2DRYA

Crystal structure of the earthworm lectin c-terminal domain mutant
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
PKFFYIKSELNGKVLDIGGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDNVLGVIKSDKGASAHICAWKQHGGPNQKFIIESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 29-kDa galactose-binding lectin
publication title Tailoring a novel sialic acid-binding lectin from a ricin-B chain-like galactose-binding protein by natural evolution-mimicry
pubmed doi rcsb
source organism Lumbricus terrestris
molecule tags Sugar binding protein
total genus 36
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2dryA00
3O5WB 1S0DA 1YXWA 1JT7A 1BASA 4F83A 5D61A 2NM1A 4LO1A 1ISZA 4DEPA 4I7IA 2R9KB 2F8XC 3CQAA 1HWNB 4ISRA 3HBWA 3O4OA 2KI4A 3N0KA 1BFCA 1PUMB 3WMVA 3A21A 3IAGC 2KI6B 1TWEA 3VEQA 3AKFA 3O4CA 3HN1A 3POKA 4JAWA 1FMZA 3H6RA 3HSMA 5BXRA 1DQOA 4QBCA 2LIQA 3PUBA 1KNMA 4GAIA 3H6QA 3IM7A 4ZA3B 7I1BA 2ERMA 4ZFUB 3ZXGA 31BIA 4AN6A 1EV2A 2QYIB 3QYDA 3AZVA 1NUNA 4LO8B 3OJMA 4IZXA 2QN4A 4JP0A 4KC3A 1S0EA 1R8OA 1EPWA 4LO3C 4FVVA 3WO3A 2Y9GA 1L2HA 1M2TB 3O49A 2ZR1B 1ISWA 3Q7XA 2E4MC 1S0BA 1XHBA 3A23A 3CRIA 3T8SA 2AQZA 2BFHA 4EFPA 1TWMA 8I1BA 2D20A 1FGAA 4USPA 1Q1UA 1W3AA 3RMXA 4D8HA 4I1BA 2I1BA 1G9DA 3UD8A 5BQUA 3F1RA 3F62B 4I4SA 2FFVA 1T9FA 4Z8SB 1JT5A 3TC2A 1ILR1 1JLXA 2J3PA 3AJ5A 3AKGA 1CVSA 1V6WA 3BADA 1ISYA 3FJKA 5BP5C 4ZFYB 3FJEA 3ZC9A 3FJCA 3CA4A 4I4PA 1PZZA 3AJ6A 1HIBA 5B2HA 1DJSB 3MPPG 1YBIA 3NBDA 3P6IA 4OW4A 3FJ9A 2ZQOA 4ISQA 3PMEA 1CE7B 4IQPA 4I6IA 2D44A 3V0AA 4I4QA 1QQLA 1D0HA 4QO3A 4EEEB 2HWMA 4JQ0A 1HCEA 1ONKB 3AZWA 4EFRA 3RMYA 1FV3A 1PWAA 1I1EA 3FUOA 1FQ9A 4OEGA 1IRPA 1RY7A 2HW9A 4I37A 2VUAA 4J2SA 1M16A 1SR4C 2AFGA 2NTDA 4ZKTB 1AVWB 2FFUA 2NYYA 2IHOA 3KMVA 4OWKA 3VSZA 3OJ2A 3WINC 2XOAA 2D43A 3V0BA 3Q7WA 5DZUA 3OGFA 1MD6A 4IYBA 1G9AA 5JLVA 1ABRB 3N7KA 4IY8A 4LO0A 4A7KA 1QXMA 1WD3A 4OWLA 4DCKC 1BFGA 3NBEA 3HALA 4GOVA 4PC4A 1RMLA 4D0TA 1K5UA 3R4SA 2Y9XE 4ZLBB 2Z49A 4EKXB 1HWOB 1Z0HA 3BAOA 1S0GA 2GZBA 3S8KA 4QKSA 3S8JA 1S0FA 2FDBM 4LO7C 5JMCA 4I0YA 1G9BA 1HCDA 1FWUA 1YYNA 5FNWA 3BAHA 3WO4A 4R6UB 2VSEA 4KEJA 5FZUA 3BRDA 5F90A 1W3GA 1SZ6B 3A22A 4I4RA 4GAFA 4LO1C 5D62A 3W9TA 2MIBA 1BFFA 2DRYA 4P0JA 1P63A 2RQ9A 2NP0A 5I1BA 4OEEA 1EVTA 2ET2A 1XZZA 5F8WA 2VXRA 3FJIA 3R4UA 3CA3A 3RTIB 3A07A 1A8DA 3FFZA 4HR6C 2ZQNA 4XFTA 1AF9A 1AXMA 4P0LA 4I3NA 1WD4A 1II4A 4L4HA 1I1BA 1JTCA 3UD9A 4L4IA 3FJ8A 4OWJA 4G6MA 1DFCA 3BA5A 2D1ZA 2VLCA 3UJ4A 4I4OA 4I2SA 2AAIB 3WO2A 5HPZA 3PHZA 1S0LA 3Q7YA 4QBVA 1QQKA 1JT3A 1BARA 4ZFWB 3EF2A 1NZKA 2Z48A 4DENA 1IILA 4XFSA 3BRFA 1S0CA 3PG0A 4I4UA 3FJBA 2BEAA 2FGFA 4ZOTA 4IY9A 3N7LA 3VT0A 3FGMA 3AH1A 4USOA 3VUOA 1Z2VA 3V79C 4P6AA 1TFMB 4LO2A 4XKIA 3H6SE 4J2YA 1DQGA 3BRGC 1IOBA 1FWVA 4ZGRB 1JT4A 3NJ5A 4J2KA 1JY0A 5BQUC 3BTAA 41BIA 3OBRA 5FNXA 5EHAA 2D7RA 3BA7A 1V6XA 1N4KA 2M49A 3VT1A 4KEIA 4X39A 2L5XA 3ZC8A 4P0KA 1YTOA 5FZZA 4EFQA 4D0ZA 1MC9A 5BOWA 3FJAA 2D7IA 4EB2B 3RTJB 2X2SA 3AKHA 1JLYA 1G82A 2F2FC 1IRAX 3IIRA 3JRRA 2X2TA 1HKNA 2ESUA 1BLAA 2D23A 2KLLA 1J0SA 4QC4A 3HOMA 4J2XA 5BVPI 2MC2A 1AVUA 5EG6C 3OJVA 4KBBA 4KEKA 5E24E 2K8RA 3LLPA 2FO1A 4CJMA 4HJJA 4JPZA 5BXSA 1Q04A 4GOYA 1RZOB 1OQLB 21BIA 4Q91A 5DSSB 3BB2A 2RG9B 3BAUA 4YOLA 9ILBA 2YUGA 4I1EA 4G6JA 3IM6A 4QALA 3FJDA 4A7ZA 1ITBA 4GP3A 4IHZA 3ZX7A 3HMYA 3BA4A 3FJHA 1UPSA 4LO7B 3UJ0A 4ENDA 1DZDA 4LO0C 4Z9WB 3I2XA 2IWTB 2D24A 4QD2C 1BA7A 4X3AA 4F34A 6I1BA 2P39A 1PUUB 4ZBVB 3K1XA 1DLLA 4I96A 2AXMA 1T4QA 2P23A 4Q9PA 3I2AA 2GO2A 3SNVA 3CRGA 3CA5A 2LIEA 1DFQA 3C9ZA 2VU9A 4JKXB 5G00A 3CRHA 1IJTA 1EYLA 3P6JA 3O3QA 4XFUA 4G9MA 3OGGA 1R8NA 5DVHA 3E8LC 3H6RB 5DUYA 4AN7B 1F31A 2BEBA 1TTUA 5D63A 2RSTA 1WBCA 3N7JA 1Q03A 3BAGA 4II0A 4LO3A 2KH2A 3AKIA 2Y9WC 3AH2A 3O4DA 4G1RA 1AVAC 3CA0A 1TIEA 1JQZA 1TP0A 3OBTA 1YF8B 2E4MA 3JUTA 4FGFA 4HA2A 2DREA 3AH4A 4OUJA 4IONA 1AVXB 3O4AA 3UDAA 1IT0A 1E0OA 1DZCA 3BAQA 3IM5A 2VSAA 4A7YA 2NVHA 4I8MA 1DIWA 2MLLB 1FV2A 5EC5A 5BP5A 2HWAA 1VCLA 4J23B 1V6UA 4GP0A 4I4YA 2WBCA 3I29B 3RSJA 3WMUA 5GAQA 1BFBA 2VXTI 1K5VA 3VSFA 3B9UA 3FJFA 1ISVA 3O4BA 3MALA 2DS0A 2KKIA 3FUQA 4LO2C 1G9CA 2NZ9A 4H04A 3LTQA 4I4VA 3BX1C 4H9WA 2Q9XA 1W3FA 4OEFA 4Q9GA 2F2FA 3BAVA 3CAHA 3N7MA 1SR4A 1WBAA 2WRYA 1FN0A 5BXTA 3WINA 3UD7A 3V0AB 3NBNA 1XG6A 1FMMS 1GGPB 2UUSA 3CA1A 3CA6A 4WBCA 5F8SA 2DRZA 5BXPA 5F8YA 1ISXA 2K4AB 2Q3NB 1XYFA 1HWMB 3NBCA 4JKQA 2Y9FA 2HZ9A 3FJJA 4JRAA 4G9NA 4X38A 3WA1A 1HWPB 1V6VA 3ILAA 4IZEA 3O44A 1PC8B 4QKRA 4TLPA 3V0BB 1BLDA 3D7WB 4X37A 1IHKA 3VT2A 3CU1B 1AFCA 3QR5A 5FZYA 3VWCA 1RG8A 2K43A 3P53A 2D22A 4I4XA 1TOOA 1Z4SA 4QD2B 3ZXDA
chains in the Genus database with same CATH superfamily
3O5WB 1S0DA 1YXWA 1JT7A 1BASA 4F83A 5D61A 2NM1A 4LO1A 1ISZA 4DEPA 4I7IA 2R9KB 2F8XC 3CQAA 1HWNB 4ISRA 4H75A 3HBWA 3O4OA 2KI4A 3N0KA 1BFCA 1PUMB 3WMVA 3A21A 3IAGC 2KI6B 1TWEA 3VEQA 3AKFA 3O4CA 3HN1A 3POKA 4JAWA 1FMZA 3H6RA 3HSMA 5BXRA 1DQOA 4QBCA 2LIQA 3PUBA 1KNMA 4GAIA 3H6QA 3IM7A 4ZA3B 7I1BA 2ERMA 4ZFUB 3ZXGA 31BIA 4AN6A 1EV2A 2QYIB 3QYDA 3AZVA 1NUNA 4LO8B 3OJMA 4IZXA 2QN4A 4JP0A 4MZGB 4KC3A 1S0EA 1R8OA 1EPWA 4LO3C 4FVVA 3WO3A 2Y9GA 1L2HA 1M2TB 3O49A 2ZR1B 1ISWA 3Q7XA 2E4MC 1S0BA 1XHBA 3A23A 3CRIA 3T8SA 2AQZA 2BFHA 4EFPA 1TWMA 8I1BA 2D20A 1FGAA 4USPA 1Q1UA 1W3AA 3RMXA 4D8HA 4I1BA 2I1BA 1G9DA 3UD8A 5BQUA 3F1RA 3F62B 4I4SA 2FFVA 1T9FA 4Z8SB 1JT5A 3TC2A 1ILR1 1JLXA 2J3PA 3AJ5A 3AKGA 1CVSA 1V6WA 3BADA 1ISYA 3FJKA 5BP5C 4ZFYB 3FJEA 3ZC9A 3FJCA 3CA4A 4I4PA 1PZZA 3AJ6A 1HIBA 5B2HA 1DJSB 3MPPG 1YBIA 3NBDA 3P6IA 4OW4A 3FJ9A 2ZQOA 4ISQA 3PMEA 1CE7B 4IQPA 4I6IA 2D44A 3V0AA 4I4QA 1QQLA 1D0HA 4QO3A 4EEEB 2HWMA 4JQ0A 1HCEA 1ONKB 3AZWA 4EFRA 3RMYA 1FV3A 1PWAA 1I1EA 3FUOA 1FQ9A 4OEGA 1IRPA 1RY7A 2HW9A 4I37A 2VUAA 4J2SA 1M16A 1SR4C 2AFGA 2NTDA 4ZKTB 1AVWB 2FFUA 2NYYA 2IHOA 3KMVA 4OWKA 3VSZA 3OJ2A 3WINC 2XOAA 2D43A 3V0BA 3Q7WA 5DZUA 3OGFA 1MD6A 4IYBA 1G9AA 5JLVA 1ABRB 3N7KA 4IY8A 4LO0A 4A7KA 1QXMA 1WD3A 4OWLA 4DCKC 1BFGA 3NBEA 3HALA 4GOVA 4PC4A 1RMLA 4D0TA 1K5UA 3R4SA 2Y9XE 4ZLBB 2Z49A 4EKXB 1HWOB 1Z0HA 3BAOA 1S0GA 2GZBA 3S8KA 4QKSA 3S8JA 1S0FA 2FDBM 4LO7C 5JMCA 4I0YA 1G9BA 1HCDA 1FWUA 1YYNA 5FNWA 3BAHA 3WO4A 4R6UB 2VSEA 4KEJA 5FZUA 3BRDA 5F90A 1W3GA 1SZ6B 3A22A 4I4RA 4GAFA 4LO1C 5D62A 3W9TA 2MIBA 1BFFA 2DRYA 4P0JA 1P63A 2RQ9A 2NP0A 5I1BA 4OEEA 1EVTA 2ET2A 1XZZA 5F8WA 2VXRA 3FJIA 2NS2A 3R4UA 3CA3A 3RTIB 3A07A 1A8DA 3FFZA 4HR6C 2ZQNA 4XFTA 1AF9A 1AXMA 4P0LA 4MZFB 4I3NA 1WD4A 1II4A 4L4HA 1I1BA 1JTCA 3UD9A 4L4IA 3FJ8A 4OWJA 4G6MA 1DFCA 3BA5A 2D1ZA 2VLCA 3UJ4A 4I4OA 4I2SA 2AAIB 3WO2A 5HPZA 3PHZA 1S0LA 3Q7YA 4QBVA 1QQKA 1JT3A 1BARA 4ZFWB 3EF2A 1NZKA 2Z48A 4DENA 1IILA 4XFSA 3BRFA 1S0CA 3PG0A 4I4UA 3FJBA 2BEAA 2FGFA 4ZOTA 4IY9A 3N7LA 3VT0A 3FGMA 3AH1A 4USOA 3VUOA 1Z2VA 3V79C 4P6AA 1TFMB 4LO2A 4XKIA 3H6SE 4J2YA 1DQGA 3BRGC 1IOBA 1FWVA 4ZGRB 1JT4A 3NJ5A 4J2KA 1JY0A 5BQUC 3BTAA 41BIA 3OBRA 5FNXA 5EHAA 2D7RA 3BA7A 1V6XA 4MZHA 1N4KA 2M49A 3VT1A 4KEIA 4X39A 2L5XA 3ZC8A 4P0KA 1YTOA 5FZZA 4EFQA 4D0ZA 1MC9A 5BOWA 3FJAA 2D7IA 4EB2B 3RTJB 2X2SA 3AKHA 1JLYA 1G82A 2F2FC 1IRAX 3IIRA 3JRRA 2X2TA 1HKNA 2ESUA 1BLAA 2D23A 2KLLA 1J0SA 4QC4A 3HOMA 4J2XA 5BVPI 2MC2A 1AVUA 5EG6C 3OJVA 4KBBA 4KEKA 5E24E 2K8RA 3LLPA 2FO1A 4CJMA 4HJJA 4JPZA 5BXSA 1Q04A 4GOYA 1RZOB 1OQLB 21BIA 4Q91A 5DSSB 3BB2A 2RG9B 3BAUA 4YOLA 9ILBA 2YUGA 4I1EA 4G6JA 3IM6A 4QALA 3FJDA 4A7ZA 1ITBA 4GP3A 4IHZA 3ZX7A 3HMYA 3BA4A 3FJHA 1UPSA 4LO7B 3UJ0A 4ENDA 1DZDA 4LO0C 4Z9WB 3I2XA 2IWTB 2D24A 4QD2C 1BA7A 4X3AA 4F34A 6I1BA 2P39A 1PUUB 4ZBVB 3K1XA 1DLLA 4I96A 2AXMA 1T4QA 2P23A 4Q9PA 4UY4A 3I2AA 2GO2A 3SNVA 3CRGA 3CA5A 2LIEA 1DFQA 3C9ZA 2VU9A 4JKXB 5G00A 3CRHA 1IJTA 1EYLA 3P6JA 3O3QA 4XFUA 4G9MA 3OGGA 1R8NA 5DVHA 3E8LC 3H6RB 5DUYA 4AN7B 1F31A 2BEBA 1TTUA 5D63A 2RSTA 1WBCA 3N7JA 1Q03A 3BAGA 4II0A 4LO3A 2KH2A 3AKIA 2Y9WC 3AH2A 3O4DA 4G1RA 1AVAC 3CA0A 1TIEA 1JQZA 1TP0A 3OBTA 1YF8B 2E4MA 3JUTA 4FGFA 4HA2A 2DREA 3AH4A 4OUJA 4IONA 1AVXB 3O4AA 3UDAA 1IT0A 1E0OA 1DZCA 3BAQA 3IM5A 2VSAA 4A7YA 2NVHA 4I8MA 1DIWA 2MLLB 1FV2A 5EC5A 5BP5A 2HWAA 1VCLA 4J23B 1V6UA 4GP0A 4I4YA 2WBCA 3I29B 3RSJA 3WMUA 5GAQA 1BFBA 2VXTI 1K5VA 3VSFA 3B9UA 3FJFA 1ISVA 3O4BA 3MALA 2DS0A 2KKIA 3FUQA 4LO2C 1G9CA 2NZ9A 4H04A 3LTQA 4I4VA 3BX1C 4H9WA 2Q9XA 1W3FA 4OEFA 4Q9GA 2F2FA 3BAVA 3CAHA 3N7MA 1SR4A 1WBAA 2WRYA 1FN0A 5BXTA 3WINA 3UD7A 3V0AB 3NBNA 1XG6A 1FMMS 1GGPB 2UUSA 3CA1A 3CA6A 4WBCA 5F8SA 2DRZA 5BXPA 5F8YA 1ISXA 2K4AB 2Q3NB 1XYFA 1HWMB 3NBCA 4JKQA 2Y9FA 2HZ9A 3FJJA 4JRAA 4G9NA 4X38A 3WA1A 1HWPB 1V6VA 3ILAA 4IZEA 3O44A 1PC8B 4QKRA 4TLPA 3V0BB 1BLDA 3D7WB 4X37A 1IHKA 3VT2A 3CU1B 1AFCA 3QR5A 5FZYA 3VWCA 1RG8A 2K43A 3P53A 2D22A 4I4XA 1TOOA 1Z4SA 4QD2B 3ZXDA
chains in the Genus database with same CATH topology
3O5WB 1S0DA 1YXWA 1JT7A 1BASA 4F83A 5D61A 2NM1A 4LO1A 1ISZA 4DEPA 4I7IA 2R9KB 2F8XC 3CQAA 1HWNB 4ISRA 4H75A 3HBWA 3O4OA 2KI4A 3N0KA 1BFCA 1PUMB 3WMVA 3A21A 3IAGC 2KI6B 1TWEA 3VEQA 3AKFA 3O4CA 3HN1A 3POKA 4JAWA 1FMZA 3H6RA 3HSMA 5BXRA 1DQOA 4QBCA 2LIQA 3PUBA 1KNMA 4GAIA 3H6QA 3IM7A 4ZA3B 7I1BA 2ERMA 4ZFUB 3ZXGA 31BIA 4AN6A 1EV2A 2QYIB 3QYDA 3AZVA 1NUNA 4LO8B 3OJMA 4IZXA 2QN4A 4JP0A 4MZGB 4KC3A 1S0EA 1R8OA 1EPWA 4LO3C 4FVVA 3WO3A 2Y9GA 1L2HA 1M2TB 3O49A 2ZR1B 1ISWA 3Q7XA 2E4MC 1S0BA 1XHBA 3A23A 3CRIA 3T8SA 2AQZA 2BFHA 4EFPA 1TWMA 8I1BA 2D20A 1FGAA 4USPA 1Q1UA 1W3AA 3RMXA 4D8HA 4I1BA 2I1BA 1G9DA 3UD8A 5BQUA 3F1RA 3F62B 4I4SA 2FFVA 1T9FA 4Z8SB 1JT5A 3TC2A 1ILR1 1JLXA 2J3PA 3AJ5A 3AKGA 1CVSA 1V6WA 3BADA 1ISYA 3FJKA 5BP5C 4ZFYB 3FJEA 3ZC9A 3FJCA 3CA4A 4I4PA 1PZZA 3AJ6A 1HIBA 5B2HA 1DJSB 3MPPG 1YBIA 3NBDA 3P6IA 4OW4A 3FJ9A 2ZQOA 4ISQA 3PMEA 1CE7B 4IQPA 4I6IA 2D44A 3V0AA 4I4QA 1QQLA 1D0HA 4QO3A 4EEEB 2HWMA 4JQ0A 1HCEA 1ONKB 3AZWA 4EFRA 3RMYA 1FV3A 1PWAA 1I1EA 3FUOA 1FQ9A 4OEGA 1IRPA 1RY7A 2HW9A 4I37A 2VUAA 4J2SA 1M16A 1SR4C 2AFGA 2NTDA 4ZKTB 1AVWB 2FFUA 2NYYA 2IHOA 3KMVA 4OWKA 3VSZA 3OJ2A 3WINC 2XOAA 2D43A 3V0BA 3Q7WA 5DZUA 3OGFA 1MD6A 4IYBA 1G9AA 5JLVA 1ABRB 3N7KA 4IY8A 4LO0A 4A7KA 1QXMA 1WD3A 4OWLA 4DCKC 1BFGA 3NBEA 3HALA 4GOVA 4PC4A 1RMLA 4D0TA 1K5UA 3R4SA 2Y9XE 4ZLBB 2Z49A 4EKXB 1HWOB 1Z0HA 3BAOA 1S0GA 2GZBA 3S8KA 4QKSA 3S8JA 1S0FA 2FDBM 4LO7C 5JMCA 4I0YA 1G9BA 1HCDA 1FWUA 1YYNA 5FNWA 3BAHA 3WO4A 4R6UB 2VSEA 4KEJA 5FZUA 3BRDA 5F90A 1W3GA 1SZ6B 3A22A 4I4RA 4GAFA 4LO1C 5D62A 3W9TA 2MIBA 1BFFA 2DRYA 4P0JA 1P63A 2RQ9A 2NP0A 5I1BA 4OEEA 1EVTA 2ET2A 1XZZA 5F8WA 2VXRA 3FJIA 2NS2A 3R4UA 3CA3A 3RTIB 3A07A 1A8DA 3FFZA 4HR6C 2ZQNA 4XFTA 1AF9A 1AXMA 4P0LA 4MZFB 4I3NA 1WD4A 1II4A 4L4HA 1I1BA 1JTCA 3UD9A 4L4IA 3FJ8A 4OWJA 4G6MA 1DFCA 3BA5A 2D1ZA 2VLCA 3UJ4A 4I4OA 4I2SA 2AAIB 3WO2A 5HPZA 3PHZA 1S0LA 3Q7YA 4QBVA 1QQKA 1JT3A 1BARA 4ZFWB 3EF2A 1NZKA 2Z48A 4DENA 1IILA 4XFSA 3BRFA 1S0CA 3PG0A 4I4UA 3FJBA 2BEAA 2FGFA 4ZOTA 4IY9A 3N7LA 3VT0A 3FGMA 3AH1A 4USOA 3VUOA 1Z2VA 3V79C 4P6AA 1TFMB 4LO2A 4XKIA 3H6SE 4J2YA 1DQGA 3BRGC 1IOBA 1FWVA 4ZGRB 1JT4A 3NJ5A 4J2KA 1JY0A 5BQUC 3BTAA 41BIA 3OBRA 5FNXA 5EHAA 2D7RA 3BA7A 1V6XA 4MZHA 1N4KA 2M49A 3VT1A 4KEIA 4X39A 2L5XA 3ZC8A 4P0KA 1YTOA 5FZZA 4EFQA 4D0ZA 1MC9A 5BOWA 3FJAA 2D7IA 4EB2B 3RTJB 2X2SA 3AKHA 1JLYA 1G82A 2F2FC 1IRAX 3IIRA 3JRRA 2X2TA 1HKNA 2ESUA 1BLAA 2D23A 2KLLA 1J0SA 4QC4A 3HOMA 4J2XA 5BVPI 2MC2A 1AVUA 5EG6C 3OJVA 4KBBA 4KEKA 5E24E 2K8RA 3LLPA 2FO1A 4CJMA 4HJJA 4JPZA 5BXSA 1Q04A 4GOYA 1RZOB 1OQLB 21BIA 4Q91A 5DSSB 3BB2A 2RG9B 3BAUA 4YOLA 9ILBA 2YUGA 4I1EA 4G6JA 3IM6A 4QALA 3FJDA 4A7ZA 1ITBA 4GP3A 4IHZA 3ZX7A 3HMYA 3BA4A 3FJHA 1UPSA 4LO7B 3UJ0A 4ENDA 1DZDA 4LO0C 4Z9WB 3I2XA 2IWTB 2D24A 4QD2C 1BA7A 4X3AA 4F34A 6I1BA 2P39A 1PUUB 4ZBVB 3K1XA 1DLLA 4I96A 2AXMA 1T4QA 2P23A 4Q9PA 4UY4A 3I2AA 2GO2A 3SNVA 3CRGA 3CA5A 2LIEA 1DFQA 3C9ZA 2VU9A 4JKXB 5G00A 3CRHA 1IJTA 1EYLA 3P6JA 3O3QA 4XFUA 4G9MA 3OGGA 1R8NA 5DVHA 3E8LC 3H6RB 5DUYA 4AN7B 1F31A 2BEBA 1TTUA 5D63A 2RSTA 1WBCA 3N7JA 1Q03A 3BAGA 4II0A 4LO3A 2KH2A 3AKIA 2Y9WC 3AH2A 3O4DA 4G1RA 1AVAC 3CA0A 1TIEA 1JQZA 1TP0A 3OBTA 1YF8B 2E4MA 3JUTA 4FGFA 4HA2A 2DREA 3AH4A 4OUJA 4IONA 1AVXB 3O4AA 3UDAA 1IT0A 1E0OA 1DZCA 3BAQA 3IM5A 2VSAA 4A7YA 2NVHA 4I8MA 1DIWA 2MLLB 1FV2A 5EC5A 5BP5A 2HWAA 1VCLA 4J23B 1V6UA 4GP0A 4I4YA 2WBCA 3I29B 3RSJA 3WMUA 5GAQA 1BFBA 2VXTI 1K5VA 3VSFA 3B9UA 3FJFA 1ISVA 3O4BA 3MALA 2DS0A 2KKIA 3FUQA 4LO2C 1G9CA 2NZ9A 4H04A 3LTQA 4I4VA 3BX1C 4H9WA 2Q9XA 1W3FA 4OEFA 4Q9GA 2F2FA 3BAVA 3CAHA 3N7MA 1SR4A 1WBAA 2WRYA 1FN0A 5BXTA 3WINA 3UD7A 3V0AB 3NBNA 1XG6A 1FMMS 1GGPB 2UUSA 3CA1A 3CA6A 4WBCA 5F8SA 2DRZA 5BXPA 5F8YA 1ISXA 2K4AB 2Q3NB 1XYFA 1HWMB 3NBCA 4JKQA 2Y9FA 2HZ9A 3FJJA 4JRAA 4G9NA 4X38A 3WA1A 1HWPB 1V6VA 3ILAA 4IZEA 3O44A 1PC8B 4QKRA 4TLPA 3V0BB 1BLDA 3D7WB 4X37A 1IHKA 3VT2A 3CU1B 1AFCA 3QR5A 5FZYA 3VWCA 1RG8A 2K43A 3P53A 2D22A 4I4XA 1TOOA 1Z4SA 4QD2B 3ZXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5W B;  1S0D A;  1YXW A;  1JT7 A;  1BAS A;  4F83 A;  5D61 A;  2NM1 A;  4LO1 A;  1ISZ A;  4DEP A;  4I7I A;  2R9K B;  2F8X C;  3CQA A;  1HWN B;  4ISR A;  3HBW A;  3O4O A;  2KI4 A;  3N0K A;  1BFC A;  1PUM B;  3WMV A;  3A21 A;  3IAG C;  2KI6 B;  1TWE A;  3VEQ A;  3AKF A;  3O4C A;  3HN1 A;  3POK A;  4JAW A;  1FMZ A;  3H6R A;  3HSM A;  5BXR A;  1DQO A;  4QBC A;  2LIQ A;  3PUB A;  1KNM A;  4GAI A;  3H6Q A;  3IM7 A;  4ZA3 B;  7I1B A;  2ERM A;  4ZFU B;  3ZXG A;  31BI A;  4AN6 A;  1EV2 A;  2QYI B;  3QYD A;  3AZV A;  1NUN A;  4LO8 B;  3OJM A;  4IZX A;  2QN4 A;  4JP0 A;  4KC3 A;  1S0E A;  1R8O A;  1EPW A;  4LO3 C;  4FVV A;  3WO3 A;  2Y9G A;  1L2H A;  1M2T B;  3O49 A;  2ZR1 B;  1ISW A;  3Q7X A;  2E4M C;  1S0B A;  1XHB A;  3A23 A;  3CRI A;  3T8S A;  2AQZ A;  2BFH A;  4EFP A;  1TWM A;  8I1B A;  2D20 A;  1FGA A;  4USP A;  1Q1U A;  1W3A A;  3RMX A;  4D8H A;  4I1B A;  2I1B A;  1G9D A;  3UD8 A;  5BQU A;  3F1R A;  3F62 B;  4I4S A;  2FFV A;  1T9F A;  4Z8S B;  1JT5 A;  3TC2 A;  1ILR 1;  1JLX A;  2J3P A;  3AJ5 A;  3AKG A;  1CVS A;  1V6W A;  3BAD A;  1ISY A;  3FJK A;  5BP5 C;  4ZFY B;  3FJE A;  3ZC9 A;  3FJC A;  3CA4 A;  4I4P A;  1PZZ A;  3AJ6 A;  1HIB A;  5B2H A;  1DJS B;  3MPP G;  1YBI A;  3NBD A;  3P6I A;  4OW4 A;  3FJ9 A;  2ZQO A;  4ISQ A;  3PME A;  1CE7 B;  4IQP A;  4I6I A;  2D44 A;  3V0A A;  4I4Q A;  1QQL A;  1D0H A;  4QO3 A;  4EEE B;  2HWM A;  4JQ0 A;  1HCE A;  1ONK B;  3AZW A;  4EFR A;  3RMY A;  1FV3 A;  1PWA A;  1I1E A;  3FUO A;  1FQ9 A;  4OEG A;  1IRP A;  1RY7 A;  2HW9 A;  4I37 A;  2VUA A;  4J2S A;  1M16 A;  1SR4 C;  2AFG A;  2NTD A;  4ZKT B;  1AVW B;  2FFU A;  2NYY A;  2IHO A;  3KMV A;  4OWK A;  3VSZ A;  3OJ2 A;  3WIN C;  2XOA A;  2D43 A;  3V0B A;  3Q7W A;  5DZU A;  3OGF A;  1MD6 A;  4IYB A;  1G9A A;  5JLV A;  1ABR B;  3N7K A;  4IY8 A;  4LO0 A;  4A7K A;  1QXM A;  1WD3 A;  4OWL A;  4DCK C;  1BFG A;  3NBE A;  3HAL A;  4GOV A;  4PC4 A;  1RML A;  4D0T A;  1K5U A;  3R4S A;  2Y9X E;  4ZLB B;  2Z49 A;  4EKX B;  1HWO B;  1Z0H A;  3BAO A;  1S0G A;  2GZB A;  3S8K A;  4QKS A;  3S8J A;  1S0F A;  2FDB M;  4LO7 C;  5JMC A;  4I0Y A;  1G9B A;  1HCD A;  1FWU A;  1YYN A;  5FNW A;  3BAH A;  3WO4 A;  4R6U B;  2VSE A;  4KEJ A;  5FZU A;  3BRD A;  5F90 A;  1W3G A;  1SZ6 B;  3A22 A;  4I4R A;  4GAF A;  4LO1 C;  5D62 A;  3W9T A;  2MIB A;  1BFF A;  2DRY A;  4P0J A;  1P63 A;  2RQ9 A;  2NP0 A;  5I1B A;  4OEE A;  1EVT A;  2ET2 A;  1XZZ A;  5F8W A;  2VXR A;  3FJI A;  3R4U A;  3CA3 A;  3RTI B;  3A07 A;  1A8D A;  3FFZ A;  4HR6 C;  2ZQN A;  4XFT A;  1AF9 A;  1AXM A;  4P0L A;  4I3N A;  1WD4 A;  1II4 A;  4L4H A;  1I1B A;  1JTC A;  3UD9 A;  4L4I A;  3FJ8 A;  4OWJ A;  4G6M A;  1DFC A;  3BA5 A;  2D1Z A;  2VLC A;  3UJ4 A;  4I4O A;  4I2S A;  2AAI B;  3WO2 A;  5HPZ A;  3PHZ A;  1S0L A;  3Q7Y A;  4QBV A;  1QQK A;  1JT3 A;  1BAR A;  4ZFW B;  3EF2 A;  1NZK A;  2Z48 A;  4DEN A;  1IIL A;  4XFS A;  3BRF A;  1S0C A;  3PG0 A;  4I4U A;  3FJB A;  2BEA A;  2FGF A;  4ZOT A;  4IY9 A;  3N7L A;  3VT0 A;  3FGM A;  3AH1 A;  4USO A;  3VUO A;  1Z2V A;  3V79 C;  4P6A A;  1TFM B;  4LO2 A;  4XKI A;  3H6S E;  4J2Y A;  1DQG A;  3BRG C;  1IOB A;  1FWV A;  4ZGR B;  1JT4 A;  3NJ5 A;  4J2K A;  1JY0 A;  5BQU C;  3BTA A;  41BI A;  3OBR A;  5FNX A;  5EHA A;  2D7R A;  3BA7 A;  1V6X A;  1N4K A;  2M49 A;  3VT1 A;  4KEI A;  4X39 A;  2L5X A;  3ZC8 A;  4P0K A;  1YTO A;  5FZZ A;  4EFQ A;  4D0Z A;  1MC9 A;  5BOW A;  3FJA A;  2D7I A;  4EB2 B;  3RTJ B;  2X2S A;  3AKH A;  1JLY A;  1G82 A;  2F2F C;  1IRA X;  3IIR A;  3JRR A;  2X2T A;  1HKN A;  2ESU A;  1BLA A;  2D23 A;  2KLL A;  1J0S A;  4QC4 A;  3HOM A;  4J2X A;  5BVP I;  2MC2 A;  1AVU A;  5EG6 C;  3OJV A;  4KBB A;  4KEK A;  5E24 E;  2K8R A;  3LLP A;  2FO1 A;  4CJM A;  4HJJ A;  4JPZ A;  5BXS A;  1Q04 A;  4GOY A;  1RZO B;  1OQL B;  21BI A;  4Q91 A;  5DSS B;  3BB2 A;  2RG9 B;  3BAU A;  4YOL A;  9ILB A;  2YUG A;  4I1E A;  4G6J A;  3IM6 A;  4QAL A;  3FJD A;  4A7Z A;  1ITB A;  4GP3 A;  4IHZ A;  3ZX7 A;  3HMY A;  3BA4 A;  3FJH A;  1UPS A;  4LO7 B;  3UJ0 A;  4END A;  1DZD A;  4LO0 C;  4Z9W B;  3I2X A;  2IWT B;  2D24 A;  4QD2 C;  1BA7 A;  4X3A A;  4F34 A;  6I1B A;  2P39 A;  1PUU B;  4ZBV B;  3K1X A;  1DLL A;  4I96 A;  2AXM A;  1T4Q A;  2P23 A;  4Q9P A;  3I2A A;  2GO2 A;  3SNV A;  3CRG A;  3CA5 A;  2LIE A;  1DFQ A;  3C9Z A;  2VU9 A;  4JKX B;  5G00 A;  3CRH A;  1IJT A;  1EYL A;  3P6J A;  3O3Q A;  4XFU A;  4G9M A;  3OGG A;  1R8N A;  5DVH A;  3E8L C;  3H6R B;  5DUY A;  4AN7 B;  1F31 A;  2BEB A;  1TTU A;  5D63 A;  2RST A;  1WBC A;  3N7J A;  1Q03 A;  3BAG A;  4II0 A;  4LO3 A;  2KH2 A;  3AKI A;  2Y9W C;  3AH2 A;  3O4D A;  4G1R A;  1AVA C;  3CA0 A;  1TIE A;  1JQZ A;  1TP0 A;  3OBT A;  1YF8 B;  2E4M A;  3JUT A;  4FGF A;  4HA2 A;  2DRE A;  3AH4 A;  4OUJ A;  4ION A;  1AVX B;  3O4A A;  3UDA A;  1IT0 A;  1E0O A;  1DZC A;  3BAQ A;  3IM5 A;  2VSA A;  4A7Y A;  2NVH A;  4I8M A;  1DIW A;  2MLL B;  1FV2 A;  5EC5 A;  5BP5 A;  2HWA A;  1VCL A;  4J23 B;  1V6U A;  4GP0 A;  4I4Y A;  2WBC A;  3I29 B;  3RSJ A;  3WMU A;  5GAQ A;  1BFB A;  2VXT I;  1K5V A;  3VSF A;  3B9U A;  3FJF A;  1ISV A;  3O4B A;  3MAL A;  2DS0 A;  2KKI A;  3FUQ A;  4LO2 C;  1G9C A;  2NZ9 A;  4H04 A;  3LTQ A;  4I4V A;  3BX1 C;  4H9W A;  2Q9X A;  1W3F A;  4OEF A;  4Q9G A;  2F2F A;  3BAV A;  3CAH A;  3N7M A;  1SR4 A;  1WBA A;  2WRY A;  1FN0 A;  5BXT A;  3WIN A;  3UD7 A;  3V0A B;  3NBN A;  1XG6 A;  1FMM S;  1GGP B;  2UUS A;  3CA1 A;  3CA6 A;  4WBC A;  5F8S A;  2DRZ A;  5BXP A;  5F8Y A;  1ISX A;  2K4A B;  2Q3N B;  1XYF A;  1HWM B;  3NBC A;  4JKQ A;  2Y9F A;  2HZ9 A;  3FJJ A;  4JRA A;  4G9N A;  4X38 A;  3WA1 A;  1HWP B;  1V6V A;  3ILA A;  4IZE A;  3O44 A;  1PC8 B;  4QKR A;  4TLP A;  3V0B B;  1BLD A;  3D7W B;  4X37 A;  1IHK A;  3VT2 A;  3CU1 B;  1AFC A;  3QR5 A;  5FZY A;  3VWC A;  1RG8 A;  2K43 A;  3P53 A;  2D22 A;  4I4X A;  1TOO A;  1Z4S A;  4QD2 B;  3ZXD A; 
#chains in the Genus database with same CATH topology
 3O5W B;  1S0D A;  1YXW A;  1JT7 A;  1BAS A;  4F83 A;  5D61 A;  2NM1 A;  4LO1 A;  1ISZ A;  4DEP A;  4I7I A;  2R9K B;  2F8X C;  3CQA A;  1HWN B;  4ISR A;  4H75 A;  3HBW A;  3O4O A;  2KI4 A;  3N0K A;  1BFC A;  1PUM B;  3WMV A;  3A21 A;  3IAG C;  2KI6 B;  1TWE A;  3VEQ A;  3AKF A;  3O4C A;  3HN1 A;  3POK A;  4JAW A;  1FMZ A;  3H6R A;  3HSM A;  5BXR A;  1DQO A;  4QBC A;  2LIQ A;  3PUB A;  1KNM A;  4GAI A;  3H6Q A;  3IM7 A;  4ZA3 B;  7I1B A;  2ERM A;  4ZFU B;  3ZXG A;  31BI A;  4AN6 A;  1EV2 A;  2QYI B;  3QYD A;  3AZV A;  1NUN A;  4LO8 B;  3OJM A;  4IZX A;  2QN4 A;  4JP0 A;  4MZG B;  4KC3 A;  1S0E A;  1R8O A;  1EPW A;  4LO3 C;  4FVV A;  3WO3 A;  2Y9G A;  1L2H A;  1M2T B;  3O49 A;  2ZR1 B;  1ISW A;  3Q7X A;  2E4M C;  1S0B A;  1XHB A;  3A23 A;  3CRI A;  3T8S A;  2AQZ A;  2BFH A;  4EFP A;  1TWM A;  8I1B A;  2D20 A;  1FGA A;  4USP A;  1Q1U A;  1W3A A;  3RMX A;  4D8H A;  4I1B A;  2I1B A;  1G9D A;  3UD8 A;  5BQU A;  3F1R A;  3F62 B;  4I4S A;  2FFV A;  1T9F A;  4Z8S B;  1JT5 A;  3TC2 A;  1ILR 1;  1JLX A;  2J3P A;  3AJ5 A;  3AKG A;  1CVS A;  1V6W A;  3BAD A;  1ISY A;  3FJK A;  5BP5 C;  4ZFY B;  3FJE A;  3ZC9 A;  3FJC A;  3CA4 A;  4I4P A;  1PZZ A;  3AJ6 A;  1HIB A;  5B2H A;  1DJS B;  3MPP G;  1YBI A;  3NBD A;  3P6I A;  4OW4 A;  3FJ9 A;  2ZQO A;  4ISQ A;  3PME A;  1CE7 B;  4IQP A;  4I6I A;  2D44 A;  3V0A A;  4I4Q A;  1QQL A;  1D0H A;  4QO3 A;  4EEE B;  2HWM A;  4JQ0 A;  1HCE A;  1ONK B;  3AZW A;  4EFR A;  3RMY A;  1FV3 A;  1PWA A;  1I1E A;  3FUO A;  1FQ9 A;  4OEG A;  1IRP A;  1RY7 A;  2HW9 A;  4I37 A;  2VUA A;  4J2S A;  1M16 A;  1SR4 C;  2AFG A;  2NTD A;  4ZKT B;  1AVW B;  2FFU A;  2NYY A;  2IHO A;  3KMV A;  4OWK A;  3VSZ A;  3OJ2 A;  3WIN C;  2XOA A;  2D43 A;  3V0B A;  3Q7W A;  5DZU A;  3OGF A;  1MD6 A;  4IYB A;  1G9A A;  5JLV A;  1ABR B;  3N7K A;  4IY8 A;  4LO0 A;  4A7K A;  1QXM A;  1WD3 A;  4OWL A;  4DCK C;  1BFG A;  3NBE A;  3HAL A;  4GOV A;  4PC4 A;  1RML A;  4D0T A;  1K5U A;  3R4S A;  2Y9X E;  4ZLB B;  2Z49 A;  4EKX B;  1HWO B;  1Z0H A;  3BAO A;  1S0G A;  2GZB A;  3S8K A;  4QKS A;  3S8J A;  1S0F A;  2FDB M;  4LO7 C;  5JMC A;  4I0Y A;  1G9B A;  1HCD A;  1FWU A;  1YYN A;  5FNW A;  3BAH A;  3WO4 A;  4R6U B;  2VSE A;  4KEJ A;  5FZU A;  3BRD A;  5F90 A;  1W3G A;  1SZ6 B;  3A22 A;  4I4R A;  4GAF A;  4LO1 C;  5D62 A;  3W9T A;  2MIB A;  1BFF A;  2DRY A;  4P0J A;  1P63 A;  2RQ9 A;  2NP0 A;  5I1B A;  4OEE A;  1EVT A;  2ET2 A;  1XZZ A;  5F8W A;  2VXR A;  3FJI A;  2NS2 A;  3R4U A;  3CA3 A;  3RTI B;  3A07 A;  1A8D A;  3FFZ A;  4HR6 C;  2ZQN A;  4XFT A;  1AF9 A;  1AXM A;  4P0L A;  4MZF B;  4I3N A;  1WD4 A;  1II4 A;  4L4H A;  1I1B A;  1JTC A;  3UD9 A;  4L4I A;  3FJ8 A;  4OWJ A;  4G6M A;  1DFC A;  3BA5 A;  2D1Z A;  2VLC A;  3UJ4 A;  4I4O A;  4I2S A;  2AAI B;  3WO2 A;  5HPZ A;  3PHZ A;  1S0L A;  3Q7Y A;  4QBV A;  1QQK A;  1JT3 A;  1BAR A;  4ZFW B;  3EF2 A;  1NZK A;  2Z48 A;  4DEN A;  1IIL A;  4XFS A;  3BRF A;  1S0C A;  3PG0 A;  4I4U A;  3FJB A;  2BEA A;  2FGF A;  4ZOT A;  4IY9 A;  3N7L A;  3VT0 A;  3FGM A;  3AH1 A;  4USO A;  3VUO A;  1Z2V A;  3V79 C;  4P6A A;  1TFM B;  4LO2 A;  4XKI A;  3H6S E;  4J2Y A;  1DQG A;  3BRG C;  1IOB A;  1FWV A;  4ZGR B;  1JT4 A;  3NJ5 A;  4J2K A;  1JY0 A;  5BQU C;  3BTA A;  41BI A;  3OBR A;  5FNX A;  5EHA A;  2D7R A;  3BA7 A;  1V6X A;  4MZH A;  1N4K A;  2M49 A;  3VT1 A;  4KEI A;  4X39 A;  2L5X A;  3ZC8 A;  4P0K A;  1YTO A;  5FZZ A;  4EFQ A;  4D0Z A;  1MC9 A;  5BOW A;  3FJA A;  2D7I A;  4EB2 B;  3RTJ B;  2X2S A;  3AKH A;  1JLY A;  1G82 A;  2F2F C;  1IRA X;  3IIR A;  3JRR A;  2X2T A;  1HKN A;  2ESU A;  1BLA A;  2D23 A;  2KLL A;  1J0S A;  4QC4 A;  3HOM A;  4J2X A;  5BVP I;  2MC2 A;  1AVU A;  5EG6 C;  3OJV A;  4KBB A;  4KEK A;  5E24 E;  2K8R A;  3LLP A;  2FO1 A;  4CJM A;  4HJJ A;  4JPZ A;  5BXS A;  1Q04 A;  4GOY A;  1RZO B;  1OQL B;  21BI A;  4Q91 A;  5DSS B;  3BB2 A;  2RG9 B;  3BAU A;  4YOL A;  9ILB A;  2YUG A;  4I1E A;  4G6J A;  3IM6 A;  4QAL A;  3FJD A;  4A7Z A;  1ITB A;  4GP3 A;  4IHZ A;  3ZX7 A;  3HMY A;  3BA4 A;  3FJH A;  1UPS A;  4LO7 B;  3UJ0 A;  4END A;  1DZD A;  4LO0 C;  4Z9W B;  3I2X A;  2IWT B;  2D24 A;  4QD2 C;  1BA7 A;  4X3A A;  4F34 A;  6I1B A;  2P39 A;  1PUU B;  4ZBV B;  3K1X A;  1DLL A;  4I96 A;  2AXM A;  1T4Q A;  2P23 A;  4Q9P A;  4UY4 A;  3I2A A;  2GO2 A;  3SNV A;  3CRG A;  3CA5 A;  2LIE A;  1DFQ A;  3C9Z A;  2VU9 A;  4JKX B;  5G00 A;  3CRH A;  1IJT A;  1EYL A;  3P6J A;  3O3Q A;  4XFU A;  4G9M A;  3OGG A;  1R8N A;  5DVH A;  3E8L C;  3H6R B;  5DUY A;  4AN7 B;  1F31 A;  2BEB A;  1TTU A;  5D63 A;  2RST A;  1WBC A;  3N7J A;  1Q03 A;  3BAG A;  4II0 A;  4LO3 A;  2KH2 A;  3AKI A;  2Y9W C;  3AH2 A;  3O4D A;  4G1R A;  1AVA C;  3CA0 A;  1TIE A;  1JQZ A;  1TP0 A;  3OBT A;  1YF8 B;  2E4M A;  3JUT A;  4FGF A;  4HA2 A;  2DRE A;  3AH4 A;  4OUJ A;  4ION A;  1AVX B;  3O4A A;  3UDA A;  1IT0 A;  1E0O A;  1DZC A;  3BAQ A;  3IM5 A;  2VSA A;  4A7Y A;  2NVH A;  4I8M A;  1DIW A;  2MLL B;  1FV2 A;  5EC5 A;  5BP5 A;  2HWA A;  1VCL A;  4J23 B;  1V6U A;  4GP0 A;  4I4Y A;  2WBC A;  3I29 B;  3RSJ A;  3WMU A;  5GAQ A;  1BFB A;  2VXT I;  1K5V A;  3VSF A;  3B9U A;  3FJF A;  1ISV A;  3O4B A;  3MAL A;  2DS0 A;  2KKI A;  3FUQ A;  4LO2 C;  1G9C A;  2NZ9 A;  4H04 A;  3LTQ A;  4I4V A;  3BX1 C;  4H9W A;  2Q9X A;  1W3F A;  4OEF A;  4Q9G A;  2F2F A;  3BAV A;  3CAH A;  3N7M A;  1SR4 A;  1WBA A;  2WRY A;  1FN0 A;  5BXT A;  3WIN A;  3UD7 A;  3V0A B;  3NBN A;  1XG6 A;  1FMM S;  1GGP B;  2UUS A;  3CA1 A;  3CA6 A;  4WBC A;  5F8S A;  2DRZ A;  5BXP A;  5F8Y A;  1ISX A;  2K4A B;  2Q3N B;  1XYF A;  1HWM B;  3NBC A;  4JKQ A;  2Y9F A;  2HZ9 A;  3FJJ A;  4JRA A;  4G9N A;  4X38 A;  3WA1 A;  1HWP B;  1V6V A;  3ILA A;  4IZE A;  3O44 A;  1PC8 B;  4QKR A;  4TLP A;  3V0B B;  1BLD A;  3D7W B;  4X37 A;  1IHK A;  3VT2 A;  3CU1 B;  1AFC A;  3QR5 A;  5FZY A;  3VWC A;  1RG8 A;  2K43 A;  3P53 A;  2D22 A;  4I4X A;  1TOO A;  1Z4S A;  4QD2 B;  3ZXD A; 
#chains in the Genus database with same CATH homology
 3O5W B;  1S0D A;  1YXW A;  1JT7 A;  1BAS A;  4F83 A;  5D61 A;  2NM1 A;  4LO1 A;  1ISZ A;  4DEP A;  4I7I A;  2R9K B;  2F8X C;  3CQA A;  1HWN B;  4ISR A;  4H75 A;  3HBW A;  3O4O A;  2KI4 A;  3N0K A;  1BFC A;  1PUM B;  3WMV A;  3A21 A;  3IAG C;  2KI6 B;  1TWE A;  3VEQ A;  3AKF A;  3O4C A;  3HN1 A;  3POK A;  4JAW A;  1FMZ A;  3H6R A;  3HSM A;  5BXR A;  1DQO A;  4QBC A;  2LIQ A;  3PUB A;  1KNM A;  4GAI A;  3H6Q A;  3IM7 A;  4ZA3 B;  7I1B A;  2ERM A;  4ZFU B;  3ZXG A;  31BI A;  4AN6 A;  1EV2 A;  2QYI B;  3QYD A;  3AZV A;  1NUN A;  4LO8 B;  3OJM A;  4IZX A;  2QN4 A;  4JP0 A;  4MZG B;  4KC3 A;  1S0E A;  1R8O A;  1EPW A;  4LO3 C;  4FVV A;  3WO3 A;  2Y9G A;  1L2H A;  1M2T B;  3O49 A;  2ZR1 B;  1ISW A;  3Q7X A;  2E4M C;  1S0B A;  1XHB A;  3A23 A;  3CRI A;  3T8S A;  2AQZ A;  2BFH A;  4EFP A;  1TWM A;  8I1B A;  2D20 A;  1FGA A;  4USP A;  1Q1U A;  1W3A A;  3RMX A;  4D8H A;  4I1B A;  2I1B A;  1G9D A;  3UD8 A;  5BQU A;  3F1R A;  3F62 B;  4I4S A;  2FFV A;  1T9F A;  4Z8S B;  1JT5 A;  3TC2 A;  1ILR 1;  1JLX A;  2J3P A;  3AJ5 A;  3AKG A;  1CVS A;  1V6W A;  3BAD A;  1ISY A;  3FJK A;  5BP5 C;  4ZFY B;  3FJE A;  3ZC9 A;  3FJC A;  3CA4 A;  4I4P A;  1PZZ A;  3AJ6 A;  1HIB A;  5B2H A;  1DJS B;  3MPP G;  1YBI A;  3NBD A;  3P6I A;  4OW4 A;  3FJ9 A;  2ZQO A;  4ISQ A;  3PME A;  1CE7 B;  4IQP A;  4I6I A;  2D44 A;  3V0A A;  4I4Q A;  1QQL A;  1D0H A;  4QO3 A;  4EEE B;  2HWM A;  4JQ0 A;  1HCE A;  1ONK B;  3AZW A;  4EFR A;  3RMY A;  1FV3 A;  1PWA A;  1I1E A;  3FUO A;  1FQ9 A;  4OEG A;  1IRP A;  1RY7 A;  2HW9 A;  4I37 A;  2VUA A;  4J2S A;  1M16 A;  1SR4 C;  2AFG A;  2NTD A;  4ZKT B;  1AVW B;  2FFU A;  2NYY A;  2IHO A;  3KMV A;  4OWK A;  3VSZ A;  3OJ2 A;  3WIN C;  2XOA A;  2D43 A;  3V0B A;  3Q7W A;  5DZU A;  3OGF A;  1MD6 A;  4IYB A;  1G9A A;  5JLV A;  1ABR B;  3N7K A;  4IY8 A;  4LO0 A;  4A7K A;  1QXM A;  1WD3 A;  4OWL A;  4DCK C;  1BFG A;  3NBE A;  3HAL A;  4GOV A;  4PC4 A;  1RML A;  4D0T A;  1K5U A;  3R4S A;  2Y9X E;  4ZLB B;  2Z49 A;  4EKX B;  1HWO B;  1Z0H A;  3BAO A;  1S0G A;  2GZB A;  3S8K A;  4QKS A;  3S8J A;  1S0F A;  2FDB M;  4LO7 C;  5JMC A;  4I0Y A;  1G9B A;  1HCD A;  1FWU A;  1YYN A;  5FNW A;  3BAH A;  3WO4 A;  4R6U B;  2VSE A;  4KEJ A;  5FZU A;  3BRD A;  5F90 A;  1W3G A;  1SZ6 B;  3A22 A;  4I4R A;  4GAF A;  4LO1 C;  5D62 A;  3W9T A;  2MIB A;  1BFF A;  2DRY A;  4P0J A;  1P63 A;  2RQ9 A;  2NP0 A;  5I1B A;  4OEE A;  1EVT A;  2ET2 A;  1XZZ A;  5F8W A;  2VXR A;  3FJI A;  2NS2 A;  3R4U A;  3CA3 A;  3RTI B;  3A07 A;  1A8D A;  3FFZ A;  4HR6 C;  2ZQN A;  4XFT A;  1AF9 A;  1AXM A;  4P0L A;  4MZF B;  4I3N A;  1WD4 A;  1II4 A;  4L4H A;  1I1B A;  1JTC A;  3UD9 A;  4L4I A;  3FJ8 A;  4OWJ A;  4G6M A;  1DFC A;  3BA5 A;  2D1Z A;  2VLC A;  3UJ4 A;  4I4O A;  4I2S A;  2AAI B;  3WO2 A;  5HPZ A;  3PHZ A;  1S0L A;  3Q7Y A;  4QBV A;  1QQK A;  1JT3 A;  1BAR A;  4ZFW B;  3EF2 A;  1NZK A;  2Z48 A;  4DEN A;  1IIL A;  4XFS A;  3BRF A;  1S0C A;  3PG0 A;  4I4U A;  3FJB A;  2BEA A;  2FGF A;  4ZOT A;  4IY9 A;  3N7L A;  3VT0 A;  3FGM A;  3AH1 A;  4USO A;  3VUO A;  1Z2V A;  3V79 C;  4P6A A;  1TFM B;  4LO2 A;  4XKI A;  3H6S E;  4J2Y A;  1DQG A;  3BRG C;  1IOB A;  1FWV A;  4ZGR B;  1JT4 A;  3NJ5 A;  4J2K A;  1JY0 A;  5BQU C;  3BTA A;  41BI A;  3OBR A;  5FNX A;  5EHA A;  2D7R A;  3BA7 A;  1V6X A;  4MZH A;  1N4K A;  2M49 A;  3VT1 A;  4KEI A;  4X39 A;  2L5X A;  3ZC8 A;  4P0K A;  1YTO A;  5FZZ A;  4EFQ A;  4D0Z A;  1MC9 A;  5BOW A;  3FJA A;  2D7I A;  4EB2 B;  3RTJ B;  2X2S A;  3AKH A;  1JLY A;  1G82 A;  2F2F C;  1IRA X;  3IIR A;  3JRR A;  2X2T A;  1HKN A;  2ESU A;  1BLA A;  2D23 A;  2KLL A;  1J0S A;  4QC4 A;  3HOM A;  4J2X A;  5BVP I;  2MC2 A;  1AVU A;  5EG6 C;  3OJV A;  4KBB A;  4KEK A;  5E24 E;  2K8R A;  3LLP A;  2FO1 A;  4CJM A;  4HJJ A;  4JPZ A;  5BXS A;  1Q04 A;  4GOY A;  1RZO B;  1OQL B;  21BI A;  4Q91 A;  5DSS B;  3BB2 A;  2RG9 B;  3BAU A;  4YOL A;  9ILB A;  2YUG A;  4I1E A;  4G6J A;  3IM6 A;  4QAL A;  3FJD A;  4A7Z A;  1ITB A;  4GP3 A;  4IHZ A;  3ZX7 A;  3HMY A;  3BA4 A;  3FJH A;  1UPS A;  4LO7 B;  3UJ0 A;  4END A;  1DZD A;  4LO0 C;  4Z9W B;  3I2X A;  2IWT B;  2D24 A;  4QD2 C;  1BA7 A;  4X3A A;  4F34 A;  6I1B A;  2P39 A;  1PUU B;  4ZBV B;  3K1X A;  1DLL A;  4I96 A;  2AXM A;  1T4Q A;  2P23 A;  4Q9P A;  4UY4 A;  3I2A A;  2GO2 A;  3SNV A;  3CRG A;  3CA5 A;  2LIE A;  1DFQ A;  3C9Z A;  2VU9 A;  4JKX B;  5G00 A;  3CRH A;  1IJT A;  1EYL A;  3P6J A;  3O3Q A;  4XFU A;  4G9M A;  3OGG A;  1R8N A;  5DVH A;  3E8L C;  3H6R B;  5DUY A;  4AN7 B;  1F31 A;  2BEB A;  1TTU A;  5D63 A;  2RST A;  1WBC A;  3N7J A;  1Q03 A;  3BAG A;  4II0 A;  4LO3 A;  2KH2 A;  3AKI A;  2Y9W C;  3AH2 A;  3O4D A;  4G1R A;  1AVA C;  3CA0 A;  1TIE A;  1JQZ A;  1TP0 A;  3OBT A;  1YF8 B;  2E4M A;  3JUT A;  4FGF A;  4HA2 A;  2DRE A;  3AH4 A;  4OUJ A;  4ION A;  1AVX B;  3O4A A;  3UDA A;  1IT0 A;  1E0O A;  1DZC A;  3BAQ A;  3IM5 A;  2VSA A;  4A7Y A;  2NVH A;  4I8M A;  1DIW A;  2MLL B;  1FV2 A;  5EC5 A;  5BP5 A;  2HWA A;  1VCL A;  4J23 B;  1V6U A;  4GP0 A;  4I4Y A;  2WBC A;  3I29 B;  3RSJ A;  3WMU A;  5GAQ A;  1BFB A;  2VXT I;  1K5V A;  3VSF A;  3B9U A;  3FJF A;  1ISV A;  3O4B A;  3MAL A;  2DS0 A;  2KKI A;  3FUQ A;  4LO2 C;  1G9C A;  2NZ9 A;  4H04 A;  3LTQ A;  4I4V A;  3BX1 C;  4H9W A;  2Q9X A;  1W3F A;  4OEF A;  4Q9G A;  2F2F A;  3BAV A;  3CAH A;  3N7M A;  1SR4 A;  1WBA A;  2WRY A;  1FN0 A;  5BXT A;  3WIN A;  3UD7 A;  3V0A B;  3NBN A;  1XG6 A;  1FMM S;  1GGP B;  2UUS A;  3CA1 A;  3CA6 A;  4WBC A;  5F8S A;  2DRZ A;  5BXP A;  5F8Y A;  1ISX A;  2K4A B;  2Q3N B;  1XYF A;  1HWM B;  3NBC A;  4JKQ A;  2Y9F A;  2HZ9 A;  3FJJ A;  4JRA A;  4G9N A;  4X38 A;  3WA1 A;  1HWP B;  1V6V A;  3ILA A;  4IZE A;  3O44 A;  1PC8 B;  4QKR A;  4TLP A;  3V0B B;  1BLD A;  3D7W B;  4X37 A;  1IHK A;  3VT2 A;  3CU1 B;  1AFC A;  3QR5 A;  5FZY A;  3VWC A;  1RG8 A;  2K43 A;  3P53 A;  2D22 A;  4I4X A;  1TOO A;  1Z4S A;  4QD2 B;  3ZXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...