4LO0A

Apo ha17-ha33
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
286
structure length
286
Chain Sequence
NSLNDKIVTISCKADTNLFFYQVAGNVSLFQQTRNYLERWRLIYDSNKAAYKIKSMDIHNTNLVLTWNAPTHNISTQQDSNADNQYWLLLKDIGNNSFIIASYKNPNLVLYADTVARNLKLSTLNNSNYIKFIIEDYIISDLNNFTCKISPILDLNKVVQQVDVTNLNVNLYTWDYGRNQKWTIRYNEEKAAYQFFNTILSNGVLTWIFSNGNTVRVSSSNDQNNDAQYWLINPVSDTDETYTITNLRDTTKALDLYGGQTANGTAIQVFNYHGDDNQKWNIRNPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
molecule keywords HA-33
molecule tags Protein transport
source organism Clostridium botulinum
total genus 77
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo0A01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo0A02
4JAWA 3HOMA 3H6RA 3VT0A 3Q7WA 3BA5A 4X38A 3IAGC 3B9UA 4Q9PA 3BRDA 3E8LC 1PWAA 3JUTA 4HR6C 3BRFA 2BFHA 2FFVA 1TWMA 4J2YA 1G82A 4HJJA 1XYFA 1W3AA 5BXTA 3NJ5A 2AAIB 3IM6A 4XFUA 3BADA 5D62A 5FZUA 4X3AA 2F2FA 4FVVA 1MC9A 2Y9XE 3AH2A 2DRYA 2RQ9A 4OWJA 1SR4C 4P0LA 5EHAA 1ISVA 1L2HA 1R8OA 9ILBA 3IIRA 3ZXGA 1JLXA 4LO3C 1FWVA 2D1ZA 4J2SA 5DSSB 3AJ6A 3CRGA 3Q7XA 2K8RA 3I2AA 3FJEA 1S0CA 3BAUA 1V6XA 1A8DA 4Z8SB 3Q7YA 2P23A 3BB2A 4L4HA 2NTDA 2LIQA 3OBRA 1HCDA 1AFCA 4Z9WB 3KMVA 2NM1A 1YXWA 4EFPA 4ZFYB 1RMLA 4TLPA 4OUJA 4ZBVB 1TTUA 3UD8A 2Z49A 2AFGA 1ABRB 2GZBA 3V0AA 2F2FC 8I1BA 1AVAC 1YTOA 4I4SA 4I4XA 3CU1B 4I37A 3BAVA 1HIBA 4EEEB 4ZA3B 4EB2B 3H6QA 3V0BA 4ZLBB 3CA4A 4ZFUB 1IRAX 4ZFWB 2BEBA 3AH4A 1I1EA 5EG6C 2R9KB 1S0LA 3T8SA 3N7LA 4I4YA 4A7KA 1HWPB 4PC4A 1IOBA 4A7YA 3PHZA 3HMYA 4LO1C 4QD2C 3R4UA 4USPA 4D8HA 1IILA 1IT0A 1P63A 4I4PA 1NZKA 1SZ6B 2KI6B 3VT1A 3RMXA 1PZZA 5I1BA 2NVHA 1XG6A 5D63A 3I29B 2QYIB 4IZEA 2Y9GA 3V0BB 3FJJA 2FDBM 4P6AA 1JT7A 5FNWA 1ONKB 1BLAA 1RZOB 1SR4A 4I4UA 3P6IA 3NBDA 1V6VA 4D0ZA 2FO1A 4X39A 2KH2A 2AXMA 4ZOTA 4LO0C 1JT4A 3F62B 1V6WA 1T9FA 4XFSA 4I1BA 4ZGRB 4IHZA 1E0OA 3VWCA 2XOAA 3WMUA 4USOA 2D7RA 2UUSA 4G9NA 3FFZA 1ISZA 1FMZA 1TOOA 3AKFA 4JPZA 1AVXB 2D7IA 2MIBA 1HWMB 1W3GA 1RG8A 3UD7A 3ILAA 2F8XC 2Y9WC 2HZ9A 4I4VA 3FJKA 2K43A 4I2SA 1R8NA 2RSTA 4ISQA 4KC3A 4Q9GA 2ESUA 2ZR1B 3BA4A 4G9MA 5BXRA 3CA1A 3BTAA 5BXSA 1DZCA 2Z48A 3EF2A 3WMVA 1KNMA 3JRRA 3BAHA 2VXRA 4IQPA 5FZYA 3H6SE 3WINA 3FJCA 41BIA 3P6JA 4QKSA 3OBTA 4I1EA 4J2XA 1ILR1 3S8KA 1V6UA 3FJBA 3H6RB 4OWKA 3HN1A 1OQLB 4G6MA 3N7JA 1BA7A 3RMYA 1RY7A 5G00A 4G1RA 4LO8B 4L4IA 2KLLA 2D20A 3UDAA 5F8SA 1WBCA 4AN6A 2HW9A 4II0A 1G9BA 3N7MA 3AKHA 3O5WB 3OJVA 3CRHA 5DZUA 1S0BA 3UJ0A 2ZQNA 1BARA 4LO1A 4OW4A 1BFBA 4IYBA 2WRYA 1FV3A 4IY8A 3CA0A 1YYNA 3AJ5A 4I7IA 3AKGA 3AH1A 2D23A 2VLCA 2J3PA 3OJ2A 4EFRA 1DQOA 3MPPG 3FJHA 3WINC 4GAFA 3FJIA 4JKQA 4OEFA 3CA6A 3OGGA 4LO0A 2D22A 4I3NA 2M49A 4QD2B 1BASA 3R4SA 3BAOA 4QBVA 1FMMS 2MC2A 2GO2A 2RG9B 2IWTB 5BXPA 3PUBA 4ISRA 1S0EA 2P39A 4DENA 3AZVA 3N0KA 1IHKA 3FJAA 1DLLA 2NP0A 3V0AB 4Q91A 2VU9A 5D61A 1S0GA 3O3QA 2ET2A 5BP5A 1BFCA 5BQUA 4GP3A 1PUMB 3VSZA 1JTCA 3P53A 3QR5A 1FQ9A 2YUGA 3D7WB 4DEPA 4J2KA 1Z0HA 3A21A 1HWOB 3FJ8A 1BFGA 3C9ZA 3AZWA 21BIA 2Q9XA 1D0HA 3IM7A 2X2TA 1AVWB 2VSEA 1XZZA 3CAHA 4I0YA 3O44A 2E4MA 4A7ZA 1HCEA 4QALA 5BOWA 1IJTA 1DFQA 3A07A 2K4AB 4IONA 3S8JA 3A23A 1ITBA 3FJDA 1N4KA 1TFMB 3CA3A 1QQKA 2NZ9A 3O4OA 1GGPB 1ISWA 1HKNA 4FGFA 3W9TA 1J0SA 3OJMA 31BIA 1S0DA 1TP0A 1PUUB 2FGFA 3CQAA 4DCKC 5E24E 4I8MA 5JMCA 3BAGA 1IRPA 1CE7B 1QQLA 5BP5C 5BQUC 4CJMA 5FZZA 4F34A 5DVHA 4KEJA 1EVTA 2VUAA 3CA5A 1Q04A 2KI4A 3OGFA 1Q1UA 3O4AA 4WBCA 4I4RA 1WBAA 1G9AA 3FUQA 1FWUA 4IZXA 3K1XA 4GOYA 4LO7C 4EKXB 1EPWA 1F31A 2DRZA 2NYYA 5F8YA 2E4MC 3BA7A 2D24A 4X37A 3RTJB 1TWEA 1MD6A 3FJFA 1II4A 1K5VA 3IM5A 3O4DA 3N7KA 3O49A 4ENDA 2Y9FA 2D43A 2ERMA 4G6JA 5BVPI 4I96A 4KEIA 5EC5A 4XKIA 2I1BA 3PMEA 2AQZA 3FUOA 3A22A 4KEKA 7I1BA 1AXMA 4LO2A 2MLLB 4GAIA 1JT5A 3TC2A 4AN7B 3HSMA 1WD3A 1VCLA 4EFQA 3ZC8A 1DIWA 1AF9A 3VT2A 4H04A 3BAQA 4F83A 3VEQA 4JKXB 1G9CA 1HWNB 2ZQOA 3SNVA 1M16A 4QKRA 3WO4A 3CRIA 4P0JA 2DREA 2L5XA 2HWAA 2HWMA 1K5UA 1Z2VA 4H9WA 2FFUA 1JQZA 4QBCA 1WD4A 1EYLA 4OEEA 1DZDA 5F8WA 2Q3NB 1Z4SA 1T4QA 3FGMA 3NBNA 1FGAA 5GAQA 4JP0A 1YF8B 4J23B 4KBBA 4QO3A 1TIEA 3UD9A 4I6IA 3ZXDA 1DFCA 1YBIA 3PG0A 4YOLA 3O4CA 1W3FA 3VSFA 1Q03A 1UPSA 1QXMA 4LO2C 2QN4A 3HALA 4IY9A 1FV2A 3F1RA 4P0KA 1PC8B 4HA2A 1DJSB 5DUYA 5JLVA 3RSJA 1EV2A 3ZC9A 1JY0A 3FJ9A 1ISXA 3ZX7A 3BRGC 3V79C 3I2XA 3UJ4A 3WA1A 4R6UB 3POKA 4XFTA 1JT3A 3RTIB 1M2TB 1S0FA 1DQGA 3WO3A 3NBCA 4D0TA 1BFFA 3VUOA 1JLYA 4JQ0A 1CVSA 3QYDA 2LIEA 3AKIA 5HPZA 1XHBA 2D44A 3BX1C 3HBWA 3O4BA 5FNXA 1G9DA 3WO2A 6I1BA 2VXTI 4I4OA 2KKIA 3MALA 3NBEA 1NUNA 4LO7B 5B2HA 1AVUA 4JRAA 2X2SA 4QC4A 5F90A 4OEGA 4LO3A 1ISYA 4I4QA 1I1BA 1BLDA 3LTQA 2VSAA 4ZKTB 2BEAA 2WBCA 2DS0A 2IHOA 4GP0A 1FN0A 3LLPA 4GOVA 4OWLA
chains in the Genus database with same CATH superfamily
4JAWA 3HOMA 3H6RA 3VT0A 3Q7WA 3BA5A 4X38A 3IAGC 3B9UA 4Q9PA 3BRDA 3E8LC 1PWAA 3JUTA 4HR6C 3BRFA 2BFHA 2FFVA 1TWMA 4J2YA 1G82A 4HJJA 1XYFA 1W3AA 5BXTA 3NJ5A 2AAIB 3IM6A 4XFUA 3BADA 5D62A 5FZUA 4X3AA 2F2FA 4FVVA 1MC9A 4MZGB 2Y9XE 3AH2A 2DRYA 2RQ9A 4OWJA 1SR4C 4P0LA 5EHAA 1ISVA 1L2HA 1R8OA 9ILBA 3IIRA 3ZXGA 1JLXA 4LO3C 1FWVA 2D1ZA 4J2SA 5DSSB 3AJ6A 3CRGA 3Q7XA 2K8RA 3I2AA 3FJEA 1S0CA 3BAUA 1V6XA 1A8DA 4MZHA 4Z8SB 3Q7YA 2P23A 3BB2A 4L4HA 2NTDA 2LIQA 3OBRA 1HCDA 1AFCA 4Z9WB 3KMVA 2NM1A 1YXWA 4EFPA 4ZFYB 1RMLA 4TLPA 4OUJA 4ZBVB 1TTUA 3UD8A 2Z49A 2AFGA 1ABRB 2GZBA 3V0AA 2F2FC 8I1BA 1AVAC 1YTOA 4I4SA 4I4XA 3CU1B 4I37A 3BAVA 1HIBA 4EEEB 4ZA3B 4EB2B 3H6QA 3V0BA 4ZLBB 3CA4A 4ZFUB 1IRAX 4ZFWB 2BEBA 3AH4A 1I1EA 5EG6C 2R9KB 1S0LA 3T8SA 3N7LA 4I4YA 4A7KA 1HWPB 4PC4A 1IOBA 4A7YA 3PHZA 3HMYA 4LO1C 4QD2C 3R4UA 4USPA 4D8HA 1IILA 1IT0A 1P63A 4I4PA 1NZKA 1SZ6B 2KI6B 3VT1A 3RMXA 1PZZA 5I1BA 2NVHA 1XG6A 5D63A 3I29B 2QYIB 4IZEA 2Y9GA 3V0BB 3FJJA 2FDBM 4P6AA 1JT7A 5FNWA 1ONKB 1BLAA 1RZOB 1SR4A 4I4UA 3P6IA 3NBDA 1V6VA 4D0ZA 2FO1A 4X39A 2KH2A 2AXMA 4ZOTA 4LO0C 1JT4A 3F62B 1V6WA 1T9FA 4XFSA 4I1BA 4ZGRB 4IHZA 1E0OA 3VWCA 4UY4A 2XOAA 3WMUA 4USOA 2D7RA 2UUSA 4G9NA 3FFZA 1ISZA 1FMZA 1TOOA 3AKFA 4JPZA 1AVXB 2D7IA 2MIBA 1HWMB 1W3GA 1RG8A 3UD7A 3ILAA 2F8XC 2Y9WC 2HZ9A 4I4VA 3FJKA 2K43A 4I2SA 1R8NA 2RSTA 4ISQA 4KC3A 4Q9GA 2ESUA 2ZR1B 3BA4A 4G9MA 5BXRA 3CA1A 3BTAA 5BXSA 1DZCA 2Z48A 3EF2A 3WMVA 1KNMA 3JRRA 3BAHA 2VXRA 4IQPA 5FZYA 3H6SE 3WINA 3FJCA 41BIA 3P6JA 4QKSA 3OBTA 4I1EA 4J2XA 1ILR1 3S8KA 1V6UA 3FJBA 3H6RB 4OWKA 3HN1A 1OQLB 4G6MA 3N7JA 1BA7A 3RMYA 1RY7A 5G00A 4G1RA 4LO8B 4L4IA 2KLLA 2D20A 3UDAA 5F8SA 1WBCA 4AN6A 2HW9A 4II0A 1G9BA 3N7MA 3AKHA 3O5WB 3OJVA 3CRHA 5DZUA 1S0BA 3UJ0A 2ZQNA 1BARA 4LO1A 4OW4A 1BFBA 4IYBA 2WRYA 1FV3A 4IY8A 3CA0A 1YYNA 3AJ5A 4I7IA 3AKGA 3AH1A 2D23A 2VLCA 2J3PA 3OJ2A 4EFRA 1DQOA 3MPPG 3FJHA 3WINC 4GAFA 3FJIA 4JKQA 4OEFA 3CA6A 3OGGA 4LO0A 2D22A 4I3NA 2M49A 4QD2B 1BASA 3R4SA 3BAOA 4QBVA 1FMMS 2MC2A 2GO2A 2RG9B 2IWTB 5BXPA 3PUBA 4ISRA 1S0EA 2P39A 4MZFB 4DENA 3AZVA 3N0KA 1IHKA 3FJAA 1DLLA 2NP0A 3V0AB 4Q91A 2VU9A 5D61A 1S0GA 3O3QA 2ET2A 5BP5A 1BFCA 5BQUA 4GP3A 1PUMB 3VSZA 1JTCA 3P53A 3QR5A 1FQ9A 2YUGA 3D7WB 4DEPA 4J2KA 1Z0HA 3A21A 1HWOB 3FJ8A 1BFGA 3C9ZA 3AZWA 21BIA 2Q9XA 1D0HA 3IM7A 2X2TA 1AVWB 2VSEA 1XZZA 3CAHA 4I0YA 3O44A 2E4MA 4A7ZA 1HCEA 4QALA 5BOWA 1IJTA 1DFQA 3A07A 2K4AB 4IONA 3S8JA 3A23A 1ITBA 3FJDA 1N4KA 1TFMB 3CA3A 1QQKA 2NZ9A 3O4OA 1GGPB 1ISWA 1HKNA 4FGFA 3W9TA 1J0SA 3OJMA 31BIA 1S0DA 1TP0A 1PUUB 2FGFA 3CQAA 4DCKC 5E24E 4I8MA 5JMCA 3BAGA 1IRPA 1CE7B 1QQLA 5BP5C 5BQUC 4CJMA 5FZZA 4F34A 5DVHA 4KEJA 1EVTA 2VUAA 3CA5A 1Q04A 2KI4A 3OGFA 1Q1UA 3O4AA 4WBCA 4I4RA 1WBAA 1G9AA 3FUQA 1FWUA 4IZXA 3K1XA 4GOYA 4LO7C 4EKXB 1EPWA 1F31A 2DRZA 2NYYA 5F8YA 2E4MC 3BA7A 2D24A 4X37A 3RTJB 1TWEA 1MD6A 3FJFA 1II4A 1K5VA 3IM5A 3O4DA 3N7KA 3O49A 4ENDA 2Y9FA 2D43A 2ERMA 4G6JA 5BVPI 4I96A 4KEIA 5EC5A 4XKIA 2I1BA 3PMEA 2AQZA 3FUOA 3A22A 4KEKA 7I1BA 1AXMA 4LO2A 2MLLB 4GAIA 1JT5A 3TC2A 4AN7B 3HSMA 1WD3A 1VCLA 4EFQA 3ZC8A 1DIWA 1AF9A 3VT2A 4H04A 3BAQA 4F83A 3VEQA 4JKXB 1G9CA 1HWNB 2ZQOA 3SNVA 1M16A 4QKRA 3WO4A 3CRIA 4P0JA 2DREA 2L5XA 2HWAA 2HWMA 1K5UA 1Z2VA 4H9WA 2FFUA 1JQZA 4QBCA 1WD4A 1EYLA 4OEEA 1DZDA 5F8WA 2Q3NB 1Z4SA 1T4QA 3FGMA 3NBNA 1FGAA 5GAQA 4JP0A 1YF8B 4J23B 4KBBA 4QO3A 1TIEA 3UD9A 4I6IA 3ZXDA 1DFCA 1YBIA 3PG0A 4YOLA 3O4CA 1W3FA 3VSFA 1Q03A 1UPSA 1QXMA 4LO2C 2QN4A 3HALA 4IY9A 1FV2A 3F1RA 4P0KA 1PC8B 2NS2A 4HA2A 1DJSB 5DUYA 5JLVA 3RSJA 1EV2A 3ZC9A 1JY0A 3FJ9A 1ISXA 3ZX7A 3BRGC 3V79C 3I2XA 3UJ4A 3WA1A 4R6UB 3POKA 4XFTA 4H75A 1JT3A 3RTIB 1M2TB 1S0FA 1DQGA 3WO3A 3NBCA 4D0TA 1BFFA 3VUOA 1JLYA 4JQ0A 1CVSA 3QYDA 2LIEA 3AKIA 5HPZA 1XHBA 2D44A 3BX1C 3HBWA 3O4BA 5FNXA 1G9DA 3WO2A 6I1BA 2VXTI 4I4OA 2KKIA 3MALA 3NBEA 1NUNA 4LO7B 5B2HA 1AVUA 4JRAA 2X2SA 4QC4A 5F90A 4OEGA 4LO3A 1ISYA 4I4QA 1I1BA 1BLDA 3LTQA 2VSAA 4ZKTB 2BEAA 2WBCA 2DS0A 2IHOA 4GP0A 1FN0A 3LLPA 4GOVA 4OWLA
chains in the Genus database with same CATH topology
4JAWA 3HOMA 3H6RA 3VT0A 3Q7WA 3BA5A 4X38A 3IAGC 3B9UA 4Q9PA 3BRDA 3E8LC 1PWAA 3JUTA 4HR6C 3BRFA 2BFHA 2FFVA 1TWMA 4J2YA 1G82A 4HJJA 1XYFA 1W3AA 5BXTA 3NJ5A 2AAIB 3IM6A 4XFUA 3BADA 5D62A 5FZUA 4X3AA 2F2FA 4FVVA 1MC9A 4MZGB 2Y9XE 3AH2A 2DRYA 2RQ9A 4OWJA 1SR4C 4P0LA 5EHAA 1ISVA 1L2HA 1R8OA 9ILBA 3IIRA 3ZXGA 1JLXA 4LO3C 1FWVA 2D1ZA 4J2SA 5DSSB 3AJ6A 3CRGA 3Q7XA 2K8RA 3I2AA 3FJEA 1S0CA 3BAUA 1V6XA 1A8DA 4MZHA 4Z8SB 3Q7YA 2P23A 3BB2A 4L4HA 2NTDA 2LIQA 3OBRA 1HCDA 1AFCA 4Z9WB 3KMVA 2NM1A 1YXWA 4EFPA 4ZFYB 1RMLA 4TLPA 4OUJA 4ZBVB 1TTUA 3UD8A 2Z49A 2AFGA 1ABRB 2GZBA 3V0AA 2F2FC 8I1BA 1AVAC 1YTOA 4I4SA 4I4XA 3CU1B 4I37A 3BAVA 1HIBA 4EEEB 4ZA3B 4EB2B 3H6QA 3V0BA 4ZLBB 3CA4A 4ZFUB 1IRAX 4ZFWB 2BEBA 3AH4A 1I1EA 5EG6C 2R9KB 1S0LA 3T8SA 3N7LA 4I4YA 4A7KA 1HWPB 4PC4A 1IOBA 4A7YA 3PHZA 3HMYA 4LO1C 4QD2C 3R4UA 4USPA 4D8HA 1IILA 1IT0A 1P63A 4I4PA 1NZKA 1SZ6B 2KI6B 3VT1A 3RMXA 1PZZA 5I1BA 2NVHA 1XG6A 5D63A 3I29B 2QYIB 4IZEA 2Y9GA 3V0BB 3FJJA 2FDBM 4P6AA 1JT7A 5FNWA 1ONKB 1BLAA 1RZOB 1SR4A 4I4UA 3P6IA 3NBDA 1V6VA 4D0ZA 2FO1A 4X39A 2KH2A 2AXMA 4ZOTA 4LO0C 1JT4A 3F62B 1V6WA 1T9FA 4XFSA 4I1BA 4ZGRB 4IHZA 1E0OA 3VWCA 4UY4A 2XOAA 3WMUA 4USOA 2D7RA 2UUSA 4G9NA 3FFZA 1ISZA 1FMZA 1TOOA 3AKFA 4JPZA 1AVXB 2D7IA 2MIBA 1HWMB 1W3GA 1RG8A 3UD7A 3ILAA 2F8XC 2Y9WC 2HZ9A 4I4VA 3FJKA 2K43A 4I2SA 1R8NA 2RSTA 4ISQA 4KC3A 4Q9GA 2ESUA 2ZR1B 3BA4A 4G9MA 5BXRA 3CA1A 3BTAA 5BXSA 1DZCA 2Z48A 3EF2A 3WMVA 1KNMA 3JRRA 3BAHA 2VXRA 4IQPA 5FZYA 3H6SE 3WINA 3FJCA 41BIA 3P6JA 4QKSA 3OBTA 4I1EA 4J2XA 1ILR1 3S8KA 1V6UA 3FJBA 3H6RB 4OWKA 3HN1A 1OQLB 4G6MA 3N7JA 1BA7A 3RMYA 1RY7A 5G00A 4G1RA 4LO8B 4L4IA 2KLLA 2D20A 3UDAA 5F8SA 1WBCA 4AN6A 2HW9A 4II0A 1G9BA 3N7MA 3AKHA 3O5WB 3OJVA 3CRHA 5DZUA 1S0BA 3UJ0A 2ZQNA 1BARA 4LO1A 4OW4A 1BFBA 4IYBA 2WRYA 1FV3A 4IY8A 3CA0A 1YYNA 3AJ5A 4I7IA 3AKGA 3AH1A 2D23A 2VLCA 2J3PA 3OJ2A 4EFRA 1DQOA 3MPPG 3FJHA 3WINC 4GAFA 3FJIA 4JKQA 4OEFA 3CA6A 3OGGA 4LO0A 2D22A 4I3NA 2M49A 4QD2B 1BASA 3R4SA 3BAOA 4QBVA 1FMMS 2MC2A 2GO2A 2RG9B 2IWTB 5BXPA 3PUBA 4ISRA 1S0EA 2P39A 4MZFB 4DENA 3AZVA 3N0KA 1IHKA 3FJAA 1DLLA 2NP0A 3V0AB 4Q91A 2VU9A 5D61A 1S0GA 3O3QA 2ET2A 5BP5A 1BFCA 5BQUA 4GP3A 1PUMB 3VSZA 1JTCA 3P53A 3QR5A 1FQ9A 2YUGA 3D7WB 4DEPA 4J2KA 1Z0HA 3A21A 1HWOB 3FJ8A 1BFGA 3C9ZA 3AZWA 21BIA 2Q9XA 1D0HA 3IM7A 2X2TA 1AVWB 2VSEA 1XZZA 3CAHA 4I0YA 3O44A 2E4MA 4A7ZA 1HCEA 4QALA 5BOWA 1IJTA 1DFQA 3A07A 2K4AB 4IONA 3S8JA 3A23A 1ITBA 3FJDA 1N4KA 1TFMB 3CA3A 1QQKA 2NZ9A 3O4OA 1GGPB 1ISWA 1HKNA 4FGFA 3W9TA 1J0SA 3OJMA 31BIA 1S0DA 1TP0A 1PUUB 2FGFA 3CQAA 4DCKC 5E24E 4I8MA 5JMCA 3BAGA 1IRPA 1CE7B 1QQLA 5BP5C 5BQUC 4CJMA 5FZZA 4F34A 5DVHA 4KEJA 1EVTA 2VUAA 3CA5A 1Q04A 2KI4A 3OGFA 1Q1UA 3O4AA 4WBCA 4I4RA 1WBAA 1G9AA 3FUQA 1FWUA 4IZXA 3K1XA 4GOYA 4LO7C 4EKXB 1EPWA 1F31A 2DRZA 2NYYA 5F8YA 2E4MC 3BA7A 2D24A 4X37A 3RTJB 1TWEA 1MD6A 3FJFA 1II4A 1K5VA 3IM5A 3O4DA 3N7KA 3O49A 4ENDA 2Y9FA 2D43A 2ERMA 4G6JA 5BVPI 4I96A 4KEIA 5EC5A 4XKIA 2I1BA 3PMEA 2AQZA 3FUOA 3A22A 4KEKA 7I1BA 1AXMA 4LO2A 2MLLB 4GAIA 1JT5A 3TC2A 4AN7B 3HSMA 1WD3A 1VCLA 4EFQA 3ZC8A 1DIWA 1AF9A 3VT2A 4H04A 3BAQA 4F83A 3VEQA 4JKXB 1G9CA 1HWNB 2ZQOA 3SNVA 1M16A 4QKRA 3WO4A 3CRIA 4P0JA 2DREA 2L5XA 2HWAA 2HWMA 1K5UA 1Z2VA 4H9WA 2FFUA 1JQZA 4QBCA 1WD4A 1EYLA 4OEEA 1DZDA 5F8WA 2Q3NB 1Z4SA 1T4QA 3FGMA 3NBNA 1FGAA 5GAQA 4JP0A 1YF8B 4J23B 4KBBA 4QO3A 1TIEA 3UD9A 4I6IA 3ZXDA 1DFCA 1YBIA 3PG0A 4YOLA 3O4CA 1W3FA 3VSFA 1Q03A 1UPSA 1QXMA 4LO2C 2QN4A 3HALA 4IY9A 1FV2A 3F1RA 4P0KA 1PC8B 2NS2A 4HA2A 1DJSB 5DUYA 5JLVA 3RSJA 1EV2A 3ZC9A 1JY0A 3FJ9A 1ISXA 3ZX7A 3BRGC 3V79C 3I2XA 3UJ4A 3WA1A 4R6UB 3POKA 4XFTA 4H75A 1JT3A 3RTIB 1M2TB 1S0FA 1DQGA 3WO3A 3NBCA 4D0TA 1BFFA 3VUOA 1JLYA 4JQ0A 1CVSA 3QYDA 2LIEA 3AKIA 5HPZA 1XHBA 2D44A 3BX1C 3HBWA 3O4BA 5FNXA 1G9DA 3WO2A 6I1BA 2VXTI 4I4OA 2KKIA 3MALA 3NBEA 1NUNA 4LO7B 5B2HA 1AVUA 4JRAA 2X2SA 4QC4A 5F90A 4OEGA 4LO3A 1ISYA 4I4QA 1I1BA 1BLDA 3LTQA 2VSAA 4ZKTB 2BEAA 2WBCA 2DS0A 2IHOA 4GP0A 1FN0A 3LLPA 4GOVA 4OWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JAW A;  3HOM A;  3H6R A;  3VT0 A;  3Q7W A;  3BA5 A;  4X38 A;  3IAG C;  3B9U A;  4Q9P A;  3BRD A;  3E8L C;  1PWA A;  3JUT A;  4HR6 C;  3BRF A;  2BFH A;  2FFV A;  1TWM A;  4J2Y A;  1G82 A;  4HJJ A;  1XYF A;  1W3A A;  5BXT A;  3NJ5 A;  2AAI B;  3IM6 A;  4XFU A;  3BAD A;  5D62 A;  5FZU A;  4X3A A;  2F2F A;  4FVV A;  1MC9 A;  2Y9X E;  3AH2 A;  2DRY A;  2RQ9 A;  4OWJ A;  1SR4 C;  4P0L A;  5EHA A;  1ISV A;  1L2H A;  1R8O A;  9ILB A;  3IIR A;  3ZXG A;  1JLX A;  4LO3 C;  1FWV A;  2D1Z A;  4J2S A;  5DSS B;  3AJ6 A;  3CRG A;  3Q7X A;  2K8R A;  3I2A A;  3FJE A;  1S0C A;  3BAU A;  1V6X A;  1A8D A;  4Z8S B;  3Q7Y A;  2P23 A;  3BB2 A;  4L4H A;  2NTD A;  2LIQ A;  3OBR A;  1HCD A;  1AFC A;  4Z9W B;  3KMV A;  2NM1 A;  1YXW A;  4EFP A;  4ZFY B;  1RML A;  4TLP A;  4OUJ A;  4ZBV B;  1TTU A;  3UD8 A;  2Z49 A;  2AFG A;  1ABR B;  2GZB A;  3V0A A;  2F2F C;  8I1B A;  1AVA C;  1YTO A;  4I4S A;  4I4X A;  3CU1 B;  4I37 A;  3BAV A;  1HIB A;  4EEE B;  4ZA3 B;  4EB2 B;  3H6Q A;  3V0B A;  4ZLB B;  3CA4 A;  4ZFU B;  1IRA X;  4ZFW B;  2BEB A;  3AH4 A;  1I1E A;  5EG6 C;  2R9K B;  1S0L A;  3T8S A;  3N7L A;  4I4Y A;  4A7K A;  1HWP B;  4PC4 A;  1IOB A;  4A7Y A;  3PHZ A;  3HMY A;  4LO1 C;  4QD2 C;  3R4U A;  4USP A;  4D8H A;  1IIL A;  1IT0 A;  1P63 A;  4I4P A;  1NZK A;  1SZ6 B;  2KI6 B;  3VT1 A;  3RMX A;  1PZZ A;  5I1B A;  2NVH A;  1XG6 A;  5D63 A;  3I29 B;  2QYI B;  4IZE A;  2Y9G A;  3V0B B;  3FJJ A;  2FDB M;  4P6A A;  1JT7 A;  5FNW A;  1ONK B;  1BLA A;  1RZO B;  1SR4 A;  4I4U A;  3P6I A;  3NBD A;  1V6V A;  4D0Z A;  2FO1 A;  4X39 A;  2KH2 A;  2AXM A;  4ZOT A;  4LO0 C;  1JT4 A;  3F62 B;  1V6W A;  1T9F A;  4XFS A;  4I1B A;  4ZGR B;  4IHZ A;  1E0O A;  3VWC A;  2XOA A;  3WMU A;  4USO A;  2D7R A;  2UUS A;  4G9N A;  3FFZ A;  1ISZ A;  1FMZ A;  1TOO A;  3AKF A;  4JPZ A;  1AVX B;  2D7I A;  2MIB A;  1HWM B;  1W3G A;  1RG8 A;  3UD7 A;  3ILA A;  2F8X C;  2Y9W C;  2HZ9 A;  4I4V A;  3FJK A;  2K43 A;  4I2S A;  1R8N A;  2RST A;  4ISQ A;  4KC3 A;  4Q9G A;  2ESU A;  2ZR1 B;  3BA4 A;  4G9M A;  5BXR A;  3CA1 A;  3BTA A;  5BXS A;  1DZC A;  2Z48 A;  3EF2 A;  3WMV A;  1KNM A;  3JRR A;  3BAH A;  2VXR A;  4IQP A;  5FZY A;  3H6S E;  3WIN A;  3FJC A;  41BI A;  3P6J A;  4QKS A;  3OBT A;  4I1E A;  4J2X A;  1ILR 1;  3S8K A;  1V6U A;  3FJB A;  3H6R B;  4OWK A;  3HN1 A;  1OQL B;  4G6M A;  3N7J A;  1BA7 A;  3RMY A;  1RY7 A;  5G00 A;  4G1R A;  4LO8 B;  4L4I A;  2KLL A;  2D20 A;  3UDA A;  5F8S A;  1WBC A;  4AN6 A;  2HW9 A;  4II0 A;  1G9B A;  3N7M A;  3AKH A;  3O5W B;  3OJV A;  3CRH A;  5DZU A;  1S0B A;  3UJ0 A;  2ZQN A;  1BAR A;  4LO1 A;  4OW4 A;  1BFB A;  4IYB A;  2WRY A;  1FV3 A;  4IY8 A;  3CA0 A;  1YYN A;  3AJ5 A;  4I7I A;  3AKG A;  3AH1 A;  2D23 A;  2VLC A;  2J3P A;  3OJ2 A;  4EFR A;  1DQO A;  3MPP G;  3FJH A;  3WIN C;  4GAF A;  3FJI A;  4JKQ A;  4OEF A;  3CA6 A;  3OGG A;  4LO0 A;  2D22 A;  4I3N A;  2M49 A;  4QD2 B;  1BAS A;  3R4S A;  3BAO A;  4QBV A;  1FMM S;  2MC2 A;  2GO2 A;  2RG9 B;  2IWT B;  5BXP A;  3PUB A;  4ISR A;  1S0E A;  2P39 A;  4DEN A;  3AZV A;  3N0K A;  1IHK A;  3FJA A;  1DLL A;  2NP0 A;  3V0A B;  4Q91 A;  2VU9 A;  5D61 A;  1S0G A;  3O3Q A;  2ET2 A;  5BP5 A;  1BFC A;  5BQU A;  4GP3 A;  1PUM B;  3VSZ A;  1JTC A;  3P53 A;  3QR5 A;  1FQ9 A;  2YUG A;  3D7W B;  4DEP A;  4J2K A;  1Z0H A;  3A21 A;  1HWO B;  3FJ8 A;  1BFG A;  3C9Z A;  3AZW A;  21BI A;  2Q9X A;  1D0H A;  3IM7 A;  2X2T A;  1AVW B;  2VSE A;  1XZZ A;  3CAH A;  4I0Y A;  3O44 A;  2E4M A;  4A7Z A;  1HCE A;  4QAL A;  5BOW A;  1IJT A;  1DFQ A;  3A07 A;  2K4A B;  4ION A;  3S8J A;  3A23 A;  1ITB A;  3FJD A;  1N4K A;  1TFM B;  3CA3 A;  1QQK A;  2NZ9 A;  3O4O A;  1GGP B;  1ISW A;  1HKN A;  4FGF A;  3W9T A;  1J0S A;  3OJM A;  31BI A;  1S0D A;  1TP0 A;  1PUU B;  2FGF A;  3CQA A;  4DCK C;  5E24 E;  4I8M A;  5JMC A;  3BAG A;  1IRP A;  1CE7 B;  1QQL A;  5BP5 C;  5BQU C;  4CJM A;  5FZZ A;  4F34 A;  5DVH A;  4KEJ A;  1EVT A;  2VUA A;  3CA5 A;  1Q04 A;  2KI4 A;  3OGF A;  1Q1U A;  3O4A A;  4WBC A;  4I4R A;  1WBA A;  1G9A A;  3FUQ A;  1FWU A;  4IZX A;  3K1X A;  4GOY A;  4LO7 C;  4EKX B;  1EPW A;  1F31 A;  2DRZ A;  2NYY A;  5F8Y A;  2E4M C;  3BA7 A;  2D24 A;  4X37 A;  3RTJ B;  1TWE A;  1MD6 A;  3FJF A;  1II4 A;  1K5V A;  3IM5 A;  3O4D A;  3N7K A;  3O49 A;  4END A;  2Y9F A;  2D43 A;  2ERM A;  4G6J A;  5BVP I;  4I96 A;  4KEI A;  5EC5 A;  4XKI A;  2I1B A;  3PME A;  2AQZ A;  3FUO A;  3A22 A;  4KEK A;  7I1B A;  1AXM A;  4LO2 A;  2MLL B;  4GAI A;  1JT5 A;  3TC2 A;  4AN7 B;  3HSM A;  1WD3 A;  1VCL A;  4EFQ A;  3ZC8 A;  1DIW A;  1AF9 A;  3VT2 A;  4H04 A;  3BAQ A;  4F83 A;  3VEQ A;  4JKX B;  1G9C A;  1HWN B;  2ZQO A;  3SNV A;  1M16 A;  4QKR A;  3WO4 A;  3CRI A;  4P0J A;  2DRE A;  2L5X A;  2HWA A;  2HWM A;  1K5U A;  1Z2V A;  4H9W A;  2FFU A;  1JQZ A;  4QBC A;  1WD4 A;  1EYL A;  4OEE A;  1DZD A;  5F8W A;  2Q3N B;  1Z4S A;  1T4Q A;  3FGM A;  3NBN A;  1FGA A;  5GAQ A;  4JP0 A;  1YF8 B;  4J23 B;  4KBB A;  4QO3 A;  1TIE A;  3UD9 A;  4I6I A;  3ZXD A;  1DFC A;  1YBI A;  3PG0 A;  4YOL A;  3O4C A;  1W3F A;  3VSF A;  1Q03 A;  1UPS A;  1QXM A;  4LO2 C;  2QN4 A;  3HAL A;  4IY9 A;  1FV2 A;  3F1R A;  4P0K A;  1PC8 B;  4HA2 A;  1DJS B;  5DUY A;  5JLV A;  3RSJ A;  1EV2 A;  3ZC9 A;  1JY0 A;  3FJ9 A;  1ISX A;  3ZX7 A;  3BRG C;  3V79 C;  3I2X A;  3UJ4 A;  3WA1 A;  4R6U B;  3POK A;  4XFT A;  1JT3 A;  3RTI B;  1M2T B;  1S0F A;  1DQG A;  3WO3 A;  3NBC A;  4D0T A;  1BFF A;  3VUO A;  1JLY A;  4JQ0 A;  1CVS A;  3QYD A;  2LIE A;  3AKI A;  5HPZ A;  1XHB A;  2D44 A;  3BX1 C;  3HBW A;  3O4B A;  5FNX A;  1G9D A;  3WO2 A;  6I1B A;  2VXT I;  4I4O A;  2KKI A;  3MAL A;  3NBE A;  1NUN A;  4LO7 B;  5B2H A;  1AVU A;  4JRA A;  2X2S A;  4QC4 A;  5F90 A;  4OEG A;  4LO3 A;  1ISY A;  4I4Q A;  1I1B A;  1BLD A;  3LTQ A;  2VSA A;  4ZKT B;  2BEA A;  2WBC A;  2DS0 A;  2IHO A;  4GP0 A;  1FN0 A;  3LLP A;  4GOV A;  4OWL A; 
#chains in the Genus database with same CATH topology
 4JAW A;  3HOM A;  3H6R A;  3VT0 A;  3Q7W A;  3BA5 A;  4X38 A;  3IAG C;  3B9U A;  4Q9P A;  3BRD A;  3E8L C;  1PWA A;  3JUT A;  4HR6 C;  3BRF A;  2BFH A;  2FFV A;  1TWM A;  4J2Y A;  1G82 A;  4HJJ A;  1XYF A;  1W3A A;  5BXT A;  3NJ5 A;  2AAI B;  3IM6 A;  4XFU A;  3BAD A;  5D62 A;  5FZU A;  4X3A A;  2F2F A;  4FVV A;  1MC9 A;  4MZG B;  2Y9X E;  3AH2 A;  2DRY A;  2RQ9 A;  4OWJ A;  1SR4 C;  4P0L A;  5EHA A;  1ISV A;  1L2H A;  1R8O A;  9ILB A;  3IIR A;  3ZXG A;  1JLX A;  4LO3 C;  1FWV A;  2D1Z A;  4J2S A;  5DSS B;  3AJ6 A;  3CRG A;  3Q7X A;  2K8R A;  3I2A A;  3FJE A;  1S0C A;  3BAU A;  1V6X A;  1A8D A;  4MZH A;  4Z8S B;  3Q7Y A;  2P23 A;  3BB2 A;  4L4H A;  2NTD A;  2LIQ A;  3OBR A;  1HCD A;  1AFC A;  4Z9W B;  3KMV A;  2NM1 A;  1YXW A;  4EFP A;  4ZFY B;  1RML A;  4TLP A;  4OUJ A;  4ZBV B;  1TTU A;  3UD8 A;  2Z49 A;  2AFG A;  1ABR B;  2GZB A;  3V0A A;  2F2F C;  8I1B A;  1AVA C;  1YTO A;  4I4S A;  4I4X A;  3CU1 B;  4I37 A;  3BAV A;  1HIB A;  4EEE B;  4ZA3 B;  4EB2 B;  3H6Q A;  3V0B A;  4ZLB B;  3CA4 A;  4ZFU B;  1IRA X;  4ZFW B;  2BEB A;  3AH4 A;  1I1E A;  5EG6 C;  2R9K B;  1S0L A;  3T8S A;  3N7L A;  4I4Y A;  4A7K A;  1HWP B;  4PC4 A;  1IOB A;  4A7Y A;  3PHZ A;  3HMY A;  4LO1 C;  4QD2 C;  3R4U A;  4USP A;  4D8H A;  1IIL A;  1IT0 A;  1P63 A;  4I4P A;  1NZK A;  1SZ6 B;  2KI6 B;  3VT1 A;  3RMX A;  1PZZ A;  5I1B A;  2NVH A;  1XG6 A;  5D63 A;  3I29 B;  2QYI B;  4IZE A;  2Y9G A;  3V0B B;  3FJJ A;  2FDB M;  4P6A A;  1JT7 A;  5FNW A;  1ONK B;  1BLA A;  1RZO B;  1SR4 A;  4I4U A;  3P6I A;  3NBD A;  1V6V A;  4D0Z A;  2FO1 A;  4X39 A;  2KH2 A;  2AXM A;  4ZOT A;  4LO0 C;  1JT4 A;  3F62 B;  1V6W A;  1T9F A;  4XFS A;  4I1B A;  4ZGR B;  4IHZ A;  1E0O A;  3VWC A;  4UY4 A;  2XOA A;  3WMU A;  4USO A;  2D7R A;  2UUS A;  4G9N A;  3FFZ A;  1ISZ A;  1FMZ A;  1TOO A;  3AKF A;  4JPZ A;  1AVX B;  2D7I A;  2MIB A;  1HWM B;  1W3G A;  1RG8 A;  3UD7 A;  3ILA A;  2F8X C;  2Y9W C;  2HZ9 A;  4I4V A;  3FJK A;  2K43 A;  4I2S A;  1R8N A;  2RST A;  4ISQ A;  4KC3 A;  4Q9G A;  2ESU A;  2ZR1 B;  3BA4 A;  4G9M A;  5BXR A;  3CA1 A;  3BTA A;  5BXS A;  1DZC A;  2Z48 A;  3EF2 A;  3WMV A;  1KNM A;  3JRR A;  3BAH A;  2VXR A;  4IQP A;  5FZY A;  3H6S E;  3WIN A;  3FJC A;  41BI A;  3P6J A;  4QKS A;  3OBT A;  4I1E A;  4J2X A;  1ILR 1;  3S8K A;  1V6U A;  3FJB A;  3H6R B;  4OWK A;  3HN1 A;  1OQL B;  4G6M A;  3N7J A;  1BA7 A;  3RMY A;  1RY7 A;  5G00 A;  4G1R A;  4LO8 B;  4L4I A;  2KLL A;  2D20 A;  3UDA A;  5F8S A;  1WBC A;  4AN6 A;  2HW9 A;  4II0 A;  1G9B A;  3N7M A;  3AKH A;  3O5W B;  3OJV A;  3CRH A;  5DZU A;  1S0B A;  3UJ0 A;  2ZQN A;  1BAR A;  4LO1 A;  4OW4 A;  1BFB A;  4IYB A;  2WRY A;  1FV3 A;  4IY8 A;  3CA0 A;  1YYN A;  3AJ5 A;  4I7I A;  3AKG A;  3AH1 A;  2D23 A;  2VLC A;  2J3P A;  3OJ2 A;  4EFR A;  1DQO A;  3MPP G;  3FJH A;  3WIN C;  4GAF A;  3FJI A;  4JKQ A;  4OEF A;  3CA6 A;  3OGG A;  4LO0 A;  2D22 A;  4I3N A;  2M49 A;  4QD2 B;  1BAS A;  3R4S A;  3BAO A;  4QBV A;  1FMM S;  2MC2 A;  2GO2 A;  2RG9 B;  2IWT B;  5BXP A;  3PUB A;  4ISR A;  1S0E A;  2P39 A;  4MZF B;  4DEN A;  3AZV A;  3N0K A;  1IHK A;  3FJA A;  1DLL A;  2NP0 A;  3V0A B;  4Q91 A;  2VU9 A;  5D61 A;  1S0G A;  3O3Q A;  2ET2 A;  5BP5 A;  1BFC A;  5BQU A;  4GP3 A;  1PUM B;  3VSZ A;  1JTC A;  3P53 A;  3QR5 A;  1FQ9 A;  2YUG A;  3D7W B;  4DEP A;  4J2K A;  1Z0H A;  3A21 A;  1HWO B;  3FJ8 A;  1BFG A;  3C9Z A;  3AZW A;  21BI A;  2Q9X A;  1D0H A;  3IM7 A;  2X2T A;  1AVW B;  2VSE A;  1XZZ A;  3CAH A;  4I0Y A;  3O44 A;  2E4M A;  4A7Z A;  1HCE A;  4QAL A;  5BOW A;  1IJT A;  1DFQ A;  3A07 A;  2K4A B;  4ION A;  3S8J A;  3A23 A;  1ITB A;  3FJD A;  1N4K A;  1TFM B;  3CA3 A;  1QQK A;  2NZ9 A;  3O4O A;  1GGP B;  1ISW A;  1HKN A;  4FGF A;  3W9T A;  1J0S A;  3OJM A;  31BI A;  1S0D A;  1TP0 A;  1PUU B;  2FGF A;  3CQA A;  4DCK C;  5E24 E;  4I8M A;  5JMC A;  3BAG A;  1IRP A;  1CE7 B;  1QQL A;  5BP5 C;  5BQU C;  4CJM A;  5FZZ A;  4F34 A;  5DVH A;  4KEJ A;  1EVT A;  2VUA A;  3CA5 A;  1Q04 A;  2KI4 A;  3OGF A;  1Q1U A;  3O4A A;  4WBC A;  4I4R A;  1WBA A;  1G9A A;  3FUQ A;  1FWU A;  4IZX A;  3K1X A;  4GOY A;  4LO7 C;  4EKX B;  1EPW A;  1F31 A;  2DRZ A;  2NYY A;  5F8Y A;  2E4M C;  3BA7 A;  2D24 A;  4X37 A;  3RTJ B;  1TWE A;  1MD6 A;  3FJF A;  1II4 A;  1K5V A;  3IM5 A;  3O4D A;  3N7K A;  3O49 A;  4END A;  2Y9F A;  2D43 A;  2ERM A;  4G6J A;  5BVP I;  4I96 A;  4KEI A;  5EC5 A;  4XKI A;  2I1B A;  3PME A;  2AQZ A;  3FUO A;  3A22 A;  4KEK A;  7I1B A;  1AXM A;  4LO2 A;  2MLL B;  4GAI A;  1JT5 A;  3TC2 A;  4AN7 B;  3HSM A;  1WD3 A;  1VCL A;  4EFQ A;  3ZC8 A;  1DIW A;  1AF9 A;  3VT2 A;  4H04 A;  3BAQ A;  4F83 A;  3VEQ A;  4JKX B;  1G9C A;  1HWN B;  2ZQO A;  3SNV A;  1M16 A;  4QKR A;  3WO4 A;  3CRI A;  4P0J A;  2DRE A;  2L5X A;  2HWA A;  2HWM A;  1K5U A;  1Z2V A;  4H9W A;  2FFU A;  1JQZ A;  4QBC A;  1WD4 A;  1EYL A;  4OEE A;  1DZD A;  5F8W A;  2Q3N B;  1Z4S A;  1T4Q A;  3FGM A;  3NBN A;  1FGA A;  5GAQ A;  4JP0 A;  1YF8 B;  4J23 B;  4KBB A;  4QO3 A;  1TIE A;  3UD9 A;  4I6I A;  3ZXD A;  1DFC A;  1YBI A;  3PG0 A;  4YOL A;  3O4C A;  1W3F A;  3VSF A;  1Q03 A;  1UPS A;  1QXM A;  4LO2 C;  2QN4 A;  3HAL A;  4IY9 A;  1FV2 A;  3F1R A;  4P0K A;  1PC8 B;  2NS2 A;  4HA2 A;  1DJS B;  5DUY A;  5JLV A;  3RSJ A;  1EV2 A;  3ZC9 A;  1JY0 A;  3FJ9 A;  1ISX A;  3ZX7 A;  3BRG C;  3V79 C;  3I2X A;  3UJ4 A;  3WA1 A;  4R6U B;  3POK A;  4XFT A;  4H75 A;  1JT3 A;  3RTI B;  1M2T B;  1S0F A;  1DQG A;  3WO3 A;  3NBC A;  4D0T A;  1BFF A;  3VUO A;  1JLY A;  4JQ0 A;  1CVS A;  3QYD A;  2LIE A;  3AKI A;  5HPZ A;  1XHB A;  2D44 A;  3BX1 C;  3HBW A;  3O4B A;  5FNX A;  1G9D A;  3WO2 A;  6I1B A;  2VXT I;  4I4O A;  2KKI A;  3MAL A;  3NBE A;  1NUN A;  4LO7 B;  5B2H A;  1AVU A;  4JRA A;  2X2S A;  4QC4 A;  5F90 A;  4OEG A;  4LO3 A;  1ISY A;  4I4Q A;  1I1B A;  1BLD A;  3LTQ A;  2VSA A;  4ZKT B;  2BEA A;  2WBC A;  2DS0 A;  2IHO A;  4GP0 A;  1FN0 A;  3LLP A;  4GOV A;  4OWL A; 
#chains in the Genus database with same CATH homology
 4JAW A;  3HOM A;  3H6R A;  3VT0 A;  3Q7W A;  3BA5 A;  4X38 A;  3IAG C;  3B9U A;  4Q9P A;  3BRD A;  3E8L C;  1PWA A;  3JUT A;  4HR6 C;  3BRF A;  2BFH A;  2FFV A;  1TWM A;  4J2Y A;  1G82 A;  4HJJ A;  1XYF A;  1W3A A;  5BXT A;  3NJ5 A;  2AAI B;  3IM6 A;  4XFU A;  3BAD A;  5D62 A;  5FZU A;  4X3A A;  2F2F A;  4FVV A;  1MC9 A;  4MZG B;  2Y9X E;  3AH2 A;  2DRY A;  2RQ9 A;  4OWJ A;  1SR4 C;  4P0L A;  5EHA A;  1ISV A;  1L2H A;  1R8O A;  9ILB A;  3IIR A;  3ZXG A;  1JLX A;  4LO3 C;  1FWV A;  2D1Z A;  4J2S A;  5DSS B;  3AJ6 A;  3CRG A;  3Q7X A;  2K8R A;  3I2A A;  3FJE A;  1S0C A;  3BAU A;  1V6X A;  1A8D A;  4MZH A;  4Z8S B;  3Q7Y A;  2P23 A;  3BB2 A;  4L4H A;  2NTD A;  2LIQ A;  3OBR A;  1HCD A;  1AFC A;  4Z9W B;  3KMV A;  2NM1 A;  1YXW A;  4EFP A;  4ZFY B;  1RML A;  4TLP A;  4OUJ A;  4ZBV B;  1TTU A;  3UD8 A;  2Z49 A;  2AFG A;  1ABR B;  2GZB A;  3V0A A;  2F2F C;  8I1B A;  1AVA C;  1YTO A;  4I4S A;  4I4X A;  3CU1 B;  4I37 A;  3BAV A;  1HIB A;  4EEE B;  4ZA3 B;  4EB2 B;  3H6Q A;  3V0B A;  4ZLB B;  3CA4 A;  4ZFU B;  1IRA X;  4ZFW B;  2BEB A;  3AH4 A;  1I1E A;  5EG6 C;  2R9K B;  1S0L A;  3T8S A;  3N7L A;  4I4Y A;  4A7K A;  1HWP B;  4PC4 A;  1IOB A;  4A7Y A;  3PHZ A;  3HMY A;  4LO1 C;  4QD2 C;  3R4U A;  4USP A;  4D8H A;  1IIL A;  1IT0 A;  1P63 A;  4I4P A;  1NZK A;  1SZ6 B;  2KI6 B;  3VT1 A;  3RMX A;  1PZZ A;  5I1B A;  2NVH A;  1XG6 A;  5D63 A;  3I29 B;  2QYI B;  4IZE A;  2Y9G A;  3V0B B;  3FJJ A;  2FDB M;  4P6A A;  1JT7 A;  5FNW A;  1ONK B;  1BLA A;  1RZO B;  1SR4 A;  4I4U A;  3P6I A;  3NBD A;  1V6V A;  4D0Z A;  2FO1 A;  4X39 A;  2KH2 A;  2AXM A;  4ZOT A;  4LO0 C;  1JT4 A;  3F62 B;  1V6W A;  1T9F A;  4XFS A;  4I1B A;  4ZGR B;  4IHZ A;  1E0O A;  3VWC A;  4UY4 A;  2XOA A;  3WMU A;  4USO A;  2D7R A;  2UUS A;  4G9N A;  3FFZ A;  1ISZ A;  1FMZ A;  1TOO A;  3AKF A;  4JPZ A;  1AVX B;  2D7I A;  2MIB A;  1HWM B;  1W3G A;  1RG8 A;  3UD7 A;  3ILA A;  2F8X C;  2Y9W C;  2HZ9 A;  4I4V A;  3FJK A;  2K43 A;  4I2S A;  1R8N A;  2RST A;  4ISQ A;  4KC3 A;  4Q9G A;  2ESU A;  2ZR1 B;  3BA4 A;  4G9M A;  5BXR A;  3CA1 A;  3BTA A;  5BXS A;  1DZC A;  2Z48 A;  3EF2 A;  3WMV A;  1KNM A;  3JRR A;  3BAH A;  2VXR A;  4IQP A;  5FZY A;  3H6S E;  3WIN A;  3FJC A;  41BI A;  3P6J A;  4QKS A;  3OBT A;  4I1E A;  4J2X A;  1ILR 1;  3S8K A;  1V6U A;  3FJB A;  3H6R B;  4OWK A;  3HN1 A;  1OQL B;  4G6M A;  3N7J A;  1BA7 A;  3RMY A;  1RY7 A;  5G00 A;  4G1R A;  4LO8 B;  4L4I A;  2KLL A;  2D20 A;  3UDA A;  5F8S A;  1WBC A;  4AN6 A;  2HW9 A;  4II0 A;  1G9B A;  3N7M A;  3AKH A;  3O5W B;  3OJV A;  3CRH A;  5DZU A;  1S0B A;  3UJ0 A;  2ZQN A;  1BAR A;  4LO1 A;  4OW4 A;  1BFB A;  4IYB A;  2WRY A;  1FV3 A;  4IY8 A;  3CA0 A;  1YYN A;  3AJ5 A;  4I7I A;  3AKG A;  3AH1 A;  2D23 A;  2VLC A;  2J3P A;  3OJ2 A;  4EFR A;  1DQO A;  3MPP G;  3FJH A;  3WIN C;  4GAF A;  3FJI A;  4JKQ A;  4OEF A;  3CA6 A;  3OGG A;  4LO0 A;  2D22 A;  4I3N A;  2M49 A;  4QD2 B;  1BAS A;  3R4S A;  3BAO A;  4QBV A;  1FMM S;  2MC2 A;  2GO2 A;  2RG9 B;  2IWT B;  5BXP A;  3PUB A;  4ISR A;  1S0E A;  2P39 A;  4MZF B;  4DEN A;  3AZV A;  3N0K A;  1IHK A;  3FJA A;  1DLL A;  2NP0 A;  3V0A B;  4Q91 A;  2VU9 A;  5D61 A;  1S0G A;  3O3Q A;  2ET2 A;  5BP5 A;  1BFC A;  5BQU A;  4GP3 A;  1PUM B;  3VSZ A;  1JTC A;  3P53 A;  3QR5 A;  1FQ9 A;  2YUG A;  3D7W B;  4DEP A;  4J2K A;  1Z0H A;  3A21 A;  1HWO B;  3FJ8 A;  1BFG A;  3C9Z A;  3AZW A;  21BI A;  2Q9X A;  1D0H A;  3IM7 A;  2X2T A;  1AVW B;  2VSE A;  1XZZ A;  3CAH A;  4I0Y A;  3O44 A;  2E4M A;  4A7Z A;  1HCE A;  4QAL A;  5BOW A;  1IJT A;  1DFQ A;  3A07 A;  2K4A B;  4ION A;  3S8J A;  3A23 A;  1ITB A;  3FJD A;  1N4K A;  1TFM B;  3CA3 A;  1QQK A;  2NZ9 A;  3O4O A;  1GGP B;  1ISW A;  1HKN A;  4FGF A;  3W9T A;  1J0S A;  3OJM A;  31BI A;  1S0D A;  1TP0 A;  1PUU B;  2FGF A;  3CQA A;  4DCK C;  5E24 E;  4I8M A;  5JMC A;  3BAG A;  1IRP A;  1CE7 B;  1QQL A;  5BP5 C;  5BQU C;  4CJM A;  5FZZ A;  4F34 A;  5DVH A;  4KEJ A;  1EVT A;  2VUA A;  3CA5 A;  1Q04 A;  2KI4 A;  3OGF A;  1Q1U A;  3O4A A;  4WBC A;  4I4R A;  1WBA A;  1G9A A;  3FUQ A;  1FWU A;  4IZX A;  3K1X A;  4GOY A;  4LO7 C;  4EKX B;  1EPW A;  1F31 A;  2DRZ A;  2NYY A;  5F8Y A;  2E4M C;  3BA7 A;  2D24 A;  4X37 A;  3RTJ B;  1TWE A;  1MD6 A;  3FJF A;  1II4 A;  1K5V A;  3IM5 A;  3O4D A;  3N7K A;  3O49 A;  4END A;  2Y9F A;  2D43 A;  2ERM A;  4G6J A;  5BVP I;  4I96 A;  4KEI A;  5EC5 A;  4XKI A;  2I1B A;  3PME A;  2AQZ A;  3FUO A;  3A22 A;  4KEK A;  7I1B A;  1AXM A;  4LO2 A;  2MLL B;  4GAI A;  1JT5 A;  3TC2 A;  4AN7 B;  3HSM A;  1WD3 A;  1VCL A;  4EFQ A;  3ZC8 A;  1DIW A;  1AF9 A;  3VT2 A;  4H04 A;  3BAQ A;  4F83 A;  3VEQ A;  4JKX B;  1G9C A;  1HWN B;  2ZQO A;  3SNV A;  1M16 A;  4QKR A;  3WO4 A;  3CRI A;  4P0J A;  2DRE A;  2L5X A;  2HWA A;  2HWM A;  1K5U A;  1Z2V A;  4H9W A;  2FFU A;  1JQZ A;  4QBC A;  1WD4 A;  1EYL A;  4OEE A;  1DZD A;  5F8W A;  2Q3N B;  1Z4S A;  1T4Q A;  3FGM A;  3NBN A;  1FGA A;  5GAQ A;  4JP0 A;  1YF8 B;  4J23 B;  4KBB A;  4QO3 A;  1TIE A;  3UD9 A;  4I6I A;  3ZXD A;  1DFC A;  1YBI A;  3PG0 A;  4YOL A;  3O4C A;  1W3F A;  3VSF A;  1Q03 A;  1UPS A;  1QXM A;  4LO2 C;  2QN4 A;  3HAL A;  4IY9 A;  1FV2 A;  3F1R A;  4P0K A;  1PC8 B;  2NS2 A;  4HA2 A;  1DJS B;  5DUY A;  5JLV A;  3RSJ A;  1EV2 A;  3ZC9 A;  1JY0 A;  3FJ9 A;  1ISX A;  3ZX7 A;  3BRG C;  3V79 C;  3I2X A;  3UJ4 A;  3WA1 A;  4R6U B;  3POK A;  4XFT A;  4H75 A;  1JT3 A;  3RTI B;  1M2T B;  1S0F A;  1DQG A;  3WO3 A;  3NBC A;  4D0T A;  1BFF A;  3VUO A;  1JLY A;  4JQ0 A;  1CVS A;  3QYD A;  2LIE A;  3AKI A;  5HPZ A;  1XHB A;  2D44 A;  3BX1 C;  3HBW A;  3O4B A;  5FNX A;  1G9D A;  3WO2 A;  6I1B A;  2VXT I;  4I4O A;  2KKI A;  3MAL A;  3NBE A;  1NUN A;  4LO7 B;  5B2H A;  1AVU A;  4JRA A;  2X2S A;  4QC4 A;  5F90 A;  4OEG A;  4LO3 A;  1ISY A;  4I4Q A;  1I1B A;  1BLD A;  3LTQ A;  2VSA A;  4ZKT B;  2BEA A;  2WBC A;  2DS0 A;  2IHO A;  4GP0 A;  1FN0 A;  3LLP A;  4GOV A;  4OWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...