUA 1QQKA 1GGPB 3BTAA 3S8KA 4X3AA 4P0LA 2VSEA 2F2FC 4G9NA 2M49A 4EKXB 1XZZA 1T9FA 3BB2A 3V0BA 2ERMA 2F8XC 5DSSB 4ZA3B 4LO3A 2K43A 2D7RA 4H04A 3FJKA 2Y9XE 1MD6A 1JLXA 21BIA 1XG6A 1JT5A 1W3AA 1JTCA 1JT7A 3V0AB 2NM1A 3BAQA 3AH4A 2P39A 3A07A 3BAHA 3VSFA 1J0SA 4XFUA 3OJ2A 5JMCA 3O49A 2ESUA 3OJVA 3BA4A 3I2XA 2VLCA 3O5WB 4GAFA 1Z0HA 1BFBA 3CA0A 4IZEA 3VWCA 1G9AA 3VT1A 1ISVA 5G00A 4LO2C 5DUYA 3NBCA 3CA3A 3MPPG 4EFQA 4IZXA 2IWTB 1Z4SA 3FJAA 4OWJA 3FJ9A 3PUBA 2X2TA 4P6AA 1FGAA 1I1EA 3FJFA 4KEKA 1PWAA 4G6JA 4QC4A 4QKSA 4QALA 2D24A 3FJBA 3HN1A 1ISYA 4ISRA 1YTOA 2RSTA 2MC2A 3AJ6A 4D0ZA 1M2TB 5BQUA 5BXSA 1L2HA 2VUAA 4LO3C 1SZ6B 1BARA 1K5VA 1MC9A 1IRAX 41BIA 2KI4A 1PUMB 1V6VA 2D23A 2HWAA 2IHOA 2K8RA 3O4CA 3A22A 2Z48A 3NBEA 2HZ9A 1IHKA 4OUJA 1DQOA 1I1BA 4FVVA 3WO4A 4LO1A 3VT2A 3OGGA 1BA7A 3VUOA 4ZBVB 2HW9A 5BOWA 4ZGRB 2AQZA 3RSJA 3F1RA 2R9KB 4II0A 3BRDA 1RG8A 1YXWA 4XFTA 1RY7A 1TTUA 3OGFA 4ENDA 1S0BA 5EG6C 2D22A 1HWPB 1P63A 1OQLB 2KKIA 1YBIA 3O3QA 4G1RA 3V0BB 1HKNA 2AFGA 4OEFA 3IM7A 1V6XA 1JLYA 2WRYA 4XKIA 1BFGA 4X37A 1N4KA 4OWLA 1F31A 3CRGA 4Z8SB 4I0YA 1EV2A 4G9MA 4F34A 5EHAA 3FJHA 4QD2C 3AJ5A 4I6IA 5BQUC 2NZ9A 1HWMB 3N7KA 4P0JA 4CJMA 3H6SE 2UUSA 3BADA 3O4DA 3FJCA 4P0KA 4Z9WB 1ILR1 3VSZA 1AVUA 3AKHA 2Z49A 4IYBA 3D7WB 3WINA 3IM5A 3POKA 4Q91A 1IJTA 3HMYA 3FGMA 5F8SA 2GZBA 3RMYA 2Q9XA 4LO8B 4I7IA 3P53A 4KBBA 3Q7XA 3BAVA 4I4UA 1ISZA 1DFCA 1TFMB 4HR6C 4I37A 4GP0A 2XOAA 3HBWA 6I1BA 4EB2B 3HSMA 4HJJA 5FZUA 4LO7C 4H9WA 2K4AB 3FFZA 1FN0A 3NJ5A 2LIEA 4IHZA 1NZKA 3QR5A 1YF8B 3OJMA 1DJSB 3TC2A 3WO3A 1AVXB 1FMZA 2KLLA 3UDAA 3NBDA 3O4BA 1HCEA 1S0CA 4OEGA 3CA5A 4PC4A 3HALA 5FZZA 1DZCA 2E4MA 4I8MA 3OBTA 4J2XA 3CA1A 1R8NA 4QO3A 3RMXA 4OW4A 1V6UA 3WINC 4ZKTB 1TOOA 2MLLB 2ET2A 3Q7YA 2KI6B 5E24E 4I4PA 2RG9B 1W3FA 2Y9WC 4R6UB 1AVWB 4ZLBB 4LO7B 8I1BA 1V6WA 2QN4A 3FUQA 1FQ9A 1IRPA 3FJ8A 1TWEA 4D8HA 4J23B 5I1BA 1ISWA 2FFVA 3UJ4A 1W3GA 4GP3A 1BFFA 1AVAC 4X39A 3UD7A 5JLVA 4J2KA 3CA6A 3WO2A 4QKRA 3CU1B 2NP0A 3WA1A 2BFHA 2ZQNA 3BAOA 1EYLA 3SNVA 3HOMA 4QBVA 1YYNA 3BX1C 3WMVA 1XYFA 1G9CA 1RMLA 4ISQA 1EPWA 3BRFA 3B9UA 2DREA 1AFCA 2E4MC 1Z2VA 3JUTA 4JRAA 4IONA 3H6RA 4LO0A 2ZR1B 1XHBA 4TLPA 3NBNA 1HCDA 3JRRA 4GOVA 4KC3A 5BXPA 3C9ZA 3F62B 1TWMA 1Q04A 4JPZA 3ILAA 4A7YA 1AXMA 1DQGA 5BP5C 3AKIA 4FGFA 4JAWA 3WMUA 1E0OA 1AF9A 4IY9A 2NTDA 1EVTA 3CQAA 5FNXA 3BA5A 4X38A 1WBCA 4JQ0A 3AH1A 4DCKC 1QQLA 1CVSA 4I2SA 1ISXA 4DEPA 1JT3A 3IM6A 4KEIA 9ILBA 4YOLA 3P6IA 1G9DA 3BAUA 2D20A 2Y9GA 3FJEA 1Q03A 3ZC8A 2DS0A 2P23A 2MIBA 4JP0A 2FGFA 1JT4A 3N0KA 4I1BA 2Q3NB 7I1BA 4L4HA 1UPSA 4I4YA 4LO0C 3IIRA 3PMEA 4QBCA 3AKFA 4OWKA 1SR4A 3ZXGA 2GO2A 1HWOB 3UJ0A 1DIWA 4HA2A 4QD2B 4XFSA 4A7KA 3V79C 5FZYA 1S0EA 2HWMA 2D44A 3BA7A 5GAQA 3BRGC 4I96A 1DZDA 1CE7B 2FFUA 2QYIB 3OBRA 1WBAA 4Q9GA 3BAGA 4OEEA 1II4A 1ABRB 3R4UA 3IAGC 4JKXB 2LIQA 4I4VA 5HPZA 2NYYA 2VXRA 1FV3A 3S8JA 4USOA 1NUNA 4EFPA 3UD8A 1M16A 5DVHA 1S0FA 5EC5A 1D0HA 5D62A 2DRYA 3H6RB 3ZC9A 1PZZA 4D0TA 2WBCA 1BLDA 3W9TA 4ZFUB 1BASA 5BP5A 4EFRA 3Q7WA 1ONKB 2J3PA 3K1XA 3FUOA 1FMMS 1DFQA 1SR4C 1WD3A 4IQPA 1A8DA 5BXTA 3AZVA 1IILA 4L4IA 1JQZA 3H6QA 4I4QA 1RZOB 2VSAA 1JY0A 3E8LC 1S0DA 4KEJA 3UD9A 2AAIB 1WD4A 4GOYA 5BXRA 2DRZA 3AKGA 2NVHA 3LLPA 3N7MA 3VEQA 3PHZA 1DLLA 1BLAA 3AH2A 3FJIA 3O4OA 4DENA 1S0GA 4AN6A 2AXMA 5F90A 1HIBA 3ZXDA 4JKQA 3V0AA 2VU9A 1KNMA 4ZOTA 3AZWA 2D7IA 1TIEA 31BIA 1R8OA 3N7LA 4J2YA 1S0LA 5F8WA 3O44A 2VXTI 1BFCA 1PUUB 2FDBM 2BEBA 2D1ZA 4I3NA 1VCLA 4ZFWB 3RTIB 3CRIA 3EF2A 4I4SA 5D61A 4WBCA 4I1EA 3R4SA 2Y9FA 5BVPI 4I4OA 4ZFYB 2F2FA 4I4RA 4Q9PA 3CA4A 3I2AA 4USPA 1TP0A 1FWUA 4J2SA 1PC8B 1K5UA 3FJJA 1FV2A 5B2HA 2KH2A 4F83A 2D43A 3O4AA 3LTQA 3CAHA 2BEAA 2YUGA 1IT0A 1G9BA 4EEEB 3CRHA
chains in the Genus database with same CATH superfamily
3A21A 3QYDA 1IOBA 1HWNB 1QXMA 3N7JA 5FNWA 3A23A 3FJDA 2RQ9A 1FWVA 1Q1UA 3KMVA 3MALA 4IY8A 4GAIA 5F8YA 3ZX7A 3RTJB 2X2SA 1ITBA 1T4QA 3PG0A 2FO1A 3VT0A 4AN7B 3I29B 5D63A 2I1BA 4I4XA 2L5XA 3T8SA 4G6MA 4LO2A 2ZQOA 4LO1C 4A7ZA 1G82A 3P6JA 5DZUA 1QQKA 1GGPB 3BTAA 3S8KA 4X3AA 4P0LA 2VSEA 2F2FC 4G9NA 2M49A 4EKXB 1XZZA 1T9FA 3BB2A 3V0BA 2ERMA 2F8XC 5DSSB 4ZA3B 4LO3A 2K43A 2D7RA 4H04A 3FJKA 2Y9XE 1MD6A 1JLXA 21BIA 1XG6A 1JT5A 1W3AA 1JTCA 1JT7A 3V0AB 2NM1A 3BAQA 3AH4A 2P39A 3A07A 3BAHA 3VSFA 1J0SA 4XFUA 3OJ2A 5JMCA 3O49A 2ESUA 3OJVA 3BA4A 3I2XA 2VLCA 3O5WB 4GAFA 1Z0HA 1BFBA 3CA0A 4IZEA 3VWCA 1G9AA 3VT1A 1ISVA 5G00A 4LO2C 5DUYA 3NBCA 3CA3A 3MPPG 4EFQA 4IZXA 2IWTB 1Z4SA 3FJAA 4OWJA 3FJ9A 3PUBA 2X2TA 4P6AA 1FGAA 1I1EA 3FJFA 4KEKA 1PWAA 4G6JA 4QC4A 4QKSA 4QALA 2D24A 3FJBA 2NS2A 1ISYA 3HN1A 4ISRA 1YTOA 2RSTA 2MC2A 3AJ6A 4D0ZA 1M2TB 5BQUA 5BXSA 1L2HA 2VUAA 4LO3C 1SZ6B 1BARA 1K5VA 1MC9A 1IRAX 41BIA 2KI4A 1PUMB 1V6VA 2D23A 2HWAA 2IHOA 2K8RA 3O4CA 3A22A 2Z48A 3NBEA 2HZ9A 1IHKA 4OUJA 1DQOA 1I1BA 4H75A 4FVVA 3WO4A 4LO1A 3VT2A 3OGGA 1BA7A 3VUOA 4ZBVB 2HW9A 5BOWA 4ZGRB 2AQZA 3RSJA 3F1RA 2R9KB 4II0A 3BRDA 1RG8A 1YXWA 4XFTA 1RY7A 1TTUA 3OGFA 4ENDA 1S0BA 5EG6C 2D22A 1HWPB 1P63A 1OQLB 2KKIA 1YBIA 3O3QA 4G1RA 3V0BB 1HKNA 2AFGA 4OEFA 3IM7A 1V6XA 1JLYA 2WRYA 4XKIA 1BFGA 4X37A 1N4KA 4OWLA 1F31A 3CRGA 4Z8SB 4I0YA 1EV2A 4G9MA 4F34A 5EHAA 3FJHA 4QD2C 3AJ5A 4I6IA 5BQUC 2NZ9A 1HWMB 3N7KA 4P0JA 4CJMA 3H6SE 2UUSA 3BADA 3O4DA 3FJCA 4P0KA 4Z9WB 1ILR1 3VSZA 1AVUA 3AKHA 2Z49A 4IYBA 3D7WB 3WINA 3IM5A 3POKA 4Q91A 1IJTA 3HMYA 3FGMA 5F8SA 2GZBA 3RMYA 2Q9XA 4LO8B 4I7IA 3P53A 4KBBA 3Q7XA 3BAVA 4I4UA 1ISZA 1DFCA 1TFMB 4HR6C 4I37A 4GP0A 2XOAA 3HBWA 6I1BA 4EB2B 3HSMA 4HJJA 5FZUA 4LO7C 4H9WA 2K4AB 3FFZA 1FN0A 3NJ5A 2LIEA 4IHZA 1NZKA 3QR5A 1YF8B 3OJMA 1DJSB 3TC2A 3WO3A 1AVXB 1FMZA 2KLLA 3UDAA 3NBDA 3O4BA 1HCEA 1S0CA 4OEGA 3CA5A 4PC4A 3HALA 5FZZA 1DZCA 2E4MA 4I8MA 3OBTA 4J2XA 3CA1A 1R8NA 4QO3A 3RMXA 4OW4A 1V6UA 3WINC 4ZKTB 1TOOA 2MLLB 2ET2A 3Q7YA 2KI6B 5E24E 4I4PA 2RG9B 1W3FA 2Y9WC 4R6UB 1AVWB 4ZLBB 4LO7B 8I1BA 1V6WA 2QN4A 3FUQA 1FQ9A 1IRPA 3FJ8A 1TWEA 4D8HA 4J23B 5I1BA 1ISWA 2FFVA 3UJ4A 1W3GA 4UY4A 4GP3A 1BFFA 1AVAC 4X39A 3UD7A 5JLVA 4J2KA 3CA6A 3WO2A 4QKRA 3CU1B 2NP0A 3WA1A 2BFHA 2ZQNA 3BAOA 1EYLA 3SNVA 3HOMA 4QBVA 1YYNA 3BX1C 3WMVA 1XYFA 1G9CA 1RMLA 4ISQA 1EPWA 3BRFA 3B9UA 2DREA 1AFCA 2E4MC 1Z2VA 3JUTA 4JRAA 4IONA 3H6RA 4LO0A 2ZR1B 1XHBA 4TLPA 3NBNA 1HCDA 4MZGB 3JRRA 4GOVA 4KC3A 5BXPA 3C9ZA 3F62B 1TWMA 1Q04A 4JPZA 3ILAA 4A7YA 1AXMA 1DQGA 5BP5C 3AKIA 4FGFA 4JAWA 3WMUA 1E0OA 1AF9A 4IY9A 2NTDA 1EVTA 3CQAA 5FNXA 3BA5A 4X38A 1WBCA 4JQ0A 3AH1A 4DCKC 1QQLA 1CVSA 4I2SA 1ISXA 4DEPA 1JT3A 3IM6A 4KEIA 9ILBA 4YOLA 3P6IA 1G9DA 3BAUA 2D20A 2Y9GA 3FJEA 1Q03A 3ZC8A 2DS0A 2P23A 2MIBA 4JP0A 2FGFA 1JT4A 3N0KA 4I1BA 2Q3NB 7I1BA 4L4HA 1UPSA 4I4YA 4LO0C 3IIRA 3PMEA 4QBCA 3AKFA 4OWKA 1SR4A 3ZXGA 2GO2A 1HWOB 3UJ0A 1DIWA 4HA2A 4QD2B 4XFSA 4A7KA 3V79C 5FZYA 1S0EA 4MZHA 2HWMA 2D44A 3BA7A 5GAQA 3BRGC 4I96A 1DZDA 1CE7B 2FFUA 2QYIB 3OBRA 1WBAA 4Q9GA 3BAGA 4OEEA 1II4A 1ABRB 3R4UA 3IAGC 4JKXB 2LIQA 4I4VA 5HPZA 2NYYA 2VXRA 1FV3A 3S8JA 4USOA 1NUNA 4EFPA 3UD8A 1M16A 5DVHA 1S0FA 5EC5A 1D0HA 5D62A 2DRYA 3H6RB 3ZC9A 1PZZA 4D0TA 2WBCA 1BLDA 3W9TA 4ZFUB 1BASA 5BP5A 4EFRA 3Q7WA 1ONKB 2J3PA 3K1XA 3FUOA 1FMMS 1DFQA 1SR4C 1WD3A 4IQPA 1A8DA 5BXTA 3AZVA 1IILA 4L4IA 1JQZA 3H6QA 4I4QA 1RZOB 2VSAA 1JY0A 3E8LC 1S0DA 4KEJA 3UD9A 2AAIB 1WD4A 4GOYA 5BXRA 2DRZA 3AKGA 2NVHA 3LLPA 3N7MA 3VEQA 3PHZA 1DLLA 1BLAA 3AH2A 3FJIA 3O4OA 4DENA 1S0GA 4MZFB 4AN6A 2AXMA 5F90A 1HIBA 3ZXDA 4JKQA 3V0AA 2VU9A 1KNMA 4ZOTA 3AZWA 2D7IA 1TIEA 31BIA 1R8OA 3N7LA 4J2YA 1S0LA 5F8WA 3O44A 2VXTI 1BFCA 1PUUB 2FDBM 2BEBA 2D1ZA 4I3NA 1VCLA 4ZFWB 3RTIB 3CRIA 3EF2A 4I4SA 5D61A 4WBCA 4I1EA 3R4SA 2Y9FA 5BVPI 4I4OA 4ZFYB 2F2FA 4I4RA 4Q9PA 3CA4A 3I2AA 4USPA 1TP0A 1FWUA 4J2SA 1PC8B 1K5UA 3FJJA 1FV2A 5B2HA 2KH2A 4F83A 2D43A 3O4AA 3LTQA 3CAHA 2BEAA 2YUGA 1IT0A 1G9BA 4EEEB 3CRHA
chains in the Genus database with same CATH topology
3A21A 3QYDA 1IOBA 1HWNB 1QXMA 3N7JA 5FNWA 3A23A 3FJDA 2RQ9A 1FWVA 1Q1UA 3KMVA 3MALA 4IY8A 4GAIA 5F8YA 3ZX7A 3RTJB 2X2SA 1ITBA 1T4QA 3PG0A 2FO1A 3VT0A 4AN7B 3I29B 5D63A 2I1BA 4I4XA 2L5XA 3T8SA 4G6MA 4LO2A 2ZQOA 4LO1C 4A7ZA 1G82A 3P6JA 5DZUA 1QQKA 1GGPB 3BTAA 3S8KA 4X3AA 4P0LA 2VSEA 2F2FC 4G9NA 2M49A 4EKXB 1XZZA 1T9FA 3BB2A 3V0BA 2ERMA 2F8XC 5DSSB 4ZA3B 4LO3A 2K43A 2D7RA 4H04A 3FJKA 2Y9XE 1MD6A 1JLXA 21BIA 1XG6A 1JT5A 1W3AA 1JTCA 1JT7A 3V0AB 2NM1A 3BAQA 3AH4A 2P39A 3A07A 3BAHA 3VSFA 1J0SA 4XFUA 3OJ2A 5JMCA 3O49A 2ESUA 3OJVA 3BA4A 3I2XA 2VLCA 3O5WB 4GAFA 1Z0HA 1BFBA 3CA0A 4IZEA 3VWCA 1G9AA 3VT1A 1ISVA 5G00A 4LO2C 5DUYA 3NBCA 3CA3A 3MPPG 4EFQA 4IZXA 2IWTB 1Z4SA 3FJAA 4OWJA 3FJ9A 3PUBA 2X2TA 4P6AA 1FGAA 1I1EA 3FJFA 4KEKA 1PWAA 4G6JA 4QC4A 4QKSA 4QALA 2D24A 3FJBA 2NS2A 1ISYA 3HN1A 4ISRA 1YTOA 2RSTA 2MC2A 3AJ6A 4D0ZA 1M2TB 5BQUA 5BXSA 1L2HA 2VUAA 4LO3C 1SZ6B 1BARA 1K5VA 1MC9A 1IRAX 41BIA 2KI4A 1PUMB 1V6VA 2D23A 2HWAA 2IHOA 2K8RA 3O4CA 3A22A 2Z48A 3NBEA 2HZ9A 1IHKA 4OUJA 1DQOA 1I1BA 4H75A 4FVVA 3WO4A 4LO1A 3VT2A 3OGGA 1BA7A 3VUOA 4ZBVB 2HW9A 5BOWA 4ZGRB 2AQZA 3RSJA 3F1RA 2R9KB 4II0A 3BRDA 1RG8A 1YXWA 4XFTA 1RY7A 1TTUA 3OGFA 4ENDA 1S0BA 5EG6C 2D22A 1HWPB 1P63A 1OQLB 2KKIA 1YBIA 3O3QA 4G1RA 3V0BB 1HKNA 2AFGA 4OEFA 3IM7A 1V6XA 1JLYA 2WRYA 4XKIA 1BFGA 4X37A 1N4KA 4OWLA 1F31A 3CRGA 4Z8SB 4I0YA 1EV2A 4G9MA 4F34A 5EHAA 3FJHA 4QD2C 3AJ5A 4I6IA 5BQUC 2NZ9A 1HWMB 3N7KA 4P0JA 4CJMA 3H6SE 2UUSA 3BADA 3O4DA 3FJCA 4P0KA 4Z9WB 1ILR1 3VSZA 1AVUA 3AKHA 2Z49A 4IYBA 3D7WB 3WINA 3IM5A 3POKA 4Q91A 1IJTA 3HMYA 3FGMA 5F8SA 2GZBA 3RMYA 2Q9XA 4LO8B 4I7IA 3P53A 4KBBA 3Q7XA 3BAVA 4I4UA 1ISZA 1DFCA 1TFMB 4HR6C 4I37A 4GP0A 2XOAA 3HBWA 6I1BA 4EB2B 3HSMA 4HJJA 5FZUA 4LO7C 4H9WA 2K4AB 3FFZA 1FN0A 3NJ5A 2LIEA 4IHZA 1NZKA 3QR5A 1YF8B 3OJMA 1DJSB 3TC2A 3WO3A 1AVXB 1FMZA 2KLLA 3UDAA 3NBDA 3O4BA 1HCEA 1S0CA 4OEGA 3CA5A 4PC4A 3HALA 5FZZA 1DZCA 2E4MA 4I8MA 3OBTA 4J2XA 3CA1A 1R8NA 4QO3A 3RMXA 4OW4A 1V6UA 3WINC 4ZKTB 1TOOA 2MLLB 2ET2A 3Q7YA 2KI6B 5E24E 4I4PA 2RG9B 1W3FA 2Y9WC 4R6UB 1AVWB 4ZLBB 4LO7B 8I1BA 1V6WA 2QN4A 3FUQA 1FQ9A 1IRPA 3FJ8A 1TWEA 4D8HA 4J23B 5I1BA 1ISWA 2FFVA 3UJ4A 1W3GA 4UY4A 4GP3A 1BFFA 1AVAC 4X39A 3UD7A 5JLVA 4J2KA 3CA6A 3WO2A 4QKRA 3CU1B 2NP0A 3WA1A 2BFHA 2ZQNA 3BAOA 1EYLA 3SNVA 3HOMA 4QBVA 1YYNA 3BX1C 3WMVA 1XYFA 1G9CA 1RMLA 4ISQA 1EPWA 3BRFA 3B9UA 2DREA 1AFCA 2E4MC 1Z2VA 3JUTA 4JRAA 4IONA 3H6RA 4LO0A 2ZR1B 1XHBA 4TLPA 3NBNA 1HCDA 4MZGB 3JRRA 4GOVA 4KC3A 5BXPA 3C9ZA 3F62B 1TWMA 1Q04A 4JPZA 3ILAA 4A7YA 1AXMA 1DQGA 5BP5C 3AKIA 4FGFA 4JAWA 3WMUA 1E0OA 1AF9A 4IY9A 2NTDA 1EVTA 3CQAA 5FNXA 3BA5A 4X38A 1WBCA 4JQ0A 3AH1A 4DCKC 1QQLA 1CVSA 4I2SA 1ISXA 4DEPA 1JT3A 3IM6A 4KEIA 9ILBA 4YOLA 3P6IA 1G9DA 3BAUA 2D20A 2Y9GA 3FJEA 1Q03A 3ZC8A 2DS0A 2P23A 2MIBA 4JP0A 2FGFA 1JT4A 3N0KA 4I1BA 2Q3NB 7I1BA 4L4HA 1UPSA 4I4YA 4LO0C 3IIRA 3PMEA 4QBCA 3AKFA 4OWKA 1SR4A 3ZXGA 2GO2A 1HWOB 3UJ0A 1DIWA 4HA2A 4QD2B 4XFSA 4A7KA 3V79C 5FZYA 1S0EA 4MZHA 2HWMA 2D44A 3BA7A 5GAQA 3BRGC 4I96A 1DZDA 1CE7B 2FFUA 2QYIB 3OBRA 1WBAA 4Q9GA 3BAGA 4OEEA 1II4A 1ABRB 3R4UA 3IAGC 4JKXB 2LIQA 4I4VA 5HPZA 2NYYA 2VXRA 1FV3A 3S8JA 4USOA 1NUNA 4EFPA 3UD8A 1M16A 5DVHA 1S0FA 5EC5A 1D0HA 5D62A 2DRYA 3H6RB 3ZC9A 1PZZA 4D0TA 2WBCA 1BLDA 3W9TA 4ZFUB 1BASA 5BP5A 4EFRA 3Q7WA 1ONKB 2J3PA 3K1XA 3FUOA 1FMMS 1DFQA 1SR4C 1WD3A 4IQPA 1A8DA 5BXTA 3AZVA 1IILA 4L4IA 1JQZA 3H6QA 4I4QA 1RZOB 2VSAA 1JY0A 3E8LC 1S0DA 4KEJA 3UD9A 2AAIB 1WD4A 4GOYA 5BXRA 2DRZA 3AKGA 2NVHA 3LLPA 3N7MA 3VEQA 3PHZA 1DLLA 1BLAA 3AH2A 3FJIA 3O4OA 4DENA 1S0GA 4MZFB 4AN6A 2AXMA 5F90A 1HIBA 3ZXDA 4JKQA 3V0AA 2VU9A 1KNMA 4ZOTA 3AZWA 2D7IA 1TIEA 31BIA 1R8OA 3N7LA 4J2YA 1S0LA 5F8WA 3O44A 2VXTI 1BFCA 1PUUB 2FDBM 2BEBA 2D1ZA 4I3NA 1VCLA 4ZFWB 3RTIB 3CRIA 3EF2A 4I4SA 5D61A 4WBCA 4I1EA 3R4SA 2Y9FA 5BVPI 4I4OA 4ZFYB 2F2FA 4I4RA 4Q9PA 3CA4A 3I2AA 4USPA 1TP0A 1FWUA 4J2SA 1PC8B 1K5UA 3FJJA 1FV2A 5B2HA 2KH2A 4F83A 2D43A 3O4AA 3LTQA 3CAHA 2BEAA 2YUGA 1IT0A 1G9BA 4EEEB 3CRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A21 A;  3QYD A;  1IOB A;  1HWN B;  1QXM A;  3N7J A;  5FNW A;  3A23 A;  3FJD A;  2RQ9 A;  1FWV A;  1Q1U A;  3KMV A;  3MAL A;  4IY8 A;  4GAI A;  5F8Y A;  3ZX7 A;  3RTJ B;  2X2S A;  1ITB A;  1T4Q A;  3PG0 A;  2FO1 A;  3VT0 A;  4AN7 B;  3I29 B;  5D63 A;  2I1B A;  4I4X A;  2L5X A;  3T8S A;  4G6M A;  4LO2 A;  2ZQO A;  4LO1 C;  4A7Z A;  1G82 A;  3P6J A;  5DZU A;  1QQK A;  1GGP B;  3BTA A;  3S8K A;  4X3A A;  4P0L A;  2VSE A;  2F2F C;  4G9N A;  2M49 A;  4EKX B;  1XZZ A;  1T9F A;  3BB2 A;  3V0B A;  2ERM A;  2F8X C;  5DSS B;  4ZA3 B;  4LO3 A;  2K43 A;  2D7R A;  4H04 A;  3FJK A;  2Y9X E;  1MD6 A;  1JLX A;  21BI A;  1XG6 A;  1JT5 A;  1W3A A;  1JTC A;  1JT7 A;  3V0A B;  2NM1 A;  3BAQ A;  3AH4 A;  2P39 A;  3A07 A;  3BAH A;  3VSF A;  1J0S A;  4XFU A;  3OJ2 A;  5JMC A;  3O49 A;  2ESU A;  3OJV A;  3BA4 A;  3I2X A;  2VLC A;  3O5W B;  4GAF A;  1Z0H A;  1BFB A;  3CA0 A;  4IZE A;  3VWC A;  1G9A A;  3VT1 A;  1ISV A;  5G00 A;  4LO2 C;  5DUY A;  3NBC A;  3CA3 A;  3MPP G;  4EFQ A;  4IZX A;  2IWT B;  1Z4S A;  3FJA A;  4OWJ A;  3FJ9 A;  3PUB A;  2X2T A;  4P6A A;  1FGA A;  1I1E A;  3FJF A;  4KEK A;  1PWA A;  4G6J A;  4QC4 A;  4QKS A;  4QAL A;  2D24 A;  3FJB A;  3HN1 A;  1ISY A;  4ISR A;  1YTO A;  2RST A;  2MC2 A;  3AJ6 A;  4D0Z A;  1M2T B;  5BQU A;  5BXS A;  1L2H A;  2VUA A;  4LO3 C;  1SZ6 B;  1BAR A;  1K5V A;  1MC9 A;  1IRA X;  41BI A;  2KI4 A;  1PUM B;  1V6V A;  2D23 A;  2HWA A;  2IHO A;  2K8R A;  3O4C A;  3A22 A;  2Z48 A;  3NBE A;  2HZ9 A;  1IHK A;  4OUJ A;  1DQO A;  1I1B A;  4FVV A;  3WO4 A;  4LO1 A;  3VT2 A;  3OGG A;  1BA7 A;  3VUO A;  4ZBV B;  2HW9 A;  5BOW A;  4ZGR B;  2AQZ A;  3RSJ A;  3F1R A;  2R9K B;  4II0 A;  3BRD A;  1RG8 A;  1YXW A;  4XFT A;  1RY7 A;  1TTU A;  3OGF A;  4END A;  1S0B A;  5EG6 C;  2D22 A;  1HWP B;  1P63 A;  1OQL B;  2KKI A;  1YBI A;  3O3Q A;  4G1R A;  3V0B B;  1HKN A;  2AFG A;  4OEF A;  3IM7 A;  1V6X A;  1JLY A;  2WRY A;  4XKI A;  1BFG A;  4X37 A;  1N4K A;  4OWL A;  1F31 A;  3CRG A;  4Z8S B;  4I0Y A;  1EV2 A;  4G9M A;  4F34 A;  5EHA A;  3FJH A;  4QD2 C;  3AJ5 A;  4I6I A;  5BQU C;  2NZ9 A;  1HWM B;  3N7K A;  4P0J A;  4CJM A;  3H6S E;  2UUS A;  3BAD A;  3O4D A;  3FJC A;  4P0K A;  4Z9W B;  1ILR 1;  3VSZ A;  1AVU A;  3AKH A;  2Z49 A;  4IYB A;  3D7W B;  3WIN A;  3IM5 A;  3POK A;  4Q91 A;  1IJT A;  3HMY A;  3FGM A;  5F8S A;  2GZB A;  3RMY A;  2Q9X A;  4LO8 B;  4I7I A;  3P53 A;  4KBB A;  3Q7X A;  3BAV A;  4I4U A;  1ISZ A;  1DFC A;  1TFM B;  4HR6 C;  4I37 A;  4GP0 A;  2XOA A;  3HBW A;  6I1B A;  4EB2 B;  3HSM A;  4HJJ A;  5FZU A;  4LO7 C;  4H9W A;  2K4A B;  3FFZ A;  1FN0 A;  3NJ5 A;  2LIE A;  4IHZ A;  1NZK A;  3QR5 A;  1YF8 B;  3OJM A;  1DJS B;  3TC2 A;  3WO3 A;  1AVX B;  1FMZ A;  2KLL A;  3UDA A;  3NBD A;  3O4B A;  1HCE A;  1S0C A;  4OEG A;  3CA5 A;  4PC4 A;  3HAL A;  5FZZ A;  1DZC A;  2E4M A;  4I8M A;  3OBT A;  4J2X A;  3CA1 A;  1R8N A;  4QO3 A;  3RMX A;  4OW4 A;  1V6U A;  3WIN C;  4ZKT B;  1TOO A;  2MLL B;  2ET2 A;  3Q7Y A;  2KI6 B;  5E24 E;  4I4P A;  2RG9 B;  1W3F A;  2Y9W C;  4R6U B;  1AVW B;  4ZLB B;  4LO7 B;  8I1B A;  1V6W A;  2QN4 A;  3FUQ A;  1FQ9 A;  1IRP A;  3FJ8 A;  1TWE A;  4D8H A;  4J23 B;  5I1B A;  1ISW A;  2FFV A;  3UJ4 A;  1W3G A;  4GP3 A;  1BFF A;  1AVA C;  4X39 A;  3UD7 A;  5JLV A;  4J2K A;  3CA6 A;  3WO2 A;  4QKR A;  3CU1 B;  2NP0 A;  3WA1 A;  2BFH A;  2ZQN A;  3BAO A;  1EYL A;  3SNV A;  3HOM A;  4QBV A;  1YYN A;  3BX1 C;  3WMV A;  1XYF A;  1G9C A;  1RML A;  4ISQ A;  1EPW A;  3BRF A;  3B9U A;  2DRE A;  1AFC A;  2E4M C;  1Z2V A;  3JUT A;  4JRA A;  4ION A;  3H6R A;  4LO0 A;  2ZR1 B;  1XHB A;  4TLP A;  3NBN A;  1HCD A;  3JRR A;  4GOV A;  4KC3 A;  5BXP A;  3C9Z A;  3F62 B;  1TWM A;  1Q04 A;  4JPZ A;  3ILA A;  4A7Y A;  1AXM A;  1DQG A;  5BP5 C;  3AKI A;  4FGF A;  4JAW A;  3WMU A;  1E0O A;  1AF9 A;  4IY9 A;  2NTD A;  1EVT A;  3CQA A;  5FNX A;  3BA5 A;  4X38 A;  1WBC A;  4JQ0 A;  3AH1 A;  4DCK C;  1QQL A;  1CVS A;  4I2S A;  1ISX A;  4DEP A;  1JT3 A;  3IM6 A;  4KEI A;  9ILB A;  4YOL A;  3P6I A;  1G9D A;  3BAU A;  2D20 A;  2Y9G A;  3FJE A;  1Q03 A;  3ZC8 A;  2DS0 A;  2P23 A;  2MIB A;  4JP0 A;  2FGF A;  1JT4 A;  3N0K A;  4I1B A;  2Q3N B;  7I1B A;  4L4H A;  1UPS A;  4I4Y A;  4LO0 C;  3IIR A;  3PME A;  4QBC A;  3AKF A;  4OWK A;  1SR4 A;  3ZXG A;  2GO2 A;  1HWO B;  3UJ0 A;  1DIW A;  4HA2 A;  4QD2 B;  4XFS A;  4A7K A;  3V79 C;  5FZY A;  1S0E A;  2HWM A;  2D44 A;  3BA7 A;  5GAQ A;  3BRG C;  4I96 A;  1DZD A;  1CE7 B;  2FFU A;  2QYI B;  3OBR A;  1WBA A;  4Q9G A;  3BAG A;  4OEE A;  1II4 A;  1ABR B;  3R4U A;  3IAG C;  4JKX B;  2LIQ A;  4I4V A;  5HPZ A;  2NYY A;  2VXR A;  1FV3 A;  3S8J A;  4USO A;  1NUN A;  4EFP A;  3UD8 A;  1M16 A;  5DVH A;  1S0F A;  5EC5 A;  1D0H A;  5D62 A;  2DRY A;  3H6R B;  3ZC9 A;  1PZZ A;  4D0T A;  2WBC A;  1BLD A;  3W9T A;  4ZFU B;  1BAS A;  5BP5 A;  4EFR A;  3Q7W A;  1ONK B;  2J3P A;  3K1X A;  3FUO A;  1FMM S;  1DFQ A;  1SR4 C;  1WD3 A;  4IQP A;  1A8D A;  5BXT A;  3AZV A;  1IIL A;  4L4I A;  1JQZ A;  3H6Q A;  4I4Q A;  1RZO B;  2VSA A;  1JY0 A;  3E8L C;  1S0D A;  4KEJ A;  3UD9 A;  2AAI B;  1WD4 A;  4GOY A;  5BXR A;  2DRZ A;  3AKG A;  2NVH A;  3LLP A;  3N7M A;  3VEQ A;  3PHZ A;  1DLL A;  1BLA A;  3AH2 A;  3FJI A;  3O4O A;  4DEN A;  1S0G A;  4AN6 A;  2AXM A;  5F90 A;  1HIB A;  3ZXD A;  4JKQ A;  3V0A A;  2VU9 A;  1KNM A;  4ZOT A;  3AZW A;  2D7I A;  1TIE A;  31BI A;  1R8O A;  3N7L A;  4J2Y A;  1S0L A;  5F8W A;  3O44 A;  2VXT I;  1BFC A;  1PUU B;  2FDB M;  2BEB A;  2D1Z A;  4I3N A;  1VCL A;  4ZFW B;  3RTI B;  3CRI A;  3EF2 A;  4I4S A;  5D61 A;  4WBC A;  4I1E A;  3R4S A;  2Y9F A;  5BVP I;  4I4O A;  4ZFY B;  2F2F A;  4I4R A;  4Q9P A;  3CA4 A;  3I2A A;  4USP A;  1TP0 A;  1FWU A;  4J2S A;  1PC8 B;  1K5U A;  3FJJ A;  1FV2 A;  5B2H A;  2KH2 A;  4F83 A;  2D43 A;  3O4A A;  3LTQ A;  3CAH A;  2BEA A;  2YUG A;  1IT0 A;  1G9B A;  4EEE B;  3CRH A; 
#chains in the Genus database with same CATH topology
 3A21 A;  3QYD A;  1IOB A;  1HWN B;  1QXM A;  3N7J A;  5FNW A;  3A23 A;  3FJD A;  2RQ9 A;  1FWV A;  1Q1U A;  3KMV A;  3MAL A;  4IY8 A;  4GAI A;  5F8Y A;  3ZX7 A;  3RTJ B;  2X2S A;  1ITB A;  1T4Q A;  3PG0 A;  2FO1 A;  3VT0 A;  4AN7 B;  3I29 B;  5D63 A;  2I1B A;  4I4X A;  2L5X A;  3T8S A;  4G6M A;  4LO2 A;  2ZQO A;  4LO1 C;  4A7Z A;  1G82 A;  3P6J A;  5DZU A;  1QQK A;  1GGP B;  3BTA A;  3S8K A;  4X3A A;  4P0L A;  2VSE A;  2F2F C;  4G9N A;  2M49 A;  4EKX B;  1XZZ A;  1T9F A;  3BB2 A;  3V0B A;  2ERM A;  2F8X C;  5DSS B;  4ZA3 B;  4LO3 A;  2K43 A;  2D7R A;  4H04 A;  3FJK A;  2Y9X E;  1MD6 A;  1JLX A;  21BI A;  1XG6 A;  1JT5 A;  1W3A A;  1JTC A;  1JT7 A;  3V0A B;  2NM1 A;  3BAQ A;  3AH4 A;  2P39 A;  3A07 A;  3BAH A;  3VSF A;  1J0S A;  4XFU A;  3OJ2 A;  5JMC A;  3O49 A;  2ESU A;  3OJV A;  3BA4 A;  3I2X A;  2VLC A;  3O5W B;  4GAF A;  1Z0H A;  1BFB A;  3CA0 A;  4IZE A;  3VWC A;  1G9A A;  3VT1 A;  1ISV A;  5G00 A;  4LO2 C;  5DUY A;  3NBC A;  3CA3 A;  3MPP G;  4EFQ A;  4IZX A;  2IWT B;  1Z4S A;  3FJA A;  4OWJ A;  3FJ9 A;  3PUB A;  2X2T A;  4P6A A;  1FGA A;  1I1E A;  3FJF A;  4KEK A;  1PWA A;  4G6J A;  4QC4 A;  4QKS A;  4QAL A;  2D24 A;  3FJB A;  2NS2 A;  1ISY A;  3HN1 A;  4ISR A;  1YTO A;  2RST A;  2MC2 A;  3AJ6 A;  4D0Z A;  1M2T B;  5BQU A;  5BXS A;  1L2H A;  2VUA A;  4LO3 C;  1SZ6 B;  1BAR A;  1K5V A;  1MC9 A;  1IRA X;  41BI A;  2KI4 A;  1PUM B;  1V6V A;  2D23 A;  2HWA A;  2IHO A;  2K8R A;  3O4C A;  3A22 A;  2Z48 A;  3NBE A;  2HZ9 A;  1IHK A;  4OUJ A;  1DQO A;  1I1B A;  4H75 A;  4FVV A;  3WO4 A;  4LO1 A;  3VT2 A;  3OGG A;  1BA7 A;  3VUO A;  4ZBV B;  2HW9 A;  5BOW A;  4ZGR B;  2AQZ A;  3RSJ A;  3F1R A;  2R9K B;  4II0 A;  3BRD A;  1RG8 A;  1YXW A;  4XFT A;  1RY7 A;  1TTU A;  3OGF A;  4END A;  1S0B A;  5EG6 C;  2D22 A;  1HWP B;  1P63 A;  1OQL B;  2KKI A;  1YBI A;  3O3Q A;  4G1R A;  3V0B B;  1HKN A;  2AFG A;  4OEF A;  3IM7 A;  1V6X A;  1JLY A;  2WRY A;  4XKI A;  1BFG A;  4X37 A;  1N4K A;  4OWL A;  1F31 A;  3CRG A;  4Z8S B;  4I0Y A;  1EV2 A;  4G9M A;  4F34 A;  5EHA A;  3FJH A;  4QD2 C;  3AJ5 A;  4I6I A;  5BQU C;  2NZ9 A;  1HWM B;  3N7K A;  4P0J A;  4CJM A;  3H6S E;  2UUS A;  3BAD A;  3O4D A;  3FJC A;  4P0K A;  4Z9W B;  1ILR 1;  3VSZ A;  1AVU A;  3AKH A;  2Z49 A;  4IYB A;  3D7W B;  3WIN A;  3IM5 A;  3POK A;  4Q91 A;  1IJT A;  3HMY A;  3FGM A;  5F8S A;  2GZB A;  3RMY A;  2Q9X A;  4LO8 B;  4I7I A;  3P53 A;  4KBB A;  3Q7X A;  3BAV A;  4I4U A;  1ISZ A;  1DFC A;  1TFM B;  4HR6 C;  4I37 A;  4GP0 A;  2XOA A;  3HBW A;  6I1B A;  4EB2 B;  3HSM A;  4HJJ A;  5FZU A;  4LO7 C;  4H9W A;  2K4A B;  3FFZ A;  1FN0 A;  3NJ5 A;  2LIE A;  4IHZ A;  1NZK A;  3QR5 A;  1YF8 B;  3OJM A;  1DJS B;  3TC2 A;  3WO3 A;  1AVX B;  1FMZ A;  2KLL A;  3UDA A;  3NBD A;  3O4B A;  1HCE A;  1S0C A;  4OEG A;  3CA5 A;  4PC4 A;  3HAL A;  5FZZ A;  1DZC A;  2E4M A;  4I8M A;  3OBT A;  4J2X A;  3CA1 A;  1R8N A;  4QO3 A;  3RMX A;  4OW4 A;  1V6U A;  3WIN C;  4ZKT B;  1TOO A;  2MLL B;  2ET2 A;  3Q7Y A;  2KI6 B;  5E24 E;  4I4P A;  2RG9 B;  1W3F A;  2Y9W C;  4R6U B;  1AVW B;  4ZLB B;  4LO7 B;  8I1B A;  1V6W A;  2QN4 A;  3FUQ A;  1FQ9 A;  1IRP A;  3FJ8 A;  1TWE A;  4D8H A;  4J23 B;  5I1B A;  1ISW A;  2FFV A;  3UJ4 A;  1W3G A;  4UY4 A;  4GP3 A;  1BFF A;  1AVA C;  4X39 A;  3UD7 A;  5JLV A;  4J2K A;  3CA6 A;  3WO2 A;  4QKR A;  3CU1 B;  2NP0 A;  3WA1 A;  2BFH A;  2ZQN A;  3BAO A;  1EYL A;  3SNV A;  3HOM A;  4QBV A;  1YYN A;  3BX1 C;  3WMV A;  1XYF A;  1G9C A;  1RML A;  4ISQ A;  1EPW A;  3BRF A;  3B9U A;  2DRE A;  1AFC A;  2E4M C;  1Z2V A;  3JUT A;  4JRA A;  4ION A;  3H6R A;  4LO0 A;  2ZR1 B;  1XHB A;  4TLP A;  3NBN A;  1HCD A;  4MZG B;  3JRR A;  4GOV A;  4KC3 A;  5BXP A;  3C9Z A;  3F62 B;  1TWM A;  1Q04 A;  4JPZ A;  3ILA A;  4A7Y A;  1AXM A;  1DQG A;  5BP5 C;  3AKI A;  4FGF A;  4JAW A;  3WMU A;  1E0O A;  1AF9 A;  4IY9 A;  2NTD A;  1EVT A;  3CQA A;  5FNX A;  3BA5 A;  4X38 A;  1WBC A;  4JQ0 A;  3AH1 A;  4DCK C;  1QQL A;  1CVS A;  4I2S A;  1ISX A;  4DEP A;  1JT3 A;  3IM6 A;  4KEI A;  9ILB A;  4YOL A;  3P6I A;  1G9D A;  3BAU A;  2D20 A;  2Y9G A;  3FJE A;  1Q03 A;  3ZC8 A;  2DS0 A;  2P23 A;  2MIB A;  4JP0 A;  2FGF A;  1JT4 A;  3N0K A;  4I1B A;  2Q3N B;  7I1B A;  4L4H A;  1UPS A;  4I4Y A;  4LO0 C;  3IIR A;  3PME A;  4QBC A;  3AKF A;  4OWK A;  1SR4 A;  3ZXG A;  2GO2 A;  1HWO B;  3UJ0 A;  1DIW A;  4HA2 A;  4QD2 B;  4XFS A;  4A7K A;  3V79 C;  5FZY A;  1S0E A;  4MZH A;  2HWM A;  2D44 A;  3BA7 A;  5GAQ A;  3BRG C;  4I96 A;  1DZD A;  1CE7 B;  2FFU A;  2QYI B;  3OBR A;  1WBA A;  4Q9G A;  3BAG A;  4OEE A;  1II4 A;  1ABR B;  3R4U A;  3IAG C;  4JKX B;  2LIQ A;  4I4V A;  5HPZ A;  2NYY A;  2VXR A;  1FV3 A;  3S8J A;  4USO A;  1NUN A;  4EFP A;  3UD8 A;  1M16 A;  5DVH A;  1S0F A;  5EC5 A;  1D0H A;  5D62 A;  2DRY A;  3H6R B;  3ZC9 A;  1PZZ A;  4D0T A;  2WBC A;  1BLD A;  3W9T A;  4ZFU B;  1BAS A;  5BP5 A;  4EFR A;  3Q7W A;  1ONK B;  2J3P A;  3K1X A;  3FUO A;  1FMM S;  1DFQ A;  1SR4 C;  1WD3 A;  4IQP A;  1A8D A;  5BXT A;  3AZV A;  1IIL A;  4L4I A;  1JQZ A;  3H6Q A;  4I4Q A;  1RZO B;  2VSA A;  1JY0 A;  3E8L C;  1S0D A;  4KEJ A;  3UD9 A;  2AAI B;  1WD4 A;  4GOY A;  5BXR A;  2DRZ A;  3AKG A;  2NVH A;  3LLP A;  3N7M A;  3VEQ A;  3PHZ A;  1DLL A;  1BLA A;  3AH2 A;  3FJI A;  3O4O A;  4DEN A;  1S0G A;  4MZF B;  4AN6 A;  2AXM A;  5F90 A;  1HIB A;  3ZXD A;  4JKQ A;  3V0A A;  2VU9 A;  1KNM A;  4ZOT A;  3AZW A;  2D7I A;  1TIE A;  31BI A;  1R8O A;  3N7L A;  4J2Y A;  1S0L A;  5F8W A;  3O44 A;  2VXT I;  1BFC A;  1PUU B;  2FDB M;  2BEB A;  2D1Z A;  4I3N A;  1VCL A;  4ZFW B;  3RTI B;  3CRI A;  3EF2 A;  4I4S A;  5D61 A;  4WBC A;  4I1E A;  3R4S A;  2Y9F A;  5BVP I;  4I4O A;  4ZFY B;  2F2F A;  4I4R A;  4Q9P A;  3CA4 A;  3I2A A;  4USP A;  1TP0 A;  1FWU A;  4J2S A;  1PC8 B;  1K5U A;  3FJJ A;  1FV2 A;  5B2H A;  2KH2 A;  4F83 A;  2D43 A;  3O4A A;  3LTQ A;  3CAH A;  2BEA A;  2YUG A;  1IT0 A;  1G9B A;  4EEE B;  3CRH A; 
#chains in the Genus database with same CATH homology
 3A21 A;  3QYD A;  1IOB A;  1HWN B;  1QXM A;  3N7J A;  5FNW A;  3A23 A;  3FJD A;  2RQ9 A;  1FWV A;  1Q1U A;  3KMV A;  3MAL A;  4IY8 A;  4GAI A;  5F8Y A;  3ZX7 A;  3RTJ B;  2X2S A;  1ITB A;  1T4Q A;  3PG0 A;  2FO1 A;  3VT0 A;  4AN7 B;  3I29 B;  5D63 A;  2I1B A;  4I4X A;  2L5X A;  3T8S A;  4G6M A;  4LO2 A;  2ZQO A;  4LO1 C;  4A7Z A;  1G82 A;  3P6J A;  5DZU A;  1QQK A;  1GGP B;  3BTA A;  3S8K A;  4X3A A;  4P0L A;  2VSE A;  2F2F C;  4G9N A;  2M49 A;  4EKX B;  1XZZ A;  1T9F A;  3BB2 A;  3V0B A;  2ERM A;  2F8X C;  5DSS B;  4ZA3 B;  4LO3 A;  2K43 A;  2D7R A;  4H04 A;  3FJK A;  2Y9X E;  1MD6 A;  1JLX A;  21BI A;  1XG6 A;  1JT5 A;  1W3A A;  1JTC A;  1JT7 A;  3V0A B;  2NM1 A;  3BAQ A;  3AH4 A;  2P39 A;  3A07 A;  3BAH A;  3VSF A;  1J0S A;  4XFU A;  3OJ2 A;  5JMC A;  3O49 A;  2ESU A;  3OJV A;  3BA4 A;  3I2X A;  2VLC A;  3O5W B;  4GAF A;  1Z0H A;  1BFB A;  3CA0 A;  4IZE A;  3VWC A;  1G9A A;  3VT1 A;  1ISV A;  5G00 A;  4LO2 C;  5DUY A;  3NBC A;  3CA3 A;  3MPP G;  4EFQ A;  4IZX A;  2IWT B;  1Z4S A;  3FJA A;  4OWJ A;  3FJ9 A;  3PUB A;  2X2T A;  4P6A A;  1FGA A;  1I1E A;  3FJF A;  4KEK A;  1PWA A;  4G6J A;  4QC4 A;  4QKS A;  4QAL A;  2D24 A;  3FJB A;  2NS2 A;  1ISY A;  3HN1 A;  4ISR A;  1YTO A;  2RST A;  2MC2 A;  3AJ6 A;  4D0Z A;  1M2T B;  5BQU A;  5BXS A;  1L2H A;  2VUA A;  4LO3 C;  1SZ6 B;  1BAR A;  1K5V A;  1MC9 A;  1IRA X;  41BI A;  2KI4 A;  1PUM B;  1V6V A;  2D23 A;  2HWA A;  2IHO A;  2K8R A;  3O4C A;  3A22 A;  2Z48 A;  3NBE A;  2HZ9 A;  1IHK A;  4OUJ A;  1DQO A;  1I1B A;  4H75 A;  4FVV A;  3WO4 A;  4LO1 A;  3VT2 A;  3OGG A;  1BA7 A;  3VUO A;  4ZBV B;  2HW9 A;  5BOW A;  4ZGR B;  2AQZ A;  3RSJ A;  3F1R A;  2R9K B;  4II0 A;  3BRD A;  1RG8 A;  1YXW A;  4XFT A;  1RY7 A;  1TTU A;  3OGF A;  4END A;  1S0B A;  5EG6 C;  2D22 A;  1HWP B;  1P63 A;  1OQL B;  2KKI A;  1YBI A;  3O3Q A;  4G1R A;  3V0B B;  1HKN A;  2AFG A;  4OEF A;  3IM7 A;  1V6X A;  1JLY A;  2WRY A;  4XKI A;  1BFG A;  4X37 A;  1N4K A;  4OWL A;  1F31 A;  3CRG A;  4Z8S B;  4I0Y A;  1EV2 A;  4G9M A;  4F34 A;  5EHA A;  3FJH A;  4QD2 C;  3AJ5 A;  4I6I A;  5BQU C;  2NZ9 A;  1HWM B;  3N7K A;  4P0J A;  4CJM A;  3H6S E;  2UUS A;  3BAD A;  3O4D A;  3FJC A;  4P0K A;  4Z9W B;  1ILR 1;  3VSZ A;  1AVU A;  3AKH A;  2Z49 A;  4IYB A;  3D7W B;  3WIN A;  3IM5 A;  3POK A;  4Q91 A;  1IJT A;  3HMY A;  3FGM A;  5F8S A;  2GZB A;  3RMY A;  2Q9X A;  4LO8 B;  4I7I A;  3P53 A;  4KBB A;  3Q7X A;  3BAV A;  4I4U A;  1ISZ A;  1DFC A;  1TFM B;  4HR6 C;  4I37 A;  4GP0 A;  2XOA A;  3HBW A;  6I1B A;  4EB2 B;  3HSM A;  4HJJ A;  5FZU A;  4LO7 C;  4H9W A;  2K4A B;  3FFZ A;  1FN0 A;  3NJ5 A;  2LIE A;  4IHZ A;  1NZK A;  3QR5 A;  1YF8 B;  3OJM A;  1DJS B;  3TC2 A;  3WO3 A;  1AVX B;  1FMZ A;  2KLL A;  3UDA A;  3NBD A;  3O4B A;  1HCE A;  1S0C A;  4OEG A;  3CA5 A;  4PC4 A;  3HAL A;  5FZZ A;  1DZC A;  2E4M A;  4I8M A;  3OBT A;  4J2X A;  3CA1 A;  1R8N A;  4QO3 A;  3RMX A;  4OW4 A;  1V6U A;  3WIN C;  4ZKT B;  1TOO A;  2MLL B;  2ET2 A;  3Q7Y A;  2KI6 B;  5E24 E;  4I4P A;  2RG9 B;  1W3F A;  2Y9W C;  4R6U B;  1AVW B;  4ZLB B;  4LO7 B;  8I1B A;  1V6W A;  2QN4 A;  3FUQ A;  1FQ9 A;  1IRP A;  3FJ8 A;  1TWE A;  4D8H A;  4J23 B;  5I1B A;  1ISW A;  2FFV A;  3UJ4 A;  1W3G A;  4UY4 A;  4GP3 A;  1BFF A;  1AVA C;  4X39 A;  3UD7 A;  5JLV A;  4J2K A;  3CA6 A;  3WO2 A;  4QKR A;  3CU1 B;  2NP0 A;  3WA1 A;  2BFH A;  2ZQN A;  3BAO A;  1EYL A;  3SNV A;  3HOM A;  4QBV A;  1YYN A;  3BX1 C;  3WMV A;  1XYF A;  1G9C A;  1RML A;  4ISQ A;  1EPW A;  3BRF A;  3B9U A;  2DRE A;  1AFC A;  2E4M C;  1Z2V A;  3JUT A;  4JRA A;  4ION A;  3H6R A;  4LO0 A;  2ZR1 B;  1XHB A;  4TLP A;  3NBN A;  1HCD A;  4MZG B;  3JRR A;  4GOV A;  4KC3 A;  5BXP A;  3C9Z A;  3F62 B;  1TWM A;  1Q04 A;  4JPZ A;  3ILA A;  4A7Y A;  1AXM A;  1DQG A;  5BP5 C;  3AKI A;  4FGF A;  4JAW A;  3WMU A;  1E0O A;  1AF9 A;  4IY9 A;  2NTD A;  1EVT A;  3CQA A;  5FNX A;  3BA5 A;  4X38 A;  1WBC A;  4JQ0 A;  3AH1 A;  4DCK C;  1QQL A;  1CVS A;  4I2S A;  1ISX A;  4DEP A;  1JT3 A;  3IM6 A;  4KEI A;  9ILB A;  4YOL A;  3P6I A;  1G9D A;  3BAU A;  2D20 A;  2Y9G A;  3FJE A;  1Q03 A;  3ZC8 A;  2DS0 A;  2P23 A;  2MIB A;  4JP0 A;  2FGF A;  1JT4 A;  3N0K A;  4I1B A;  2Q3N B;  7I1B A;  4L4H A;  1UPS A;  4I4Y A;  4LO0 C;  3IIR A;  3PME A;  4QBC A;  3AKF A;  4OWK A;  1SR4 A;  3ZXG A;  2GO2 A;  1HWO B;  3UJ0 A;  1DIW A;  4HA2 A;  4QD2 B;  4XFS A;  4A7K A;  3V79 C;  5FZY A;  1S0E A;  4MZH A;  2HWM A;  2D44 A;  3BA7 A;  5GAQ A;  3BRG C;  4I96 A;  1DZD A;  1CE7 B;  2FFU A;  2QYI B;  3OBR A;  1WBA A;  4Q9G A;  3BAG A;  4OEE A;  1II4 A;  1ABR B;  3R4U A;  3IAG C;  4JKX B;  2LIQ A;  4I4V A;  5HPZ A;  2NYY A;  2VXR A;  1FV3 A;  3S8J A;  4USO A;  1NUN A;  4EFP A;  3UD8 A;  1M16 A;  5DVH A;  1S0F A;  5EC5 A;  1D0H A;  5D62 A;  2DRY A;  3H6R B;  3ZC9 A;  1PZZ A;  4D0T A;  2WBC A;  1BLD A;  3W9T A;  4ZFU B;  1BAS A;  5BP5 A;  4EFR A;  3Q7W A;  1ONK B;  2J3P A;  3K1X A;  3FUO A;  1FMM S;  1DFQ A;  1SR4 C;  1WD3 A;  4IQP A;  1A8D A;  5BXT A;  3AZV A;  1IIL A;  4L4I A;  1JQZ A;  3H6Q A;  4I4Q A;  1RZO B;  2VSA A;  1JY0 A;  3E8L C;  1S0D A;  4KEJ A;  3UD9 A;  2AAI B;  1WD4 A;  4GOY A;  5BXR A;  2DRZ A;  3AKG A;  2NVH A;  3LLP A;  3N7M A;  3VEQ A;  3PHZ A;  1DLL A;  1BLA A;  3AH2 A;  3FJI A;  3O4O A;  4DEN A;  1S0G A;  4MZF B;  4AN6 A;  2AXM A;  5F90 A;  1HIB A;  3ZXD A;  4JKQ A;  3V0A A;  2VU9 A;  1KNM A;  4ZOT A;  3AZW A;  2D7I A;  1TIE A;  31BI A;  1R8O A;  3N7L A;  4J2Y A;  1S0L A;  5F8W A;  3O44 A;  2VXT I;  1BFC A;  1PUU B;  2FDB M;  2BEB A;  2D1Z A;  4I3N A;  1VCL A;  4ZFW B;  3RTI B;  3CRI A;  3EF2 A;  4I4S A;  5D61 A;  4WBC A;  4I1E A;  3R4S A;  2Y9F A;  5BVP I;  4I4O A;  4ZFY B;  2F2F A;  4I4R A;  4Q9P A;  3CA4 A;  3I2A A;  4USP A;  1TP0 A;  1FWU A;  4J2S A;  1PC8 B;  1K5U A;  3FJJ A;  1FV2 A;  5B2H A;  2KH2 A;  4F83 A;  2D43 A;  3O4A A;  3LTQ A;  3CAH A;  2BEA A;  2YUG A;  1IT0 A;  1G9B A;  4EEE B;  3CRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...