2DRYA

Crystal structure of the earthworm lectin c-terminal domain mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
b'PKFFYIKSELNGKVLDIGGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDNVLGVIKSDKGASAHICAWKQHGGPNQKFIIESE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 29-kDa galactose-binding lectin
publication title Tailoring a novel sialic acid-binding lectin from a ricin-B chain-like galactose-binding protein by natural evolution-mimicry
pubmed doi rcsb
source organism Lumbricus terrestris
molecule tags Sugar binding protein
total genus 36
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2dryA00
3OJVA 1L2HA 4A7ZA 2YUGA 2KLLA 3P53A 5D61A 4IY9A 1EV2A 3BTAA 4OEGA 1Z2VA 3E8LC 1XZZA 1T9FA 3HSMA 4FVVA 5DUYA 2NZ9A 1HWNB 1AF9A 4EKXB 1BFBA 3AZVA 1SZ6B 4G6MA 4LO1A 4HJJA 2WBCA 3A22A 3O4AA 1YXWA 3FFZA 3N0KA 2FDBM 1BASA 5BXTA 2MIBA 1HWOB 3CRIA 4ISRA 4ZFUB 1ISYA 1DFCA 2AAIB 1TFMB 2VSAA 2L5XA 3N7JA 4OEEA 1WD4A 1W3AA 1S0LA 4AN7B 4IHZA 4I8MA 2P39A 3UD7A 3H6SE 3VT0A 2FGFA 4JRAA 3O5WB 3LLPA 1SR4A 1TOOA 4P6AA 2AFGA 4H04A 1BARA 4D8HA 5BXSA 4QC4A 1VCLA 4G9NA 1V6VA 1RG8A 1JQZA 4P0LA 1HIBA 3PUBA 4HA2A 5BOWA 4ZLBB 3WO3A 2QYIB 4XFSA 4JKXB 4JPZA 3K1XA 5JMCA 4J23B 2ZQOA 1G82A 1XYFA 4X3AA 3BRGC 5BXRA 4Q91A 4R6UB 2FFUA 1WBAA 2AQZA 3BB2A 3OJ2A 4I96A 3AH1A 1IT0A 2KKIA 3AH2A 1DQGA 1WD3A 3FJCA 3RTIB 4XKIA 1BFCA 4FGFA 3FJ8A 7I1BA 2I1BA 4USPA 4YOLA 2X2SA 3S8KA 1TP0A 3O4BA 1V6UA 5D62A 1YTOA 3O4DA 3AKHA 1S0FA 4Z9WB 1DZCA 3WO4A 4IYBA 1ISZA 2HWMA 1UPSA 4L4HA 1ISVA 3AZWA 1BLAA 3AKGA 4IZXA 4ZBVB 3CRHA 4A7KA 1M2TB 2HW9A 3IM5A 4I0YA 1ITBA 4ZA3B 9ILBA 1QXMA 1XHBA 3CAHA 1FWUA 2D43A 1FN0A 2GZBA 1ONKB 2LIQA 4J2SA 2E4MA 4I4VA 3ZC8A 3IM7A 3FJBA 2Z48A 3BAGA 3QR5A 4D0ZA 2FO1A 2LIEA 1AXMA 2NVHA 2VU9A 4HR6C 3W9TA 2ESUA 1I1BA 2FFVA 3FJKA 3PHZA 4I4PA 3WMVA 4LO0C 4I3NA 4OWKA 4EB2B 4KC3A 1AVWB 4I4QA 3HBWA 3PG0A 2P23A 4GP0A 4I37A 4I2SA 1JT3A 2M49A 1J0SA 2F2FA 4LO3C 3RMXA 1TTUA 1G9DA 3B9UA 2AXMA 3CA1A 3BA7A 1I1EA 1QQLA 3VSFA 3BRDA 1DLLA 3O4OA 1YYNA 4Z8SB 1IRAX 5BVPI 1JT5A 1NZKA 2Z49A 2D23A 2Y9FA 4KEKA 4ZFWB 4AN6A 2VSEA 1QQKA 2QN4A 4WBCA 5FZUA 1ISWA 4JQ0A 3FJIA 4JAWA 2RQ9A 4XFTA 1N4KA 3UDAA 5BQUA 3BAUA 4QKRA 5EHAA 3CRGA 4GP3A 3OBRA 1IILA 2ET2A 2HWAA 3P6JA 5DSSB 3BRFA 4ZKTB 4JKQA 1EVTA 5DZUA 3VUOA 1JLXA 1P63A 2VXRA 3Q7YA 3F62B 3WINA 3VEQA 4D0TA 4IONA 4EEEB 4Q9PA 2K43A 3CQAA 4DENA 2J3PA 5GAQA 2RSTA 3FJDA 3V0BA 4KEIA 3BX1C 3R4UA 31BIA 3A23A 3WA1A 1FWVA 3RTJB 3BAVA 3R4SA 1FMMS 1S0EA 1WBCA 5G00A 1FV2A 3FJFA 3BA5A 3H6RA 1W3GA 1R8OA 1IJTA 3TC2A 5BP5A 1G9BA 1Z0HA 1SR4C 4P0JA 1PWAA 2KH2A 1NUNA 2GO2A 1TIEA 1AFCA 3HN1A 3CA3A 3AKFA 1S0DA 4Q9GA 1JTCA 1HKNA 4LO7B 1D0HA 1M16A 2D44A 3FJEA 3WMUA 2HZ9A 3IIRA 3ZXGA 4J2XA 4GAFA 3V0BB 4QD2B 2MC2A 4I7IA 3CA6A 3POKA 3NBEA 5F8SA 8I1BA 2Y9WC 3HMYA 4QO3A 5FZYA 3I2XA 5I1BA 2ZR1B 4IQPA 4LO2A 1FQ9A 3FUQA 3SNVA 1EYLA 1K5UA 3H6RB 1CE7B 3VSZA 2VUAA 3UD8A 3BAQA 3EF2A 4DCKC 3C9ZA 1S0BA 1FMZA 3QYDA 4I4RA 1DQOA 3ZXDA 2NM1A 2BEBA 3WO2A 3HALA 1JT4A 3AH4A 4LO0A 1KNMA 2ZQNA 3FJ9A 4X39A 2NP0A 2VXTI 2DRZA 3BAHA 1TWMA 1DJSB 4A7YA 3AJ6A 3FGMA 2KI4A 4EFQA 1IRPA 1OQLB 3CA0A 3Q7WA 4OUJA 3I29B 3NJ5A 1BFFA 2IWTB 4I1EA 3JRRA 4QALA 3ZX7A 1MC9A 2IHOA 3OJMA 3A21A 1DFQA 4IZEA 1HWPB 1Q03A 4TLPA 1S0CA 3OGFA 2D1ZA 2E4MC 4USOA 21BIA 2VLCA 2Q9XA 3KMVA 1ILR1 1IOBA 4I1BA 3NBCA 1PZZA 3P6IA 4J2YA 4KEJA 3IM6A 1IHKA 3O4CA 3I2AA 4F83A 5DVHA 2NYYA 4QBCA 3FJHA 3HOMA 3O3QA 4I4YA 1RMLA 5FNWA 3OBTA 2R9KB 1JLYA 2BEAA 3RSJA 3OGGA 3BA4A 1JT7A 2F2FC 4QBVA 4JP0A 4X37A 5BXPA 1ISXA 2Y9XE 4F34A 1DIWA 3BAOA 3AKIA 1EPWA 4ZOTA 3UD9A 3A07A 2KI6B 4J2KA 1F31A 1GGPB 1A8DA 2MLLB 2D20A 4GOYA 3FJJA 1RZOB 5FNXA 4IY8A 3VT1A 4LO1C 2D24A 1G9AA 2DREA 3Q7XA 3NBDA 5F8WA 1TWEA 5EC5A 3D7WB 4P0KA 3VWCA 1Z4SA 3N7KA 3H6QA 1T4QA 4G1RA 5F8YA 5BQUC 2ERMA 6I1BA 4X38A 4XFUA 2K4AB 1CVSA 3CA5A 2NTDA 4I4UA 3CU1B 5E24E 3O49A 4I4SA 3RMYA 4L4IA 3BADA 3WINC 3MALA 4LO7C 4EFPA 3V0AA 4OEFA 1FV3A 1ABRB 1FGAA 1II4A 4QD2C 3MPPG 4OWLA 4ZGRB 3V79C 1DZDA 3JUTA 3F1RA 4H9WA 1BA7A 1AVAC 4KBBA 2XOAA 2D7RA 3ZC9A 5EG6C 1JY0A 3UJ4A 5D63A 3PMEA 4GOVA 2D7IA 3T8SA 5BP5C 3LTQA 1XG6A 1V6XA 1PC8B 4PC4A 1E0OA 4OW4A 2X2TA 3CA4A 3O44A 1PUUB 1BLDA 1V6WA 3UJ0A 3N7MA 1HCEA 1AVUA 3IAGC 3VT2A 3V0AB 4I4OA 5F90A 1HCDA 4II0A 1R8NA 3S8JA 1Q1UA 3FUOA 5B2HA 1RY7A 4G6JA 1W3FA 41BIA 3FJAA 4CJMA 4ZFYB 4LO2C 1BFGA 4OWJA 2D22A 4EFRA 3NBNA 4DEPA 2F8XC 1Q04A 2BFHA 3AJ5A 5JLVA 4LO3A 2UUSA 1K5VA 1AVXB 1G9CA 2RG9B 3N7LA 4GAIA 1MD6A 1PUMB 3ILAA 4ENDA 2DRYA 2WRYA 4G9MA 1YBIA 1HWMB 1S0GA 2K8RA 2Y9GA 4I4XA 4LO8B 2DS0A 4QKSA 4ISQA 5HPZA 1YF8B 4I6IA 5FZZA 2Q3NB
chains in the Genus database with same CATH superfamily
3OJVA 1L2HA 4A7ZA 2YUGA 2KLLA 3P53A 5D61A 4IY9A 1EV2A 3BTAA 4OEGA 1Z2VA 3E8LC 1XZZA 1T9FA 3HSMA 4FVVA 5DUYA 2NZ9A 1HWNB 1AF9A 4EKXB 1BFBA 3AZVA 1SZ6B 4G6MA 4LO1A 4HJJA 2WBCA 3A22A 3O4AA 1YXWA 3FFZA 3N0KA 2FDBM 1BASA 5BXTA 2MIBA 1HWOB 3CRIA 4ISRA 4ZFUB 1ISYA 1DFCA 2AAIB 1TFMB 2VSAA 2L5XA 3N7JA 4OEEA 1WD4A 1W3AA 1S0LA 4AN7B 4IHZA 4I8MA 2P39A 3UD7A 3H6SE 3VT0A 2FGFA 4JRAA 3O5WB 3LLPA 1SR4A 1TOOA 4P6AA 2AFGA 4H04A 1BARA 4D8HA 5BXSA 4QC4A 1VCLA 4G9NA 1V6VA 1RG8A 1JQZA 4P0LA 1HIBA 3PUBA 4HA2A 5BOWA 4ZLBB 3WO3A 2QYIB 4XFSA 4JKXB 4JPZA 3K1XA 5JMCA 4J23B 2ZQOA 1G82A 1XYFA 4X3AA 3BRGC 5BXRA 4Q91A 4R6UB 2FFUA 1WBAA 2AQZA 3BB2A 3OJ2A 4I96A 3AH1A 1IT0A 2KKIA 3AH2A 1DQGA 1WD3A 3FJCA 3RTIB 4XKIA 1BFCA 4FGFA 3FJ8A 7I1BA 2I1BA 4USPA 4YOLA 2X2SA 3S8KA 1TP0A 3O4BA 1V6UA 5D62A 1YTOA 3O4DA 3AKHA 1S0FA 4Z9WB 1DZCA 3WO4A 4IYBA 1ISZA 2HWMA 1UPSA 4L4HA 1ISVA 3AZWA 1BLAA 3AKGA 4IZXA 4ZBVB 3CRHA 4A7KA 1M2TB 2HW9A 3IM5A 4I0YA 1ITBA 4ZA3B 9ILBA 1QXMA 1XHBA 3CAHA 1FWUA 2D43A 1FN0A 2GZBA 1ONKB 2LIQA 4J2SA 2E4MA 4I4VA 3ZC8A 3IM7A 3FJBA 2Z48A 3BAGA 3QR5A 4D0ZA 2FO1A 2LIEA 1AXMA 2NVHA 2VU9A 4HR6C 4MZGB 3W9TA 2ESUA 1I1BA 2FFVA 3FJKA 3PHZA 4I4PA 3WMVA 4LO0C 4I3NA 4OWKA 4EB2B 4KC3A 1AVWB 4I4QA 3HBWA 3PG0A 2P23A 4GP0A 4I37A 4I2SA 1JT3A 2M49A 1J0SA 2F2FA 4LO3C 3RMXA 1TTUA 1G9DA 3B9UA 2AXMA 3CA1A 3BA7A 1I1EA 1QQLA 3VSFA 3BRDA 1DLLA 3O4OA 1YYNA 4Z8SB 1IRAX 5BVPI 1JT5A 1NZKA 2Z49A 2D23A 2Y9FA 4KEKA 4ZFWB 4AN6A 2VSEA 1QQKA 2QN4A 4WBCA 5FZUA 1ISWA 4JQ0A 3FJIA 4JAWA 2RQ9A 4XFTA 1N4KA 3UDAA 5BQUA 3BAUA 4QKRA 5EHAA 3CRGA 4GP3A 3OBRA 1IILA 2ET2A 2HWAA 3P6JA 5DSSB 3BRFA 4ZKTB 4JKQA 1EVTA 5DZUA 3VUOA 1JLXA 1P63A 2VXRA 3Q7YA 3F62B 3WINA 3VEQA 4D0TA 4IONA 4EEEB 4Q9PA 2K43A 3CQAA 4DENA 2J3PA 5GAQA 2RSTA 3FJDA 3V0BA 4KEIA 3BX1C 3R4UA 31BIA 3A23A 3WA1A 1FWVA 3RTJB 3BAVA 3R4SA 1FMMS 1S0EA 1WBCA 5G00A 1FV2A 3FJFA 3BA5A 3H6RA 1W3GA 1R8OA 1IJTA 3TC2A 5BP5A 1G9BA 1Z0HA 1SR4C 4P0JA 1PWAA 2KH2A 1NUNA 2GO2A 1TIEA 1AFCA 3HN1A 3CA3A 3AKFA 1S0DA 4Q9GA 1JTCA 1HKNA 4LO7B 1D0HA 1M16A 2D44A 3FJEA 3WMUA 2HZ9A 3IIRA 3ZXGA 4J2XA 4GAFA 3V0BB 4QD2B 2MC2A 4I7IA 3CA6A 3POKA 3NBEA 5F8SA 8I1BA 2Y9WC 3HMYA 4QO3A 5FZYA 3I2XA 5I1BA 2ZR1B 4IQPA 4LO2A 1FQ9A 3FUQA 3SNVA 1EYLA 1K5UA 3H6RB 1CE7B 3VSZA 2VUAA 3UD8A 3BAQA 3EF2A 4DCKC 3C9ZA 1S0BA 1FMZA 3QYDA 4I4RA 1DQOA 2NS2A 3ZXDA 2NM1A 2BEBA 3WO2A 3HALA 1JT4A 3AH4A 4LO0A 1KNMA 2ZQNA 3FJ9A 4X39A 2NP0A 2VXTI 2DRZA 3BAHA 1TWMA 1DJSB 4A7YA 3AJ6A 3FGMA 2KI4A 4EFQA 1IRPA 1OQLB 3CA0A 3Q7WA 4OUJA 3I29B 3NJ5A 1BFFA 2IWTB 4I1EA 3JRRA 4QALA 3ZX7A 1MC9A 2IHOA 3OJMA 3A21A 1DFQA 4IZEA 1HWPB 1Q03A 4TLPA 1S0CA 3OGFA 2D1ZA 2E4MC 4USOA 21BIA 2VLCA 2Q9XA 3KMVA 1ILR1 1IOBA 4I1BA 3NBCA 1PZZA 3P6IA 4J2YA 4KEJA 3IM6A 1IHKA 3O4CA 3I2AA 4F83A 5DVHA 2NYYA 4QBCA 3FJHA 3HOMA 3O3QA 4I4YA 1RMLA 5FNWA 3OBTA 2R9KB 1JLYA 2BEAA 3RSJA 3OGGA 3BA4A 1JT7A 2F2FC 4QBVA 4JP0A 4X37A 5BXPA 1ISXA 2Y9XE 4F34A 1DIWA 3BAOA 3AKIA 1EPWA 4ZOTA 3UD9A 3A07A 2KI6B 4J2KA 1F31A 1GGPB 1A8DA 2MLLB 2D20A 4GOYA 3FJJA 1RZOB 5FNXA 4IY8A 3VT1A 4LO1C 2D24A 1G9AA 2DREA 3Q7XA 3NBDA 5F8WA 1TWEA 5EC5A 3D7WB 4P0KA 3VWCA 1Z4SA 3N7KA 3H6QA 1T4QA 4G1RA 5F8YA 5BQUC 2ERMA 6I1BA 4X38A 4H75A 4XFUA 2K4AB 1CVSA 3CA5A 2NTDA 4I4UA 3CU1B 5E24E 3O49A 4I4SA 3RMYA 4L4IA 3BADA 3WINC 3MALA 4LO7C 4EFPA 3V0AA 4OEFA 1FV3A 1ABRB 1FGAA 4MZFB 1II4A 4QD2C 3MPPG 4OWLA 4ZGRB 3V79C 1DZDA 3JUTA 3F1RA 4H9WA 1BA7A 1AVAC 4KBBA 2XOAA 2D7RA 3ZC9A 5EG6C 1JY0A 3UJ4A 5D63A 3PMEA 4GOVA 2D7IA 3T8SA 5BP5C 3LTQA 1XG6A 1V6XA 1PC8B 4PC4A 1E0OA 4OW4A 2X2TA 3CA4A 3O44A 1PUUB 1BLDA 1V6WA 3UJ0A 3N7MA 1HCEA 1AVUA 3IAGC 3VT2A 3V0AB 4I4OA 5F90A 1HCDA 4II0A 1R8NA 3S8JA 1Q1UA 3FUOA 5B2HA 1RY7A 4G6JA 1W3FA 41BIA 3FJAA 4CJMA 4ZFYB 4LO2C 1BFGA 4OWJA 2D22A 4EFRA 3NBNA 4DEPA 2F8XC 1Q04A 2BFHA 3AJ5A 5JLVA 4LO3A 4MZHA 2UUSA 1K5VA 1AVXB 1G9CA 2RG9B 3N7LA 4UY4A 4GAIA 1MD6A 1PUMB 3ILAA 4ENDA 2DRYA 2WRYA 4G9MA 1YBIA 1HWMB 1S0GA 2K8RA 2Y9GA 4I4XA 4LO8B 2DS0A 4QKSA 4ISQA 5HPZA 1YF8B 4I6IA 5FZZA 2Q3NB
chains in the Genus database with same CATH topology
3OJVA 1L2HA 4A7ZA 2YUGA 2KLLA 3P53A 5D61A 4IY9A 1EV2A 3BTAA 4OEGA 1Z2VA 3E8LC 1XZZA 1T9FA 3HSMA 4FVVA 5DUYA 2NZ9A 1HWNB 1AF9A 4EKXB 1BFBA 3AZVA 1SZ6B 4G6MA 4LO1A 4HJJA 2WBCA 3A22A 3O4AA 1YXWA 3FFZA 3N0KA 2FDBM 1BASA 5BXTA 2MIBA 1HWOB 3CRIA 4ISRA 4ZFUB 1ISYA 1DFCA 2AAIB 1TFMB 2VSAA 2L5XA 3N7JA 4OEEA 1WD4A 1W3AA 1S0LA 4AN7B 4IHZA 4I8MA 2P39A 3UD7A 3H6SE 3VT0A 2FGFA 4JRAA 3O5WB 3LLPA 1SR4A 1TOOA 4P6AA 2AFGA 4H04A 1BARA 4D8HA 5BXSA 4QC4A 1VCLA 4G9NA 1V6VA 1RG8A 1JQZA 4P0LA 1HIBA 3PUBA 4HA2A 5BOWA 4ZLBB 3WO3A 2QYIB 4XFSA 4JKXB 4JPZA 3K1XA 5JMCA 4J23B 2ZQOA 1G82A 1XYFA 4X3AA 3BRGC 5BXRA 4Q91A 4R6UB 2FFUA 1WBAA 2AQZA 3BB2A 3OJ2A 4I96A 3AH1A 1IT0A 2KKIA 3AH2A 1DQGA 1WD3A 3FJCA 3RTIB 4XKIA 1BFCA 4FGFA 3FJ8A 7I1BA 2I1BA 4USPA 4YOLA 2X2SA 3S8KA 1TP0A 3O4BA 1V6UA 5D62A 1YTOA 3O4DA 3AKHA 1S0FA 4Z9WB 1DZCA 3WO4A 4IYBA 1ISZA 2HWMA 1UPSA 4L4HA 1ISVA 3AZWA 1BLAA 3AKGA 4IZXA 4ZBVB 3CRHA 4A7KA 1M2TB 2HW9A 3IM5A 4I0YA 1ITBA 4ZA3B 9ILBA 1QXMA 1XHBA 3CAHA 1FWUA 2D43A 1FN0A 2GZBA 1ONKB 2LIQA 4J2SA 2E4MA 4I4VA 3ZC8A 3IM7A 3FJBA 2Z48A 3BAGA 3QR5A 4D0ZA 2FO1A 2LIEA 1AXMA 2NVHA 2VU9A 4HR6C 4MZGB 3W9TA 2ESUA 1I1BA 2FFVA 3FJKA 3PHZA 4I4PA 3WMVA 4LO0C 4I3NA 4OWKA 4EB2B 4KC3A 1AVWB 4I4QA 3HBWA 3PG0A 2P23A 4GP0A 4I37A 4I2SA 1JT3A 2M49A 1J0SA 2F2FA 4LO3C 3RMXA 1TTUA 1G9DA 3B9UA 2AXMA 3CA1A 3BA7A 1I1EA 1QQLA 3VSFA 3BRDA 1DLLA 3O4OA 1YYNA 4Z8SB 1IRAX 5BVPI 1JT5A 1NZKA 2Z49A 2D23A 2Y9FA 4KEKA 4ZFWB 4AN6A 2VSEA 1QQKA 2QN4A 4WBCA 5FZUA 1ISWA 4JQ0A 3FJIA 4JAWA 2RQ9A 4XFTA 1N4KA 3UDAA 5BQUA 3BAUA 4QKRA 5EHAA 3CRGA 4GP3A 3OBRA 1IILA 2ET2A 2HWAA 3P6JA 5DSSB 3BRFA 4ZKTB 4JKQA 1EVTA 5DZUA 3VUOA 1JLXA 1P63A 2VXRA 3Q7YA 3F62B 3WINA 3VEQA 4D0TA 4IONA 4EEEB 4Q9PA 2K43A 3CQAA 4DENA 2J3PA 5GAQA 2RSTA 3FJDA 3V0BA 4KEIA 3BX1C 3R4UA 31BIA 3A23A 3WA1A 1FWVA 3RTJB 3BAVA 3R4SA 1FMMS 1S0EA 1WBCA 5G00A 1FV2A 3FJFA 3BA5A 3H6RA 1W3GA 1R8OA 1IJTA 3TC2A 5BP5A 1G9BA 1Z0HA 1SR4C 4P0JA 1PWAA 2KH2A 1NUNA 2GO2A 1TIEA 1AFCA 3HN1A 3CA3A 3AKFA 1S0DA 4Q9GA 1JTCA 1HKNA 4LO7B 1D0HA 1M16A 2D44A 3FJEA 3WMUA 2HZ9A 3IIRA 3ZXGA 4J2XA 4GAFA 3V0BB 4QD2B 2MC2A 4I7IA 3CA6A 3POKA 3NBEA 5F8SA 8I1BA 2Y9WC 3HMYA 4QO3A 5FZYA 3I2XA 5I1BA 2ZR1B 4IQPA 4LO2A 1FQ9A 3FUQA 3SNVA 1EYLA 1K5UA 3H6RB 1CE7B 3VSZA 2VUAA 3UD8A 3BAQA 3EF2A 4DCKC 3C9ZA 1S0BA 1FMZA 3QYDA 4I4RA 1DQOA 2NS2A 3ZXDA 2NM1A 2BEBA 3WO2A 3HALA 1JT4A 3AH4A 4LO0A 1KNMA 2ZQNA 3FJ9A 4X39A 2NP0A 2VXTI 2DRZA 3BAHA 1TWMA 1DJSB 4A7YA 3AJ6A 3FGMA 2KI4A 4EFQA 1IRPA 1OQLB 3CA0A 3Q7WA 4OUJA 3I29B 3NJ5A 1BFFA 2IWTB 4I1EA 3JRRA 4QALA 3ZX7A 1MC9A 2IHOA 3OJMA 3A21A 1DFQA 4IZEA 1HWPB 1Q03A 4TLPA 1S0CA 3OGFA 2D1ZA 2E4MC 4USOA 21BIA 2VLCA 2Q9XA 3KMVA 1ILR1 1IOBA 4I1BA 3NBCA 1PZZA 3P6IA 4J2YA 4KEJA 3IM6A 1IHKA 3O4CA 3I2AA 4F83A 5DVHA 2NYYA 4QBCA 3FJHA 3HOMA 3O3QA 4I4YA 1RMLA 5FNWA 3OBTA 2R9KB 1JLYA 2BEAA 3RSJA 3OGGA 3BA4A 1JT7A 2F2FC 4QBVA 4JP0A 4X37A 5BXPA 1ISXA 2Y9XE 4F34A 1DIWA 3BAOA 3AKIA 1EPWA 4ZOTA 3UD9A 3A07A 2KI6B 4J2KA 1F31A 1GGPB 1A8DA 2MLLB 2D20A 4GOYA 3FJJA 1RZOB 5FNXA 4IY8A 3VT1A 4LO1C 2D24A 1G9AA 2DREA 3Q7XA 3NBDA 5F8WA 1TWEA 5EC5A 3D7WB 4P0KA 3VWCA 1Z4SA 3N7KA 3H6QA 1T4QA 4G1RA 5F8YA 5BQUC 2ERMA 6I1BA 4X38A 4H75A 4XFUA 2K4AB 1CVSA 3CA5A 2NTDA 4I4UA 3CU1B 5E24E 3O49A 4I4SA 3RMYA 4L4IA 3BADA 3WINC 3MALA 4LO7C 4EFPA 3V0AA 4OEFA 1FV3A 1ABRB 1FGAA 4MZFB 1II4A 4QD2C 3MPPG 4OWLA 4ZGRB 3V79C 1DZDA 3JUTA 3F1RA 4H9WA 1BA7A 1AVAC 4KBBA 2XOAA 2D7RA 3ZC9A 5EG6C 1JY0A 3UJ4A 5D63A 3PMEA 4GOVA 2D7IA 3T8SA 5BP5C 3LTQA 1XG6A 1V6XA 1PC8B 4PC4A 1E0OA 4OW4A 2X2TA 3CA4A 3O44A 1PUUB 1BLDA 1V6WA 3UJ0A 3N7MA 1HCEA 1AVUA 3IAGC 3VT2A 3V0AB 4I4OA 5F90A 1HCDA 4II0A 1R8NA 3S8JA 1Q1UA 3FUOA 5B2HA 1RY7A 4G6JA 1W3FA 41BIA 3FJAA 4CJMA 4ZFYB 4LO2C 1BFGA 4OWJA 2D22A 4EFRA 3NBNA 4DEPA 2F8XC 1Q04A 2BFHA 3AJ5A 5JLVA 4LO3A 4MZHA 2UUSA 1K5VA 1AVXB 1G9CA 2RG9B 3N7LA 4UY4A 4GAIA 1MD6A 1PUMB 3ILAA 4ENDA 2DRYA 2WRYA 4G9MA 1YBIA 1HWMB 1S0GA 2K8RA 2Y9GA 4I4XA 4LO8B 2DS0A 4QKSA 4ISQA 5HPZA 1YF8B 4I6IA 5FZZA 2Q3NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJV A;  1L2H A;  4A7Z A;  2YUG A;  2KLL A;  3P53 A;  5D61 A;  4IY9 A;  1EV2 A;  3BTA A;  4OEG A;  1Z2V A;  3E8L C;  1XZZ A;  1T9F A;  3HSM A;  4FVV A;  5DUY A;  2NZ9 A;  1HWN B;  1AF9 A;  4EKX B;  1BFB A;  3AZV A;  1SZ6 B;  4G6M A;  4LO1 A;  4HJJ A;  2WBC A;  3A22 A;  3O4A A;  1YXW A;  3FFZ A;  3N0K A;  2FDB M;  1BAS A;  5BXT A;  2MIB A;  1HWO B;  3CRI A;  4ISR A;  4ZFU B;  1ISY A;  1DFC A;  2AAI B;  1TFM B;  2VSA A;  2L5X A;  3N7J A;  4OEE A;  1WD4 A;  1W3A A;  1S0L A;  4AN7 B;  4IHZ A;  4I8M A;  2P39 A;  3UD7 A;  3H6S E;  3VT0 A;  2FGF A;  4JRA A;  3O5W B;  3LLP A;  1SR4 A;  1TOO A;  4P6A A;  2AFG A;  4H04 A;  1BAR A;  4D8H A;  5BXS A;  4QC4 A;  1VCL A;  4G9N A;  1V6V A;  1RG8 A;  1JQZ A;  4P0L A;  1HIB A;  3PUB A;  4HA2 A;  5BOW A;  4ZLB B;  3WO3 A;  2QYI B;  4XFS A;  4JKX B;  4JPZ A;  3K1X A;  5JMC A;  4J23 B;  2ZQO A;  1G82 A;  1XYF A;  4X3A A;  3BRG C;  5BXR A;  4Q91 A;  4R6U B;  2FFU A;  1WBA A;  2AQZ A;  3BB2 A;  3OJ2 A;  4I96 A;  3AH1 A;  1IT0 A;  2KKI A;  3AH2 A;  1DQG A;  1WD3 A;  3FJC A;  3RTI B;  4XKI A;  1BFC A;  4FGF A;  3FJ8 A;  7I1B A;  2I1B A;  4USP A;  4YOL A;  2X2S A;  3S8K A;  1TP0 A;  3O4B A;  1V6U A;  5D62 A;  1YTO A;  3O4D A;  3AKH A;  1S0F A;  4Z9W B;  1DZC A;  3WO4 A;  4IYB A;  1ISZ A;  2HWM A;  1UPS A;  4L4H A;  1ISV A;  3AZW A;  1BLA A;  3AKG A;  4IZX A;  4ZBV B;  3CRH A;  4A7K A;  1M2T B;  2HW9 A;  3IM5 A;  4I0Y A;  1ITB A;  4ZA3 B;  9ILB A;  1QXM A;  1XHB A;  3CAH A;  1FWU A;  2D43 A;  1FN0 A;  2GZB A;  1ONK B;  2LIQ A;  4J2S A;  2E4M A;  4I4V A;  3ZC8 A;  3IM7 A;  3FJB A;  2Z48 A;  3BAG A;  3QR5 A;  4D0Z A;  2FO1 A;  2LIE A;  1AXM A;  2NVH A;  2VU9 A;  4HR6 C;  3W9T A;  2ESU A;  1I1B A;  2FFV A;  3FJK A;  3PHZ A;  4I4P A;  3WMV A;  4LO0 C;  4I3N A;  4OWK A;  4EB2 B;  4KC3 A;  1AVW B;  4I4Q A;  3HBW A;  3PG0 A;  2P23 A;  4GP0 A;  4I37 A;  4I2S A;  1JT3 A;  2M49 A;  1J0S A;  2F2F A;  4LO3 C;  3RMX A;  1TTU A;  1G9D A;  3B9U A;  2AXM A;  3CA1 A;  3BA7 A;  1I1E A;  1QQL A;  3VSF A;  3BRD A;  1DLL A;  3O4O A;  1YYN A;  4Z8S B;  1IRA X;  5BVP I;  1JT5 A;  1NZK A;  2Z49 A;  2D23 A;  2Y9F A;  4KEK A;  4ZFW B;  4AN6 A;  2VSE A;  1QQK A;  2QN4 A;  4WBC A;  5FZU A;  1ISW A;  4JQ0 A;  3FJI A;  4JAW A;  2RQ9 A;  4XFT A;  1N4K A;  3UDA A;  5BQU A;  3BAU A;  4QKR A;  5EHA A;  3CRG A;  4GP3 A;  3OBR A;  1IIL A;  2ET2 A;  2HWA A;  3P6J A;  5DSS B;  3BRF A;  4ZKT B;  4JKQ A;  1EVT A;  5DZU A;  3VUO A;  1JLX A;  1P63 A;  2VXR A;  3Q7Y A;  3F62 B;  3WIN A;  3VEQ A;  4D0T A;  4ION A;  4EEE B;  4Q9P A;  2K43 A;  3CQA A;  4DEN A;  2J3P A;  5GAQ A;  2RST A;  3FJD A;  3V0B A;  4KEI A;  3BX1 C;  3R4U A;  31BI A;  3A23 A;  3WA1 A;  1FWV A;  3RTJ B;  3BAV A;  3R4S A;  1FMM S;  1S0E A;  1WBC A;  5G00 A;  1FV2 A;  3FJF A;  3BA5 A;  3H6R A;  1W3G A;  1R8O A;  1IJT A;  3TC2 A;  5BP5 A;  1G9B A;  1Z0H A;  1SR4 C;  4P0J A;  1PWA A;  2KH2 A;  1NUN A;  2GO2 A;  1TIE A;  1AFC A;  3HN1 A;  3CA3 A;  3AKF A;  1S0D A;  4Q9G A;  1JTC A;  1HKN A;  4LO7 B;  1D0H A;  1M16 A;  2D44 A;  3FJE A;  3WMU A;  2HZ9 A;  3IIR A;  3ZXG A;  4J2X A;  4GAF A;  3V0B B;  4QD2 B;  2MC2 A;  4I7I A;  3CA6 A;  3POK A;  3NBE A;  5F8S A;  8I1B A;  2Y9W C;  3HMY A;  4QO3 A;  5FZY A;  3I2X A;  5I1B A;  2ZR1 B;  4IQP A;  4LO2 A;  1FQ9 A;  3FUQ A;  3SNV A;  1EYL A;  1K5U A;  3H6R B;  1CE7 B;  3VSZ A;  2VUA A;  3UD8 A;  3BAQ A;  3EF2 A;  4DCK C;  3C9Z A;  1S0B A;  1FMZ A;  3QYD A;  4I4R A;  1DQO A;  3ZXD A;  2NM1 A;  2BEB A;  3WO2 A;  3HAL A;  1JT4 A;  3AH4 A;  4LO0 A;  1KNM A;  2ZQN A;  3FJ9 A;  4X39 A;  2NP0 A;  2VXT I;  2DRZ A;  3BAH A;  1TWM A;  1DJS B;  4A7Y A;  3AJ6 A;  3FGM A;  2KI4 A;  4EFQ A;  1IRP A;  1OQL B;  3CA0 A;  3Q7W A;  4OUJ A;  3I29 B;  3NJ5 A;  1BFF A;  2IWT B;  4I1E A;  3JRR A;  4QAL A;  3ZX7 A;  1MC9 A;  2IHO A;  3OJM A;  3A21 A;  1DFQ A;  4IZE A;  1HWP B;  1Q03 A;  4TLP A;  1S0C A;  3OGF A;  2D1Z A;  2E4M C;  4USO A;  21BI A;  2VLC A;  2Q9X A;  3KMV A;  1ILR 1;  1IOB A;  4I1B A;  3NBC A;  1PZZ A;  3P6I A;  4J2Y A;  4KEJ A;  3IM6 A;  1IHK A;  3O4C A;  3I2A A;  4F83 A;  5DVH A;  2NYY A;  4QBC A;  3FJH A;  3HOM A;  3O3Q A;  4I4Y A;  1RML A;  5FNW A;  3OBT A;  2R9K B;  1JLY A;  2BEA A;  3RSJ A;  3OGG A;  3BA4 A;  1JT7 A;  2F2F C;  4QBV A;  4JP0 A;  4X37 A;  5BXP A;  1ISX A;  2Y9X E;  4F34 A;  1DIW A;  3BAO A;  3AKI A;  1EPW A;  4ZOT A;  3UD9 A;  3A07 A;  2KI6 B;  4J2K A;  1F31 A;  1GGP B;  1A8D A;  2MLL B;  2D20 A;  4GOY A;  3FJJ A;  1RZO B;  5FNX A;  4IY8 A;  3VT1 A;  4LO1 C;  2D24 A;  1G9A A;  2DRE A;  3Q7X A;  3NBD A;  5F8W A;  1TWE A;  5EC5 A;  3D7W B;  4P0K A;  3VWC A;  1Z4S A;  3N7K A;  3H6Q A;  1T4Q A;  4G1R A;  5F8Y A;  5BQU C;  2ERM A;  6I1B A;  4X38 A;  4XFU A;  2K4A B;  1CVS A;  3CA5 A;  2NTD A;  4I4U A;  3CU1 B;  5E24 E;  3O49 A;  4I4S A;  3RMY A;  4L4I A;  3BAD A;  3WIN C;  3MAL A;  4LO7 C;  4EFP A;  3V0A A;  4OEF A;  1FV3 A;  1ABR B;  1FGA A;  1II4 A;  4QD2 C;  3MPP G;  4OWL A;  4ZGR B;  3V79 C;  1DZD A;  3JUT A;  3F1R A;  4H9W A;  1BA7 A;  1AVA C;  4KBB A;  2XOA A;  2D7R A;  3ZC9 A;  5EG6 C;  1JY0 A;  3UJ4 A;  5D63 A;  3PME A;  4GOV A;  2D7I A;  3T8S A;  5BP5 C;  3LTQ A;  1XG6 A;  1V6X A;  1PC8 B;  4PC4 A;  1E0O A;  4OW4 A;  2X2T A;  3CA4 A;  3O44 A;  1PUU B;  1BLD A;  1V6W A;  3UJ0 A;  3N7M A;  1HCE A;  1AVU A;  3IAG C;  3VT2 A;  3V0A B;  4I4O A;  5F90 A;  1HCD A;  4II0 A;  1R8N A;  3S8J A;  1Q1U A;  3FUO A;  5B2H A;  1RY7 A;  4G6J A;  1W3F A;  41BI A;  3FJA A;  4CJM A;  4ZFY B;  4LO2 C;  1BFG A;  4OWJ A;  2D22 A;  4EFR A;  3NBN A;  4DEP A;  2F8X C;  1Q04 A;  2BFH A;  3AJ5 A;  5JLV A;  4LO3 A;  2UUS A;  1K5V A;  1AVX B;  1G9C A;  2RG9 B;  3N7L A;  4GAI A;  1MD6 A;  1PUM B;  3ILA A;  4END A;  2DRY A;  2WRY A;  4G9M A;  1YBI A;  1HWM B;  1S0G A;  2K8R A;  2Y9G A;  4I4X A;  4LO8 B;  2DS0 A;  4QKS A;  4ISQ A;  5HPZ A;  1YF8 B;  4I6I A;  5FZZ A;  2Q3N B; 
#chains in the Genus database with same CATH topology
 3OJV A;  1L2H A;  4A7Z A;  2YUG A;  2KLL A;  3P53 A;  5D61 A;  4IY9 A;  1EV2 A;  3BTA A;  4OEG A;  1Z2V A;  3E8L C;  1XZZ A;  1T9F A;  3HSM A;  4FVV A;  5DUY A;  2NZ9 A;  1HWN B;  1AF9 A;  4EKX B;  1BFB A;  3AZV A;  1SZ6 B;  4G6M A;  4LO1 A;  4HJJ A;  2WBC A;  3A22 A;  3O4A A;  1YXW A;  3FFZ A;  3N0K A;  2FDB M;  1BAS A;  5BXT A;  2MIB A;  1HWO B;  3CRI A;  4ISR A;  4ZFU B;  1ISY A;  1DFC A;  2AAI B;  1TFM B;  2VSA A;  2L5X A;  3N7J A;  4OEE A;  1WD4 A;  1W3A A;  1S0L A;  4AN7 B;  4IHZ A;  4I8M A;  2P39 A;  3UD7 A;  3H6S E;  3VT0 A;  2FGF A;  4JRA A;  3O5W B;  3LLP A;  1SR4 A;  1TOO A;  4P6A A;  2AFG A;  4H04 A;  1BAR A;  4D8H A;  5BXS A;  4QC4 A;  1VCL A;  4G9N A;  1V6V A;  1RG8 A;  1JQZ A;  4P0L A;  1HIB A;  3PUB A;  4HA2 A;  5BOW A;  4ZLB B;  3WO3 A;  2QYI B;  4XFS A;  4JKX B;  4JPZ A;  3K1X A;  5JMC A;  4J23 B;  2ZQO A;  1G82 A;  1XYF A;  4X3A A;  3BRG C;  5BXR A;  4Q91 A;  4R6U B;  2FFU A;  1WBA A;  2AQZ A;  3BB2 A;  3OJ2 A;  4I96 A;  3AH1 A;  1IT0 A;  2KKI A;  3AH2 A;  1DQG A;  1WD3 A;  3FJC A;  3RTI B;  4XKI A;  1BFC A;  4FGF A;  3FJ8 A;  7I1B A;  2I1B A;  4USP A;  4YOL A;  2X2S A;  3S8K A;  1TP0 A;  3O4B A;  1V6U A;  5D62 A;  1YTO A;  3O4D A;  3AKH A;  1S0F A;  4Z9W B;  1DZC A;  3WO4 A;  4IYB A;  1ISZ A;  2HWM A;  1UPS A;  4L4H A;  1ISV A;  3AZW A;  1BLA A;  3AKG A;  4IZX A;  4ZBV B;  3CRH A;  4A7K A;  1M2T B;  2HW9 A;  3IM5 A;  4I0Y A;  1ITB A;  4ZA3 B;  9ILB A;  1QXM A;  1XHB A;  3CAH A;  1FWU A;  2D43 A;  1FN0 A;  2GZB A;  1ONK B;  2LIQ A;  4J2S A;  2E4M A;  4I4V A;  3ZC8 A;  3IM7 A;  3FJB A;  2Z48 A;  3BAG A;  3QR5 A;  4D0Z A;  2FO1 A;  2LIE A;  1AXM A;  2NVH A;  2VU9 A;  4HR6 C;  4MZG B;  3W9T A;  2ESU A;  1I1B A;  2FFV A;  3FJK A;  3PHZ A;  4I4P A;  3WMV A;  4LO0 C;  4I3N A;  4OWK A;  4EB2 B;  4KC3 A;  1AVW B;  4I4Q A;  3HBW A;  3PG0 A;  2P23 A;  4GP0 A;  4I37 A;  4I2S A;  1JT3 A;  2M49 A;  1J0S A;  2F2F A;  4LO3 C;  3RMX A;  1TTU A;  1G9D A;  3B9U A;  2AXM A;  3CA1 A;  3BA7 A;  1I1E A;  1QQL A;  3VSF A;  3BRD A;  1DLL A;  3O4O A;  1YYN A;  4Z8S B;  1IRA X;  5BVP I;  1JT5 A;  1NZK A;  2Z49 A;  2D23 A;  2Y9F A;  4KEK A;  4ZFW B;  4AN6 A;  2VSE A;  1QQK A;  2QN4 A;  4WBC A;  5FZU A;  1ISW A;  4JQ0 A;  3FJI A;  4JAW A;  2RQ9 A;  4XFT A;  1N4K A;  3UDA A;  5BQU A;  3BAU A;  4QKR A;  5EHA A;  3CRG A;  4GP3 A;  3OBR A;  1IIL A;  2ET2 A;  2HWA A;  3P6J A;  5DSS B;  3BRF A;  4ZKT B;  4JKQ A;  1EVT A;  5DZU A;  3VUO A;  1JLX A;  1P63 A;  2VXR A;  3Q7Y A;  3F62 B;  3WIN A;  3VEQ A;  4D0T A;  4ION A;  4EEE B;  4Q9P A;  2K43 A;  3CQA A;  4DEN A;  2J3P A;  5GAQ A;  2RST A;  3FJD A;  3V0B A;  4KEI A;  3BX1 C;  3R4U A;  31BI A;  3A23 A;  3WA1 A;  1FWV A;  3RTJ B;  3BAV A;  3R4S A;  1FMM S;  1S0E A;  1WBC A;  5G00 A;  1FV2 A;  3FJF A;  3BA5 A;  3H6R A;  1W3G A;  1R8O A;  1IJT A;  3TC2 A;  5BP5 A;  1G9B A;  1Z0H A;  1SR4 C;  4P0J A;  1PWA A;  2KH2 A;  1NUN A;  2GO2 A;  1TIE A;  1AFC A;  3HN1 A;  3CA3 A;  3AKF A;  1S0D A;  4Q9G A;  1JTC A;  1HKN A;  4LO7 B;  1D0H A;  1M16 A;  2D44 A;  3FJE A;  3WMU A;  2HZ9 A;  3IIR A;  3ZXG A;  4J2X A;  4GAF A;  3V0B B;  4QD2 B;  2MC2 A;  4I7I A;  3CA6 A;  3POK A;  3NBE A;  5F8S A;  8I1B A;  2Y9W C;  3HMY A;  4QO3 A;  5FZY A;  3I2X A;  5I1B A;  2ZR1 B;  4IQP A;  4LO2 A;  1FQ9 A;  3FUQ A;  3SNV A;  1EYL A;  1K5U A;  3H6R B;  1CE7 B;  3VSZ A;  2VUA A;  3UD8 A;  3BAQ A;  3EF2 A;  4DCK C;  3C9Z A;  1S0B A;  1FMZ A;  3QYD A;  4I4R A;  1DQO A;  2NS2 A;  3ZXD A;  2NM1 A;  2BEB A;  3WO2 A;  3HAL A;  1JT4 A;  3AH4 A;  4LO0 A;  1KNM A;  2ZQN A;  3FJ9 A;  4X39 A;  2NP0 A;  2VXT I;  2DRZ A;  3BAH A;  1TWM A;  1DJS B;  4A7Y A;  3AJ6 A;  3FGM A;  2KI4 A;  4EFQ A;  1IRP A;  1OQL B;  3CA0 A;  3Q7W A;  4OUJ A;  3I29 B;  3NJ5 A;  1BFF A;  2IWT B;  4I1E A;  3JRR A;  4QAL A;  3ZX7 A;  1MC9 A;  2IHO A;  3OJM A;  3A21 A;  1DFQ A;  4IZE A;  1HWP B;  1Q03 A;  4TLP A;  1S0C A;  3OGF A;  2D1Z A;  2E4M C;  4USO A;  21BI A;  2VLC A;  2Q9X A;  3KMV A;  1ILR 1;  1IOB A;  4I1B A;  3NBC A;  1PZZ A;  3P6I A;  4J2Y A;  4KEJ A;  3IM6 A;  1IHK A;  3O4C A;  3I2A A;  4F83 A;  5DVH A;  2NYY A;  4QBC A;  3FJH A;  3HOM A;  3O3Q A;  4I4Y A;  1RML A;  5FNW A;  3OBT A;  2R9K B;  1JLY A;  2BEA A;  3RSJ A;  3OGG A;  3BA4 A;  1JT7 A;  2F2F C;  4QBV A;  4JP0 A;  4X37 A;  5BXP A;  1ISX A;  2Y9X E;  4F34 A;  1DIW A;  3BAO A;  3AKI A;  1EPW A;  4ZOT A;  3UD9 A;  3A07 A;  2KI6 B;  4J2K A;  1F31 A;  1GGP B;  1A8D A;  2MLL B;  2D20 A;  4GOY A;  3FJJ A;  1RZO B;  5FNX A;  4IY8 A;  3VT1 A;  4LO1 C;  2D24 A;  1G9A A;  2DRE A;  3Q7X A;  3NBD A;  5F8W A;  1TWE A;  5EC5 A;  3D7W B;  4P0K A;  3VWC A;  1Z4S A;  3N7K A;  3H6Q A;  1T4Q A;  4G1R A;  5F8Y A;  5BQU C;  2ERM A;  6I1B A;  4X38 A;  4H75 A;  4XFU A;  2K4A B;  1CVS A;  3CA5 A;  2NTD A;  4I4U A;  3CU1 B;  5E24 E;  3O49 A;  4I4S A;  3RMY A;  4L4I A;  3BAD A;  3WIN C;  3MAL A;  4LO7 C;  4EFP A;  3V0A A;  4OEF A;  1FV3 A;  1ABR B;  1FGA A;  4MZF B;  1II4 A;  4QD2 C;  3MPP G;  4OWL A;  4ZGR B;  3V79 C;  1DZD A;  3JUT A;  3F1R A;  4H9W A;  1BA7 A;  1AVA C;  4KBB A;  2XOA A;  2D7R A;  3ZC9 A;  5EG6 C;  1JY0 A;  3UJ4 A;  5D63 A;  3PME A;  4GOV A;  2D7I A;  3T8S A;  5BP5 C;  3LTQ A;  1XG6 A;  1V6X A;  1PC8 B;  4PC4 A;  1E0O A;  4OW4 A;  2X2T A;  3CA4 A;  3O44 A;  1PUU B;  1BLD A;  1V6W A;  3UJ0 A;  3N7M A;  1HCE A;  1AVU A;  3IAG C;  3VT2 A;  3V0A B;  4I4O A;  5F90 A;  1HCD A;  4II0 A;  1R8N A;  3S8J A;  1Q1U A;  3FUO A;  5B2H A;  1RY7 A;  4G6J A;  1W3F A;  41BI A;  3FJA A;  4CJM A;  4ZFY B;  4LO2 C;  1BFG A;  4OWJ A;  2D22 A;  4EFR A;  3NBN A;  4DEP A;  2F8X C;  1Q04 A;  2BFH A;  3AJ5 A;  5JLV A;  4LO3 A;  4MZH A;  2UUS A;  1K5V A;  1AVX B;  1G9C A;  2RG9 B;  3N7L A;  4UY4 A;  4GAI A;  1MD6 A;  1PUM B;  3ILA A;  4END A;  2DRY A;  2WRY A;  4G9M A;  1YBI A;  1HWM B;  1S0G A;  2K8R A;  2Y9G A;  4I4X A;  4LO8 B;  2DS0 A;  4QKS A;  4ISQ A;  5HPZ A;  1YF8 B;  4I6I A;  5FZZ A;  2Q3N B; 
#chains in the Genus database with same CATH homology
 3OJV A;  1L2H A;  4A7Z A;  2YUG A;  2KLL A;  3P53 A;  5D61 A;  4IY9 A;  1EV2 A;  3BTA A;  4OEG A;  1Z2V A;  3E8L C;  1XZZ A;  1T9F A;  3HSM A;  4FVV A;  5DUY A;  2NZ9 A;  1HWN B;  1AF9 A;  4EKX B;  1BFB A;  3AZV A;  1SZ6 B;  4G6M A;  4LO1 A;  4HJJ A;  2WBC A;  3A22 A;  3O4A A;  1YXW A;  3FFZ A;  3N0K A;  2FDB M;  1BAS A;  5BXT A;  2MIB A;  1HWO B;  3CRI A;  4ISR A;  4ZFU B;  1ISY A;  1DFC A;  2AAI B;  1TFM B;  2VSA A;  2L5X A;  3N7J A;  4OEE A;  1WD4 A;  1W3A A;  1S0L A;  4AN7 B;  4IHZ A;  4I8M A;  2P39 A;  3UD7 A;  3H6S E;  3VT0 A;  2FGF A;  4JRA A;  3O5W B;  3LLP A;  1SR4 A;  1TOO A;  4P6A A;  2AFG A;  4H04 A;  1BAR A;  4D8H A;  5BXS A;  4QC4 A;  1VCL A;  4G9N A;  1V6V A;  1RG8 A;  1JQZ A;  4P0L A;  1HIB A;  3PUB A;  4HA2 A;  5BOW A;  4ZLB B;  3WO3 A;  2QYI B;  4XFS A;  4JKX B;  4JPZ A;  3K1X A;  5JMC A;  4J23 B;  2ZQO A;  1G82 A;  1XYF A;  4X3A A;  3BRG C;  5BXR A;  4Q91 A;  4R6U B;  2FFU A;  1WBA A;  2AQZ A;  3BB2 A;  3OJ2 A;  4I96 A;  3AH1 A;  1IT0 A;  2KKI A;  3AH2 A;  1DQG A;  1WD3 A;  3FJC A;  3RTI B;  4XKI A;  1BFC A;  4FGF A;  3FJ8 A;  7I1B A;  2I1B A;  4USP A;  4YOL A;  2X2S A;  3S8K A;  1TP0 A;  3O4B A;  1V6U A;  5D62 A;  1YTO A;  3O4D A;  3AKH A;  1S0F A;  4Z9W B;  1DZC A;  3WO4 A;  4IYB A;  1ISZ A;  2HWM A;  1UPS A;  4L4H A;  1ISV A;  3AZW A;  1BLA A;  3AKG A;  4IZX A;  4ZBV B;  3CRH A;  4A7K A;  1M2T B;  2HW9 A;  3IM5 A;  4I0Y A;  1ITB A;  4ZA3 B;  9ILB A;  1QXM A;  1XHB A;  3CAH A;  1FWU A;  2D43 A;  1FN0 A;  2GZB A;  1ONK B;  2LIQ A;  4J2S A;  2E4M A;  4I4V A;  3ZC8 A;  3IM7 A;  3FJB A;  2Z48 A;  3BAG A;  3QR5 A;  4D0Z A;  2FO1 A;  2LIE A;  1AXM A;  2NVH A;  2VU9 A;  4HR6 C;  4MZG B;  3W9T A;  2ESU A;  1I1B A;  2FFV A;  3FJK A;  3PHZ A;  4I4P A;  3WMV A;  4LO0 C;  4I3N A;  4OWK A;  4EB2 B;  4KC3 A;  1AVW B;  4I4Q A;  3HBW A;  3PG0 A;  2P23 A;  4GP0 A;  4I37 A;  4I2S A;  1JT3 A;  2M49 A;  1J0S A;  2F2F A;  4LO3 C;  3RMX A;  1TTU A;  1G9D A;  3B9U A;  2AXM A;  3CA1 A;  3BA7 A;  1I1E A;  1QQL A;  3VSF A;  3BRD A;  1DLL A;  3O4O A;  1YYN A;  4Z8S B;  1IRA X;  5BVP I;  1JT5 A;  1NZK A;  2Z49 A;  2D23 A;  2Y9F A;  4KEK A;  4ZFW B;  4AN6 A;  2VSE A;  1QQK A;  2QN4 A;  4WBC A;  5FZU A;  1ISW A;  4JQ0 A;  3FJI A;  4JAW A;  2RQ9 A;  4XFT A;  1N4K A;  3UDA A;  5BQU A;  3BAU A;  4QKR A;  5EHA A;  3CRG A;  4GP3 A;  3OBR A;  1IIL A;  2ET2 A;  2HWA A;  3P6J A;  5DSS B;  3BRF A;  4ZKT B;  4JKQ A;  1EVT A;  5DZU A;  3VUO A;  1JLX A;  1P63 A;  2VXR A;  3Q7Y A;  3F62 B;  3WIN A;  3VEQ A;  4D0T A;  4ION A;  4EEE B;  4Q9P A;  2K43 A;  3CQA A;  4DEN A;  2J3P A;  5GAQ A;  2RST A;  3FJD A;  3V0B A;  4KEI A;  3BX1 C;  3R4U A;  31BI A;  3A23 A;  3WA1 A;  1FWV A;  3RTJ B;  3BAV A;  3R4S A;  1FMM S;  1S0E A;  1WBC A;  5G00 A;  1FV2 A;  3FJF A;  3BA5 A;  3H6R A;  1W3G A;  1R8O A;  1IJT A;  3TC2 A;  5BP5 A;  1G9B A;  1Z0H A;  1SR4 C;  4P0J A;  1PWA A;  2KH2 A;  1NUN A;  2GO2 A;  1TIE A;  1AFC A;  3HN1 A;  3CA3 A;  3AKF A;  1S0D A;  4Q9G A;  1JTC A;  1HKN A;  4LO7 B;  1D0H A;  1M16 A;  2D44 A;  3FJE A;  3WMU A;  2HZ9 A;  3IIR A;  3ZXG A;  4J2X A;  4GAF A;  3V0B B;  4QD2 B;  2MC2 A;  4I7I A;  3CA6 A;  3POK A;  3NBE A;  5F8S A;  8I1B A;  2Y9W C;  3HMY A;  4QO3 A;  5FZY A;  3I2X A;  5I1B A;  2ZR1 B;  4IQP A;  4LO2 A;  1FQ9 A;  3FUQ A;  3SNV A;  1EYL A;  1K5U A;  3H6R B;  1CE7 B;  3VSZ A;  2VUA A;  3UD8 A;  3BAQ A;  3EF2 A;  4DCK C;  3C9Z A;  1S0B A;  1FMZ A;  3QYD A;  4I4R A;  1DQO A;  2NS2 A;  3ZXD A;  2NM1 A;  2BEB A;  3WO2 A;  3HAL A;  1JT4 A;  3AH4 A;  4LO0 A;  1KNM A;  2ZQN A;  3FJ9 A;  4X39 A;  2NP0 A;  2VXT I;  2DRZ A;  3BAH A;  1TWM A;  1DJS B;  4A7Y A;  3AJ6 A;  3FGM A;  2KI4 A;  4EFQ A;  1IRP A;  1OQL B;  3CA0 A;  3Q7W A;  4OUJ A;  3I29 B;  3NJ5 A;  1BFF A;  2IWT B;  4I1E A;  3JRR A;  4QAL A;  3ZX7 A;  1MC9 A;  2IHO A;  3OJM A;  3A21 A;  1DFQ A;  4IZE A;  1HWP B;  1Q03 A;  4TLP A;  1S0C A;  3OGF A;  2D1Z A;  2E4M C;  4USO A;  21BI A;  2VLC A;  2Q9X A;  3KMV A;  1ILR 1;  1IOB A;  4I1B A;  3NBC A;  1PZZ A;  3P6I A;  4J2Y A;  4KEJ A;  3IM6 A;  1IHK A;  3O4C A;  3I2A A;  4F83 A;  5DVH A;  2NYY A;  4QBC A;  3FJH A;  3HOM A;  3O3Q A;  4I4Y A;  1RML A;  5FNW A;  3OBT A;  2R9K B;  1JLY A;  2BEA A;  3RSJ A;  3OGG A;  3BA4 A;  1JT7 A;  2F2F C;  4QBV A;  4JP0 A;  4X37 A;  5BXP A;  1ISX A;  2Y9X E;  4F34 A;  1DIW A;  3BAO A;  3AKI A;  1EPW A;  4ZOT A;  3UD9 A;  3A07 A;  2KI6 B;  4J2K A;  1F31 A;  1GGP B;  1A8D A;  2MLL B;  2D20 A;  4GOY A;  3FJJ A;  1RZO B;  5FNX A;  4IY8 A;  3VT1 A;  4LO1 C;  2D24 A;  1G9A A;  2DRE A;  3Q7X A;  3NBD A;  5F8W A;  1TWE A;  5EC5 A;  3D7W B;  4P0K A;  3VWC A;  1Z4S A;  3N7K A;  3H6Q A;  1T4Q A;  4G1R A;  5F8Y A;  5BQU C;  2ERM A;  6I1B A;  4X38 A;  4H75 A;  4XFU A;  2K4A B;  1CVS A;  3CA5 A;  2NTD A;  4I4U A;  3CU1 B;  5E24 E;  3O49 A;  4I4S A;  3RMY A;  4L4I A;  3BAD A;  3WIN C;  3MAL A;  4LO7 C;  4EFP A;  3V0A A;  4OEF A;  1FV3 A;  1ABR B;  1FGA A;  4MZF B;  1II4 A;  4QD2 C;  3MPP G;  4OWL A;  4ZGR B;  3V79 C;  1DZD A;  3JUT A;  3F1R A;  4H9W A;  1BA7 A;  1AVA C;  4KBB A;  2XOA A;  2D7R A;  3ZC9 A;  5EG6 C;  1JY0 A;  3UJ4 A;  5D63 A;  3PME A;  4GOV A;  2D7I A;  3T8S A;  5BP5 C;  3LTQ A;  1XG6 A;  1V6X A;  1PC8 B;  4PC4 A;  1E0O A;  4OW4 A;  2X2T A;  3CA4 A;  3O44 A;  1PUU B;  1BLD A;  1V6W A;  3UJ0 A;  3N7M A;  1HCE A;  1AVU A;  3IAG C;  3VT2 A;  3V0A B;  4I4O A;  5F90 A;  1HCD A;  4II0 A;  1R8N A;  3S8J A;  1Q1U A;  3FUO A;  5B2H A;  1RY7 A;  4G6J A;  1W3F A;  41BI A;  3FJA A;  4CJM A;  4ZFY B;  4LO2 C;  1BFG A;  4OWJ A;  2D22 A;  4EFR A;  3NBN A;  4DEP A;  2F8X C;  1Q04 A;  2BFH A;  3AJ5 A;  5JLV A;  4LO3 A;  4MZH A;  2UUS A;  1K5V A;  1AVX B;  1G9C A;  2RG9 B;  3N7L A;  4UY4 A;  4GAI A;  1MD6 A;  1PUM B;  3ILA A;  4END A;  2DRY A;  2WRY A;  4G9M A;  1YBI A;  1HWM B;  1S0G A;  2K8R A;  2Y9G A;  4I4X A;  4LO8 B;  2DS0 A;  4QKS A;  4ISQ A;  5HPZ A;  1YF8 B;  4I6I A;  5FZZ A;  2Q3N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...