3BB2A

Crystal structure of l26d/d28n mutant of human acidic fibroblast growth factor
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
141
structure length
141
Chain Sequence
b'HHHHFNLPPGNYKKPKLLYCSNGGHFLRIDPNGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 38
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3bb2A00
2MIBA 4QKRA 3WINC 1WD3A 4I96A 2RQ9A 3NBCA 2Y9GA 2NP0A 1K5VA 3O4BA 3D7WB 3FJDA 3HALA 1DQGA 3HOMA 2FDBM 1JT4A 5BP5A 2HW9A 4I1EA 4IYBA 1IT0A 1PZZA 2D22A 2E4MA 1BLAA 1A8DA 1M2TB 2K4AB 3JRRA 2AXMA 4EEEB 1TTUA 1DJSB 1BLDA 3BAGA 1I1EA 4PC4A 4H9WA 2F2FA 4LO7B 3AJ6A 4DEPA 3BRGC 5BXTA 4J2SA 3IM6A 1G9BA 3CRIA 1FV3A 2XOAA 3R4SA 3KMVA 1BARA 2X2SA 4WBCA 1OQLB 3N0KA 4FVVA 1IOBA 2Y9XE 4LO8B 1SR4A 1TWMA 1Q04A 2FFUA 1G9CA 4OWLA 1SZ6B 2DRZA 2NVHA 3OBRA 5FZYA 4OEFA 2QN4A 4J2YA 4QD2C 1BFCA 3ZC9A 4I4XA 3WO4A 4JPZA 4P6AA 2D23A 2NZ9A 4I7IA 4ZOTA 1ISVA 4JKXB 1GGPB 3VWCA 1IILA 7I1BA 1HWNB 5BQUC 3Q7XA 1G9DA 3CU1B 4ISRA 3AKHA 3ZC8A 1JTCA 4XFTA 2IWTB 4OEEA 2Q9XA 3NJ5A 4LO0C 5B2HA 3PUBA 5BOWA 1ISZA 4IQPA 3ZXDA 1BFFA 4QBVA 1BFBA 1YF8B 4AN6A 2M49A 2NTDA 3H6SE 2P39A 4DCKC 4OWKA 1JT3A 1V6VA 2KH2A 2GZBA 2HWMA 3UJ0A 1YXWA 4LO1A 4P0LA 4II0A 3AJ5A 3PG0A 1R8NA 3AKFA 3IM7A 3BA4A 1YTOA 1Z4SA 4ZGRB 5DSSB 1PUUB 4P0KA 5E24E 3A07A 4I4PA 4J23B 4I2SA 4Q91A 9ILBA 3H6RB 1AXMA 4A7YA 3OGGA 3R4UA 2VXRA 1AVAC 4HJJA 3O44A 4GP0A 4AN7B 3AH2A 1XG6A 1DQOA 4Z8SB 3ZX7A 41BIA 1XZZA 3BAHA 2YUGA 4X38A 4I8MA 1T4QA 1KNMA 3O4OA 3FGMA 3P53A 4GP3A 1IRAX 1DZDA 1NZKA 1ISWA 1W3GA 2F8XC 2Y9WC 1TP0A 5DUYA 5DVHA 1AVXB 4I4UA 1QXMA 2K8RA 4ENDA 2X2TA 4XKIA 3RTIB 3C9ZA 3TC2A 4GOVA 4LO3C 2WRYA 2ET2A 4DENA 3FFZA 3S8KA 2UUSA 3A22A 3O4DA 4ISQA 5DZUA 3A23A 2K43A 1I1BA 4QC4A 2ZQNA 1S0EA 1FMMS 3HBWA 2DS0A 5D63A 3IM5A 3WO2A 3BAQA 2QYIB 3VSZA 4IZXA 5F8WA 5BP5C 3CQAA 4KEIA 4EKXB 5BXRA 5D61A 5F90A 1DZCA 2Q3NB 2D1ZA 2E4MC 2KI6B 1V6WA 3O49A 3AKGA 1T9FA 3UD7A 3CRGA 3JUTA 3FUQA 3BAOA 3V0AB 1Z0HA 3CA6A 2F2FC 1JLYA 1AVUA 5FZUA 1BASA 1XYFA 4I4RA 3W9TA 5JMCA 3V79C 4IHZA 4F34A 4D0TA 1BFGA 3H6QA 3NBDA 1AF9A 3NBNA 4USOA 3S8JA 3BAVA 1S0FA 1FV2A 2RSTA 1ABRB 3HSMA 5EHAA 3VUOA 1SR4C 2ZR1B 4J2XA 4GAIA 4L4IA 4QO3A 1EVTA 1W3FA 2HZ9A 2ZQOA 3AKIA 3RMXA 4ZFWB 3VT2A 2D44A 4A7ZA 3OJVA 3BTAA 4I6IA 4KC3A 4ZLBB 3WO3A 4ZFUB 3Q7YA 3CA5A 1FMZA 1TOOA 3OGFA 4XFSA 2KI4A 1S0CA 4G6JA 1BA7A 3BRFA 2GO2A 4I37A 1R8OA 1MC9A 1ILR1 3FUOA 3E8LC 2BEBA 1PUMB 3FJKA 3BB2A 1FQ9A 2WBCA 4IZEA 4JP0A 1EYLA 4I4SA 3FJAA 3ILAA 1HWOB 4HA2A 5F8SA 31BIA 3CA0A 4I4QA 4Z9WB 4LO2A 1EV2A 4G9MA 1S0DA 2BEAA 4QBCA 4FGFA 2MLLB 2D7IA 5BXPA 1Q03A 2Z49A 3N7JA 1RY7A 3WINA 3CA4A 3FJEA 2FFVA 3P6IA 4LO1C 1HCEA 1NUNA 6I1BA 4HR6C 3F62B 3FJHA 3N7MA 3FJIA 2Z48A 3CRHA 1V6UA 1S0GA 3I29B 1Q1UA 3AH1A 3BX1C 3O5WB 5I1BA 3V0BA 1M16A 3RSJA 1TIEA 3HN1A 1HWPB 21BIA 4L4HA 3N7LA 3QYDA 3F1RA 8I1BA 4USPA 3SNVA 1Z2VA 2HWAA 3OJMA 4GOYA 1CVSA 1V6XA 4G9NA 3I2XA 4F83A 3WMUA 3ZXGA 1HIBA 3PMEA 2RG9B 4P0JA 4ZA3B 2P23A 1WD4A 1YBIA 2IHOA 1HCDA 2VLCA 1RMLA 5GAQA 4OEGA 4Q9PA 1MD6A 1S0BA 4OW4A 1DFQA 5EG6C 4H04A 3CA1A 3Q7WA 5G00A 1JQZA 3FJCA 4I4YA 2R9KB 4JQ0A 4EB2B 4ZFYB 4OWJA 1J0SA 1EPWA 4KBBA 2Y9FA 3CAHA 3POKA 5HPZA 2LIEA 5BXSA 2AQZA 3BA5A 4D8HA 4I3NA 1D0HA 4ZBVB 3IIRA 1FGAA 4OUJA 1PWAA 4X37A 3AZWA 4IY9A 3FJ9A 3O4CA 1II4A 2LIQA 3UDAA 1DLLA 3LLPA 2KKIA 3H6RA 1E0OA 5JLVA 3OJ2A 2VUAA 5BQUA 1IHKA 4G1RA 3BRDA 3RTJB 3A21A 3HMYA 2FGFA 2D20A 1N4KA 1IRPA 1UPSA 4D0ZA 1G9AA 4KEJA 1XHBA 2DREA 2VU9A 4Q9GA 2D43A 4CJMA 3O3QA 1TFMB 4QKSA 4YOLA 5BVPI 1TWEA 1YYNA 3FJ8A 1F31A 3QR5A 4LO0A 4JKQA 2L5XA 1WBCA 1P63A 3LTQA 5FNWA 4EFRA 1ISXA 5D62A 1VCLA 3VSFA 3WA1A 3RMYA 3V0BB 1WBAA 4TLPA 3UD9A 1ONKB 4ZKTB 2VXTI 1AVWB 1JY0A 3WMVA 4X39A 4J2KA 4QALA 2FO1A 2ERMA 2D7RA 1PC8B 3BAUA 4EFQA 2AAIB 1DIWA 1CE7B 1DFCA 1G82A 5EC5A 2J3PA 3NBEA 2D24A 4A7KA 1ISYA 2I1BA 3T8SA 1JLXA 1FWVA 3B9UA 3P6JA 4IY8A 3VT0A 1JT7A 3UJ4A 4R6UB 3AZVA 3IAGC 2BFHA 3FJFA 3O4AA 2NM1A 3I2AA 5F8YA 1IJTA 3MPPG 3FJBA 1FWUA 3AH4A 3VEQA 3UD8A 3PHZA 1S0LA 1QQLA 1FN0A 2DRYA 3CA3A 3N7KA 4G6MA 4KEKA 4GAFA 3BADA 3V0AA 4I1BA 4I0YA 1HKNA 4X3AA 4LO7C 3VT1A 1RZOB 1JT5A 2AFGA 3FJJA 4QD2B 3K1XA 1QQKA 3OBTA 5FZZA 1L2HA 3EF2A 3MALA 4XFUA 2MC2A 2KLLA 2NYYA 5FNXA 2VSEA 2ESUA 4LO2C 1K5UA 4EFPA 4I4OA 4IONA 1W3AA 1RG8A 4I4VA 1AFCA 2VSAA 4LO3A 1HWMB 3BA7A 4JAWA 4JRAA 1ITBA
chains in the Genus database with same CATH superfamily
2MIBA 4QKRA 3WINC 1WD3A 4I96A 2RQ9A 3NBCA 2Y9GA 2NP0A 1K5VA 3O4BA 3D7WB 3FJDA 3HALA 1DQGA 3HOMA 2FDBM 1JT4A 5BP5A 2HW9A 4I1EA 4IYBA 1IT0A 1PZZA 2D22A 2E4MA 1BLAA 1A8DA 1M2TB 2K4AB 3JRRA 2AXMA 4EEEB 1TTUA 1DJSB 1BLDA 3BAGA 1I1EA 4PC4A 4H9WA 2F2FA 4LO7B 3AJ6A 4DEPA 3BRGC 5BXTA 4J2SA 3IM6A 1G9BA 3CRIA 1FV3A 2XOAA 3R4SA 3KMVA 1BARA 2X2SA 4WBCA 1OQLB 3N0KA 4FVVA 1IOBA 2Y9XE 4LO8B 1SR4A 1TWMA 1Q04A 2FFUA 1G9CA 4OWLA 1SZ6B 2DRZA 2NVHA 3OBRA 5FZYA 4MZFB 4OEFA 2QN4A 4J2YA 4QD2C 1BFCA 3ZC9A 4I4XA 3WO4A 4JPZA 4P6AA 2D23A 2NZ9A 4I7IA 4ZOTA 1ISVA 4JKXB 1GGPB 3VWCA 1IILA 7I1BA 1HWNB 5BQUC 3Q7XA 1G9DA 3CU1B 4ISRA 3AKHA 3ZC8A 1JTCA 4XFTA 2IWTB 4OEEA 2Q9XA 3NJ5A 4LO0C 5B2HA 3PUBA 4UY4A 1ISZA 4IQPA 3ZXDA 5BOWA 1BFFA 4QBVA 1BFBA 1YF8B 4AN6A 2M49A 2NTDA 3H6SE 2P39A 4DCKC 4OWKA 1JT3A 1V6VA 2KH2A 2GZBA 2HWMA 3UJ0A 1YXWA 4LO1A 4P0LA 4II0A 3AJ5A 3PG0A 1R8NA 3AKFA 3IM7A 3BA4A 1YTOA 1Z4SA 4ZGRB 5DSSB 1PUUB 4P0KA 5E24E 3A07A 4I4PA 4J23B 4I2SA 4Q91A 9ILBA 3H6RB 1AXMA 4A7YA 3OGGA 3R4UA 2VXRA 1AVAC 4HJJA 3O44A 4GP0A 4AN7B 3AH2A 1XG6A 1DQOA 4Z8SB 3ZX7A 41BIA 1XZZA 3BAHA 2YUGA 4X38A 4I8MA 1T4QA 1KNMA 3O4OA 3FGMA 3P53A 4GP3A 1IRAX 1DZDA 1NZKA 1ISWA 1W3GA 2F8XC 2Y9WC 1TP0A 5DUYA 5DVHA 1AVXB 4I4UA 1QXMA 2K8RA 4ENDA 2X2TA 4XKIA 3RTIB 3C9ZA 3TC2A 4GOVA 4LO3C 2WRYA 2ET2A 4DENA 3FFZA 3S8KA 2UUSA 3A22A 3O4DA 4ISQA 5DZUA 3A23A 2K43A 1I1BA 4QC4A 2ZQNA 1S0EA 1FMMS 3HBWA 2DS0A 5D63A 3IM5A 3WO2A 3BAQA 2QYIB 3VSZA 4IZXA 5F8WA 5BP5C 3CQAA 4KEIA 4EKXB 5BXRA 5D61A 5F90A 1DZCA 2Q3NB 2D1ZA 2E4MC 2KI6B 1V6WA 3O49A 3AKGA 1T9FA 3UD7A 4H75A 3CRGA 3JUTA 3FUQA 3BAOA 3V0AB 1Z0HA 3CA6A 2F2FC 1JLYA 1AVUA 5FZUA 1BASA 1XYFA 4I4RA 3W9TA 5JMCA 3V79C 4IHZA 4F34A 4D0TA 1BFGA 3H6QA 3NBDA 1AF9A 3NBNA 4USOA 3S8JA 3BAVA 1S0FA 1FV2A 2RSTA 1ABRB 3HSMA 5EHAA 3VUOA 1SR4C 2ZR1B 4J2XA 4GAIA 4L4IA 4QO3A 1EVTA 1W3FA 2HZ9A 2ZQOA 3AKIA 3RMXA 4ZFWB 3VT2A 2D44A 4A7ZA 3OJVA 3BTAA 4I6IA 4KC3A 4ZLBB 3WO3A 4ZFUB 3Q7YA 3CA5A 1FMZA 1TOOA 3OGFA 4XFSA 4MZHA 2KI4A 1S0CA 4G6JA 1BA7A 3BRFA 2GO2A 4I37A 1R8OA 1MC9A 1ILR1 3FUOA 3E8LC 2BEBA 1PUMB 3FJKA 3BB2A 1FQ9A 2WBCA 4IZEA 4JP0A 1EYLA 4I4SA 3FJAA 3ILAA 1HWOB 4HA2A 5F8SA 31BIA 3CA0A 4I4QA 4Z9WB 4LO2A 1EV2A 4G9MA 1S0DA 2BEAA 4QBCA 4FGFA 2MLLB 2D7IA 5BXPA 1Q03A 2Z49A 3N7JA 1RY7A 3WINA 3CA4A 3FJEA 2FFVA 3P6IA 4LO1C 1HCEA 1NUNA 2NS2A 6I1BA 4HR6C 3F62B 3FJHA 3N7MA 3FJIA 2Z48A 3CRHA 1V6UA 1S0GA 3I29B 1Q1UA 3AH1A 3BX1C 3O5WB 5I1BA 3V0BA 1M16A 3RSJA 1TIEA 3HN1A 1HWPB 21BIA 4L4HA 3N7LA 3QYDA 3F1RA 8I1BA 4USPA 3SNVA 1Z2VA 2HWAA 3OJMA 4GOYA 1CVSA 1V6XA 4G9NA 3I2XA 4F83A 3WMUA 3ZXGA 1HIBA 3PMEA 2RG9B 4P0JA 4ZA3B 2P23A 1WD4A 1YBIA 2IHOA 1HCDA 2VLCA 1RMLA 5GAQA 4OEGA 4Q9PA 1MD6A 1S0BA 4OW4A 1DFQA 5EG6C 4H04A 3CA1A 3Q7WA 5G00A 1JQZA 3FJCA 4I4YA 2R9KB 4JQ0A 4EB2B 4ZFYB 4OWJA 1J0SA 1EPWA 4KBBA 2Y9FA 3CAHA 3POKA 5HPZA 2LIEA 5BXSA 2AQZA 3BA5A 4D8HA 4I3NA 1D0HA 4ZBVB 3IIRA 1FGAA 4OUJA 1PWAA 4X37A 3AZWA 4IY9A 3FJ9A 3O4CA 1II4A 2LIQA 4MZGB 3UDAA 1DLLA 3LLPA 2KKIA 3H6RA 1E0OA 5JLVA 3OJ2A 2VUAA 5BQUA 1IHKA 4G1RA 3BRDA 3RTJB 3A21A 3HMYA 2FGFA 2D20A 1N4KA 1IRPA 1UPSA 4D0ZA 1G9AA 4KEJA 1XHBA 2DREA 2VU9A 4Q9GA 2D43A 4CJMA 3O3QA 1TFMB 4QKSA 4YOLA 5BVPI 1TWEA 1YYNA 3FJ8A 1F31A 3QR5A 4LO0A 4JKQA 2L5XA 1WBCA 1P63A 3LTQA 5FNWA 4EFRA 1ISXA 5D62A 1VCLA 3VSFA 3WA1A 3RMYA 3V0BB 1WBAA 4TLPA 3UD9A 1ONKB 4ZKTB 2VXTI 1AVWB 1JY0A 3WMVA 4X39A 4J2KA 4QALA 2FO1A 2ERMA 2D7RA 1PC8B 3BAUA 4EFQA 2AAIB 1DIWA 1CE7B 1DFCA 1G82A 5EC5A 2J3PA 3NBEA 2D24A 4A7KA 1ISYA 2I1BA 3T8SA 1JLXA 1FWVA 3B9UA 3P6JA 4IY8A 3VT0A 1JT7A 3UJ4A 4R6UB 3AZVA 3IAGC 2BFHA 3FJFA 3O4AA 2NM1A 3I2AA 5F8YA 1IJTA 3MPPG 3FJBA 1FWUA 3AH4A 3VEQA 3UD8A 3PHZA 1S0LA 1QQLA 1FN0A 2DRYA 3CA3A 3N7KA 4G6MA 4KEKA 4GAFA 3BADA 3V0AA 4I1BA 4I0YA 1HKNA 4X3AA 4LO7C 3VT1A 1RZOB 1JT5A 2AFGA 3FJJA 4QD2B 3K1XA 1QQKA 3OBTA 5FZZA 1L2HA 3EF2A 3MALA 4XFUA 2MC2A 2KLLA 2NYYA 5FNXA 2VSEA 2ESUA 4LO2C 1K5UA 4EFPA 4I4OA 4IONA 1W3AA 1RG8A 4I4VA 1AFCA 2VSAA 4LO3A 1HWMB 3BA7A 4JAWA 4JRAA 1ITBA
chains in the Genus database with same CATH topology
2MIBA 4QKRA 3WINC 1WD3A 4I96A 2RQ9A 3NBCA 2Y9GA 2NP0A 1K5VA 3O4BA 3D7WB 3FJDA 3HALA 1DQGA 3HOMA 2FDBM 1JT4A 5BP5A 2HW9A 4I1EA 4IYBA 1IT0A 1PZZA 2D22A 2E4MA 1BLAA 1A8DA 1M2TB 2K4AB 3JRRA 2AXMA 4EEEB 1TTUA 1DJSB 1BLDA 3BAGA 1I1EA 4PC4A 4H9WA 2F2FA 4LO7B 3AJ6A 4DEPA 3BRGC 5BXTA 4J2SA 3IM6A 1G9BA 3CRIA 1FV3A 2XOAA 3R4SA 3KMVA 1BARA 2X2SA 4WBCA 1OQLB 3N0KA 4FVVA 1IOBA 2Y9XE 4LO8B 1SR4A 1TWMA 1Q04A 2FFUA 1G9CA 4OWLA 1SZ6B 2DRZA 2NVHA 3OBRA 5FZYA 4MZFB 4OEFA 2QN4A 4J2YA 4QD2C 1BFCA 3ZC9A 4I4XA 3WO4A 4JPZA 4P6AA 2D23A 2NZ9A 4I7IA 4ZOTA 1ISVA 4JKXB 1GGPB 3VWCA 1IILA 7I1BA 1HWNB 5BQUC 3Q7XA 1G9DA 3CU1B 4ISRA 3AKHA 3ZC8A 1JTCA 4XFTA 2IWTB 4OEEA 2Q9XA 3NJ5A 4LO0C 5B2HA 3PUBA 4UY4A 1ISZA 4IQPA 3ZXDA 5BOWA 1BFFA 4QBVA 1BFBA 1YF8B 4AN6A 2M49A 2NTDA 3H6SE 2P39A 4DCKC 4OWKA 1JT3A 1V6VA 2KH2A 2GZBA 2HWMA 3UJ0A 1YXWA 4LO1A 4P0LA 4II0A 3AJ5A 3PG0A 1R8NA 3AKFA 3IM7A 3BA4A 1YTOA 1Z4SA 4ZGRB 5DSSB 1PUUB 4P0KA 5E24E 3A07A 4I4PA 4J23B 4I2SA 4Q91A 9ILBA 3H6RB 1AXMA 4A7YA 3OGGA 3R4UA 2VXRA 1AVAC 4HJJA 3O44A 4GP0A 4AN7B 3AH2A 1XG6A 1DQOA 4Z8SB 3ZX7A 41BIA 1XZZA 3BAHA 2YUGA 4X38A 4I8MA 1T4QA 1KNMA 3O4OA 3FGMA 3P53A 4GP3A 1IRAX 1DZDA 1NZKA 1ISWA 1W3GA 2F8XC 2Y9WC 1TP0A 5DUYA 5DVHA 1AVXB 4I4UA 1QXMA 2K8RA 4ENDA 2X2TA 4XKIA 3RTIB 3C9ZA 3TC2A 4GOVA 4LO3C 2WRYA 2ET2A 4DENA 3FFZA 3S8KA 2UUSA 3A22A 3O4DA 4ISQA 5DZUA 3A23A 2K43A 1I1BA 4QC4A 2ZQNA 1S0EA 1FMMS 3HBWA 2DS0A 5D63A 3IM5A 3WO2A 3BAQA 2QYIB 3VSZA 4IZXA 5F8WA 5BP5C 3CQAA 4KEIA 4EKXB 5BXRA 5D61A 5F90A 1DZCA 2Q3NB 2D1ZA 2E4MC 2KI6B 1V6WA 3O49A 3AKGA 1T9FA 3UD7A 4H75A 3CRGA 3JUTA 3FUQA 3BAOA 3V0AB 1Z0HA 3CA6A 2F2FC 1JLYA 1AVUA 5FZUA 1BASA 1XYFA 4I4RA 3W9TA 5JMCA 3V79C 4IHZA 4F34A 4D0TA 1BFGA 3H6QA 3NBDA 1AF9A 3NBNA 4USOA 3S8JA 3BAVA 1S0FA 1FV2A 2RSTA 1ABRB 3HSMA 5EHAA 3VUOA 1SR4C 2ZR1B 4J2XA 4GAIA 4L4IA 4QO3A 1EVTA 1W3FA 2HZ9A 2ZQOA 3AKIA 3RMXA 4ZFWB 3VT2A 2D44A 4A7ZA 3OJVA 3BTAA 4I6IA 4KC3A 4ZLBB 3WO3A 4ZFUB 3Q7YA 3CA5A 1FMZA 1TOOA 3OGFA 4XFSA 4MZHA 2KI4A 1S0CA 4G6JA 1BA7A 3BRFA 2GO2A 4I37A 1R8OA 1MC9A 1ILR1 3FUOA 3E8LC 2BEBA 1PUMB 3FJKA 3BB2A 1FQ9A 2WBCA 4IZEA 4JP0A 1EYLA 4I4SA 3FJAA 3ILAA 1HWOB 4HA2A 5F8SA 31BIA 3CA0A 4I4QA 4Z9WB 4LO2A 1EV2A 4G9MA 1S0DA 2BEAA 4QBCA 4FGFA 2MLLB 2D7IA 5BXPA 1Q03A 2Z49A 3N7JA 1RY7A 3WINA 3CA4A 3FJEA 2FFVA 3P6IA 4LO1C 1HCEA 1NUNA 2NS2A 6I1BA 4HR6C 3F62B 3FJHA 3N7MA 3FJIA 2Z48A 3CRHA 1V6UA 1S0GA 3I29B 1Q1UA 3AH1A 3BX1C 3O5WB 5I1BA 3V0BA 1M16A 3RSJA 1TIEA 3HN1A 1HWPB 21BIA 4L4HA 3N7LA 3QYDA 3F1RA 8I1BA 4USPA 3SNVA 1Z2VA 2HWAA 3OJMA 4GOYA 1CVSA 1V6XA 4G9NA 3I2XA 4F83A 3WMUA 3ZXGA 1HIBA 3PMEA 2RG9B 4P0JA 4ZA3B 2P23A 1WD4A 1YBIA 2IHOA 1HCDA 2VLCA 1RMLA 5GAQA 4OEGA 4Q9PA 1MD6A 1S0BA 4OW4A 1DFQA 5EG6C 4H04A 3CA1A 3Q7WA 5G00A 1JQZA 3FJCA 4I4YA 2R9KB 4JQ0A 4EB2B 4ZFYB 4OWJA 1J0SA 1EPWA 4KBBA 2Y9FA 3CAHA 3POKA 5HPZA 2LIEA 5BXSA 2AQZA 3BA5A 4D8HA 4I3NA 1D0HA 4ZBVB 3IIRA 1FGAA 4OUJA 1PWAA 4X37A 3AZWA 4IY9A 3FJ9A 3O4CA 1II4A 2LIQA 4MZGB 3UDAA 1DLLA 3LLPA 2KKIA 3H6RA 1E0OA 5JLVA 3OJ2A 2VUAA 5BQUA 1IHKA 4G1RA 3BRDA 3RTJB 3A21A 3HMYA 2FGFA 2D20A 1N4KA 1IRPA 1UPSA 4D0ZA 1G9AA 4KEJA 1XHBA 2DREA 2VU9A 4Q9GA 2D43A 4CJMA 3O3QA 1TFMB 4QKSA 4YOLA 5BVPI 1TWEA 1YYNA 3FJ8A 1F31A 3QR5A 4LO0A 4JKQA 2L5XA 1WBCA 1P63A 3LTQA 5FNWA 4EFRA 1ISXA 5D62A 1VCLA 3VSFA 3WA1A 3RMYA 3V0BB 1WBAA 4TLPA 3UD9A 1ONKB 4ZKTB 2VXTI 1AVWB 1JY0A 3WMVA 4X39A 4J2KA 4QALA 2FO1A 2ERMA 2D7RA 1PC8B 3BAUA 4EFQA 2AAIB 1DIWA 1CE7B 1DFCA 1G82A 5EC5A 2J3PA 3NBEA 2D24A 4A7KA 1ISYA 2I1BA 3T8SA 1JLXA 1FWVA 3B9UA 3P6JA 4IY8A 3VT0A 1JT7A 3UJ4A 4R6UB 3AZVA 3IAGC 2BFHA 3FJFA 3O4AA 2NM1A 3I2AA 5F8YA 1IJTA 3MPPG 3FJBA 1FWUA 3AH4A 3VEQA 3UD8A 3PHZA 1S0LA 1QQLA 1FN0A 2DRYA 3CA3A 3N7KA 4G6MA 4KEKA 4GAFA 3BADA 3V0AA 4I1BA 4I0YA 1HKNA 4X3AA 4LO7C 3VT1A 1RZOB 1JT5A 2AFGA 3FJJA 4QD2B 3K1XA 1QQKA 3OBTA 5FZZA 1L2HA 3EF2A 3MALA 4XFUA 2MC2A 2KLLA 2NYYA 5FNXA 2VSEA 2ESUA 4LO2C 1K5UA 4EFPA 4I4OA 4IONA 1W3AA 1RG8A 4I4VA 1AFCA 2VSAA 4LO3A 1HWMB 3BA7A 4JAWA 4JRAA 1ITBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MIB A;  4QKR A;  3WIN C;  1WD3 A;  4I96 A;  2RQ9 A;  3NBC A;  2Y9G A;  2NP0 A;  1K5V A;  3O4B A;  3D7W B;  3FJD A;  3HAL A;  1DQG A;  3HOM A;  2FDB M;  1JT4 A;  5BP5 A;  2HW9 A;  4I1E A;  4IYB A;  1IT0 A;  1PZZ A;  2D22 A;  2E4M A;  1BLA A;  1A8D A;  1M2T B;  2K4A B;  3JRR A;  2AXM A;  4EEE B;  1TTU A;  1DJS B;  1BLD A;  3BAG A;  1I1E A;  4PC4 A;  4H9W A;  2F2F A;  4LO7 B;  3AJ6 A;  4DEP A;  3BRG C;  5BXT A;  4J2S A;  3IM6 A;  1G9B A;  3CRI A;  1FV3 A;  2XOA A;  3R4S A;  3KMV A;  1BAR A;  2X2S A;  4WBC A;  1OQL B;  3N0K A;  4FVV A;  1IOB A;  2Y9X E;  4LO8 B;  1SR4 A;  1TWM A;  1Q04 A;  2FFU A;  1G9C A;  4OWL A;  1SZ6 B;  2DRZ A;  2NVH A;  3OBR A;  5FZY A;  4OEF A;  2QN4 A;  4J2Y A;  4QD2 C;  1BFC A;  3ZC9 A;  4I4X A;  3WO4 A;  4JPZ A;  4P6A A;  2D23 A;  2NZ9 A;  4I7I A;  4ZOT A;  1ISV A;  4JKX B;  1GGP B;  3VWC A;  1IIL A;  7I1B A;  1HWN B;  5BQU C;  3Q7X A;  1G9D A;  3CU1 B;  4ISR A;  3AKH A;  3ZC8 A;  1JTC A;  4XFT A;  2IWT B;  4OEE A;  2Q9X A;  3NJ5 A;  4LO0 C;  5B2H A;  3PUB A;  5BOW A;  1ISZ A;  4IQP A;  3ZXD A;  1BFF A;  4QBV A;  1BFB A;  1YF8 B;  4AN6 A;  2M49 A;  2NTD A;  3H6S E;  2P39 A;  4DCK C;  4OWK A;  1JT3 A;  1V6V A;  2KH2 A;  2GZB A;  2HWM A;  3UJ0 A;  1YXW A;  4LO1 A;  4P0L A;  4II0 A;  3AJ5 A;  3PG0 A;  1R8N A;  3AKF A;  3IM7 A;  3BA4 A;  1YTO A;  1Z4S A;  4ZGR B;  5DSS B;  1PUU B;  4P0K A;  5E24 E;  3A07 A;  4I4P A;  4J23 B;  4I2S A;  4Q91 A;  9ILB A;  3H6R B;  1AXM A;  4A7Y A;  3OGG A;  3R4U A;  2VXR A;  1AVA C;  4HJJ A;  3O44 A;  4GP0 A;  4AN7 B;  3AH2 A;  1XG6 A;  1DQO A;  4Z8S B;  3ZX7 A;  41BI A;  1XZZ A;  3BAH A;  2YUG A;  4X38 A;  4I8M A;  1T4Q A;  1KNM A;  3O4O A;  3FGM A;  3P53 A;  4GP3 A;  1IRA X;  1DZD A;  1NZK A;  1ISW A;  1W3G A;  2F8X C;  2Y9W C;  1TP0 A;  5DUY A;  5DVH A;  1AVX B;  4I4U A;  1QXM A;  2K8R A;  4END A;  2X2T A;  4XKI A;  3RTI B;  3C9Z A;  3TC2 A;  4GOV A;  4LO3 C;  2WRY A;  2ET2 A;  4DEN A;  3FFZ A;  3S8K A;  2UUS A;  3A22 A;  3O4D A;  4ISQ A;  5DZU A;  3A23 A;  2K43 A;  1I1B A;  4QC4 A;  2ZQN A;  1S0E A;  1FMM S;  3HBW A;  2DS0 A;  5D63 A;  3IM5 A;  3WO2 A;  3BAQ A;  2QYI B;  3VSZ A;  4IZX A;  5F8W A;  5BP5 C;  3CQA A;  4KEI A;  4EKX B;  5BXR A;  5D61 A;  5F90 A;  1DZC A;  2Q3N B;  2D1Z A;  2E4M C;  2KI6 B;  1V6W A;  3O49 A;  3AKG A;  1T9F A;  3UD7 A;  3CRG A;  3JUT A;  3FUQ A;  3BAO A;  3V0A B;  1Z0H A;  3CA6 A;  2F2F C;  1JLY A;  1AVU A;  5FZU A;  1BAS A;  1XYF A;  4I4R A;  3W9T A;  5JMC A;  3V79 C;  4IHZ A;  4F34 A;  4D0T A;  1BFG A;  3H6Q A;  3NBD A;  1AF9 A;  3NBN A;  4USO A;  3S8J A;  3BAV A;  1S0F A;  1FV2 A;  2RST A;  1ABR B;  3HSM A;  5EHA A;  3VUO A;  1SR4 C;  2ZR1 B;  4J2X A;  4GAI A;  4L4I A;  4QO3 A;  1EVT A;  1W3F A;  2HZ9 A;  2ZQO A;  3AKI A;  3RMX A;  4ZFW B;  3VT2 A;  2D44 A;  4A7Z A;  3OJV A;  3BTA A;  4I6I A;  4KC3 A;  4ZLB B;  3WO3 A;  4ZFU B;  3Q7Y A;  3CA5 A;  1FMZ A;  1TOO A;  3OGF A;  4XFS A;  2KI4 A;  1S0C A;  4G6J A;  1BA7 A;  3BRF A;  2GO2 A;  4I37 A;  1R8O A;  1MC9 A;  1ILR 1;  3FUO A;  3E8L C;  2BEB A;  1PUM B;  3FJK A;  3BB2 A;  1FQ9 A;  2WBC A;  4IZE A;  4JP0 A;  1EYL A;  4I4S A;  3FJA A;  3ILA A;  1HWO B;  4HA2 A;  5F8S A;  31BI A;  3CA0 A;  4I4Q A;  4Z9W B;  4LO2 A;  1EV2 A;  4G9M A;  1S0D A;  2BEA A;  4QBC A;  4FGF A;  2MLL B;  2D7I A;  5BXP A;  1Q03 A;  2Z49 A;  3N7J A;  1RY7 A;  3WIN A;  3CA4 A;  3FJE A;  2FFV A;  3P6I A;  4LO1 C;  1HCE A;  1NUN A;  6I1B A;  4HR6 C;  3F62 B;  3FJH A;  3N7M A;  3FJI A;  2Z48 A;  3CRH A;  1V6U A;  1S0G A;  3I29 B;  1Q1U A;  3AH1 A;  3BX1 C;  3O5W B;  5I1B A;  3V0B A;  1M16 A;  3RSJ A;  1TIE A;  3HN1 A;  1HWP B;  21BI A;  4L4H A;  3N7L A;  3QYD A;  3F1R A;  8I1B A;  4USP A;  3SNV A;  1Z2V A;  2HWA A;  3OJM A;  4GOY A;  1CVS A;  1V6X A;  4G9N A;  3I2X A;  4F83 A;  3WMU A;  3ZXG A;  1HIB A;  3PME A;  2RG9 B;  4P0J A;  4ZA3 B;  2P23 A;  1WD4 A;  1YBI A;  2IHO A;  1HCD A;  2VLC A;  1RML A;  5GAQ A;  4OEG A;  4Q9P A;  1MD6 A;  1S0B A;  4OW4 A;  1DFQ A;  5EG6 C;  4H04 A;  3CA1 A;  3Q7W A;  5G00 A;  1JQZ A;  3FJC A;  4I4Y A;  2R9K B;  4JQ0 A;  4EB2 B;  4ZFY B;  4OWJ A;  1J0S A;  1EPW A;  4KBB A;  2Y9F A;  3CAH A;  3POK A;  5HPZ A;  2LIE A;  5BXS A;  2AQZ A;  3BA5 A;  4D8H A;  4I3N A;  1D0H A;  4ZBV B;  3IIR A;  1FGA A;  4OUJ A;  1PWA A;  4X37 A;  3AZW A;  4IY9 A;  3FJ9 A;  3O4C A;  1II4 A;  2LIQ A;  3UDA A;  1DLL A;  3LLP A;  2KKI A;  3H6R A;  1E0O A;  5JLV A;  3OJ2 A;  2VUA A;  5BQU A;  1IHK A;  4G1R A;  3BRD A;  3RTJ B;  3A21 A;  3HMY A;  2FGF A;  2D20 A;  1N4K A;  1IRP A;  1UPS A;  4D0Z A;  1G9A A;  4KEJ A;  1XHB A;  2DRE A;  2VU9 A;  4Q9G A;  2D43 A;  4CJM A;  3O3Q A;  1TFM B;  4QKS A;  4YOL A;  5BVP I;  1TWE A;  1YYN A;  3FJ8 A;  1F31 A;  3QR5 A;  4LO0 A;  4JKQ A;  2L5X A;  1WBC A;  1P63 A;  3LTQ A;  5FNW A;  4EFR A;  1ISX A;  5D62 A;  1VCL A;  3VSF A;  3WA1 A;  3RMY A;  3V0B B;  1WBA A;  4TLP A;  3UD9 A;  1ONK B;  4ZKT B;  2VXT I;  1AVW B;  1JY0 A;  3WMV A;  4X39 A;  4J2K A;  4QAL A;  2FO1 A;  2ERM A;  2D7R A;  1PC8 B;  3BAU A;  4EFQ A;  2AAI B;  1DIW A;  1CE7 B;  1DFC A;  1G82 A;  5EC5 A;  2J3P A;  3NBE A;  2D24 A;  4A7K A;  1ISY A;  2I1B A;  3T8S A;  1JLX A;  1FWV A;  3B9U A;  3P6J A;  4IY8 A;  3VT0 A;  1JT7 A;  3UJ4 A;  4R6U B;  3AZV A;  3IAG C;  2BFH A;  3FJF A;  3O4A A;  2NM1 A;  3I2A A;  5F8Y A;  1IJT A;  3MPP G;  3FJB A;  1FWU A;  3AH4 A;  3VEQ A;  3UD8 A;  3PHZ A;  1S0L A;  1QQL A;  1FN0 A;  2DRY A;  3CA3 A;  3N7K A;  4G6M A;  4KEK A;  4GAF A;  3BAD A;  3V0A A;  4I1B A;  4I0Y A;  1HKN A;  4X3A A;  4LO7 C;  3VT1 A;  1RZO B;  1JT5 A;  2AFG A;  3FJJ A;  4QD2 B;  3K1X A;  1QQK A;  3OBT A;  5FZZ A;  1L2H A;  3EF2 A;  3MAL A;  4XFU A;  2MC2 A;  2KLL A;  2NYY A;  5FNX A;  2VSE A;  2ESU A;  4LO2 C;  1K5U A;  4EFP A;  4I4O A;  4ION A;  1W3A A;  1RG8 A;  4I4V A;  1AFC A;  2VSA A;  4LO3 A;  1HWM B;  3BA7 A;  4JAW A;  4JRA A;  1ITB A; 
#chains in the Genus database with same CATH topology
 2MIB A;  4QKR A;  3WIN C;  1WD3 A;  4I96 A;  2RQ9 A;  3NBC A;  2Y9G A;  2NP0 A;  1K5V A;  3O4B A;  3D7W B;  3FJD A;  3HAL A;  1DQG A;  3HOM A;  2FDB M;  1JT4 A;  5BP5 A;  2HW9 A;  4I1E A;  4IYB A;  1IT0 A;  1PZZ A;  2D22 A;  2E4M A;  1BLA A;  1A8D A;  1M2T B;  2K4A B;  3JRR A;  2AXM A;  4EEE B;  1TTU A;  1DJS B;  1BLD A;  3BAG A;  1I1E A;  4PC4 A;  4H9W A;  2F2F A;  4LO7 B;  3AJ6 A;  4DEP A;  3BRG C;  5BXT A;  4J2S A;  3IM6 A;  1G9B A;  3CRI A;  1FV3 A;  2XOA A;  3R4S A;  3KMV A;  1BAR A;  2X2S A;  4WBC A;  1OQL B;  3N0K A;  4FVV A;  1IOB A;  2Y9X E;  4LO8 B;  1SR4 A;  1TWM A;  1Q04 A;  2FFU A;  1G9C A;  4OWL A;  1SZ6 B;  2DRZ A;  2NVH A;  3OBR A;  5FZY A;  4MZF B;  4OEF A;  2QN4 A;  4J2Y A;  4QD2 C;  1BFC A;  3ZC9 A;  4I4X A;  3WO4 A;  4JPZ A;  4P6A A;  2D23 A;  2NZ9 A;  4I7I A;  4ZOT A;  1ISV A;  4JKX B;  1GGP B;  3VWC A;  1IIL A;  7I1B A;  1HWN B;  5BQU C;  3Q7X A;  1G9D A;  3CU1 B;  4ISR A;  3AKH A;  3ZC8 A;  1JTC A;  4XFT A;  2IWT B;  4OEE A;  2Q9X A;  3NJ5 A;  4LO0 C;  5B2H A;  3PUB A;  4UY4 A;  1ISZ A;  4IQP A;  3ZXD A;  5BOW A;  1BFF A;  4QBV A;  1BFB A;  1YF8 B;  4AN6 A;  2M49 A;  2NTD A;  3H6S E;  2P39 A;  4DCK C;  4OWK A;  1JT3 A;  1V6V A;  2KH2 A;  2GZB A;  2HWM A;  3UJ0 A;  1YXW A;  4LO1 A;  4P0L A;  4II0 A;  3AJ5 A;  3PG0 A;  1R8N A;  3AKF A;  3IM7 A;  3BA4 A;  1YTO A;  1Z4S A;  4ZGR B;  5DSS B;  1PUU B;  4P0K A;  5E24 E;  3A07 A;  4I4P A;  4J23 B;  4I2S A;  4Q91 A;  9ILB A;  3H6R B;  1AXM A;  4A7Y A;  3OGG A;  3R4U A;  2VXR A;  1AVA C;  4HJJ A;  3O44 A;  4GP0 A;  4AN7 B;  3AH2 A;  1XG6 A;  1DQO A;  4Z8S B;  3ZX7 A;  41BI A;  1XZZ A;  3BAH A;  2YUG A;  4X38 A;  4I8M A;  1T4Q A;  1KNM A;  3O4O A;  3FGM A;  3P53 A;  4GP3 A;  1IRA X;  1DZD A;  1NZK A;  1ISW A;  1W3G A;  2F8X C;  2Y9W C;  1TP0 A;  5DUY A;  5DVH A;  1AVX B;  4I4U A;  1QXM A;  2K8R A;  4END A;  2X2T A;  4XKI A;  3RTI B;  3C9Z A;  3TC2 A;  4GOV A;  4LO3 C;  2WRY A;  2ET2 A;  4DEN A;  3FFZ A;  3S8K A;  2UUS A;  3A22 A;  3O4D A;  4ISQ A;  5DZU A;  3A23 A;  2K43 A;  1I1B A;  4QC4 A;  2ZQN A;  1S0E A;  1FMM S;  3HBW A;  2DS0 A;  5D63 A;  3IM5 A;  3WO2 A;  3BAQ A;  2QYI B;  3VSZ A;  4IZX A;  5F8W A;  5BP5 C;  3CQA A;  4KEI A;  4EKX B;  5BXR A;  5D61 A;  5F90 A;  1DZC A;  2Q3N B;  2D1Z A;  2E4M C;  2KI6 B;  1V6W A;  3O49 A;  3AKG A;  1T9F A;  3UD7 A;  4H75 A;  3CRG A;  3JUT A;  3FUQ A;  3BAO A;  3V0A B;  1Z0H A;  3CA6 A;  2F2F C;  1JLY A;  1AVU A;  5FZU A;  1BAS A;  1XYF A;  4I4R A;  3W9T A;  5JMC A;  3V79 C;  4IHZ A;  4F34 A;  4D0T A;  1BFG A;  3H6Q A;  3NBD A;  1AF9 A;  3NBN A;  4USO A;  3S8J A;  3BAV A;  1S0F A;  1FV2 A;  2RST A;  1ABR B;  3HSM A;  5EHA A;  3VUO A;  1SR4 C;  2ZR1 B;  4J2X A;  4GAI A;  4L4I A;  4QO3 A;  1EVT A;  1W3F A;  2HZ9 A;  2ZQO A;  3AKI A;  3RMX A;  4ZFW B;  3VT2 A;  2D44 A;  4A7Z A;  3OJV A;  3BTA A;  4I6I A;  4KC3 A;  4ZLB B;  3WO3 A;  4ZFU B;  3Q7Y A;  3CA5 A;  1FMZ A;  1TOO A;  3OGF A;  4XFS A;  4MZH A;  2KI4 A;  1S0C A;  4G6J A;  1BA7 A;  3BRF A;  2GO2 A;  4I37 A;  1R8O A;  1MC9 A;  1ILR 1;  3FUO A;  3E8L C;  2BEB A;  1PUM B;  3FJK A;  3BB2 A;  1FQ9 A;  2WBC A;  4IZE A;  4JP0 A;  1EYL A;  4I4S A;  3FJA A;  3ILA A;  1HWO B;  4HA2 A;  5F8S A;  31BI A;  3CA0 A;  4I4Q A;  4Z9W B;  4LO2 A;  1EV2 A;  4G9M A;  1S0D A;  2BEA A;  4QBC A;  4FGF A;  2MLL B;  2D7I A;  5BXP A;  1Q03 A;  2Z49 A;  3N7J A;  1RY7 A;  3WIN A;  3CA4 A;  3FJE A;  2FFV A;  3P6I A;  4LO1 C;  1HCE A;  1NUN A;  2NS2 A;  6I1B A;  4HR6 C;  3F62 B;  3FJH A;  3N7M A;  3FJI A;  2Z48 A;  3CRH A;  1V6U A;  1S0G A;  3I29 B;  1Q1U A;  3AH1 A;  3BX1 C;  3O5W B;  5I1B A;  3V0B A;  1M16 A;  3RSJ A;  1TIE A;  3HN1 A;  1HWP B;  21BI A;  4L4H A;  3N7L A;  3QYD A;  3F1R A;  8I1B A;  4USP A;  3SNV A;  1Z2V A;  2HWA A;  3OJM A;  4GOY A;  1CVS A;  1V6X A;  4G9N A;  3I2X A;  4F83 A;  3WMU A;  3ZXG A;  1HIB A;  3PME A;  2RG9 B;  4P0J A;  4ZA3 B;  2P23 A;  1WD4 A;  1YBI A;  2IHO A;  1HCD A;  2VLC A;  1RML A;  5GAQ A;  4OEG A;  4Q9P A;  1MD6 A;  1S0B A;  4OW4 A;  1DFQ A;  5EG6 C;  4H04 A;  3CA1 A;  3Q7W A;  5G00 A;  1JQZ A;  3FJC A;  4I4Y A;  2R9K B;  4JQ0 A;  4EB2 B;  4ZFY B;  4OWJ A;  1J0S A;  1EPW A;  4KBB A;  2Y9F A;  3CAH A;  3POK A;  5HPZ A;  2LIE A;  5BXS A;  2AQZ A;  3BA5 A;  4D8H A;  4I3N A;  1D0H A;  4ZBV B;  3IIR A;  1FGA A;  4OUJ A;  1PWA A;  4X37 A;  3AZW A;  4IY9 A;  3FJ9 A;  3O4C A;  1II4 A;  2LIQ A;  4MZG B;  3UDA A;  1DLL A;  3LLP A;  2KKI A;  3H6R A;  1E0O A;  5JLV A;  3OJ2 A;  2VUA A;  5BQU A;  1IHK A;  4G1R A;  3BRD A;  3RTJ B;  3A21 A;  3HMY A;  2FGF A;  2D20 A;  1N4K A;  1IRP A;  1UPS A;  4D0Z A;  1G9A A;  4KEJ A;  1XHB A;  2DRE A;  2VU9 A;  4Q9G A;  2D43 A;  4CJM A;  3O3Q A;  1TFM B;  4QKS A;  4YOL A;  5BVP I;  1TWE A;  1YYN A;  3FJ8 A;  1F31 A;  3QR5 A;  4LO0 A;  4JKQ A;  2L5X A;  1WBC A;  1P63 A;  3LTQ A;  5FNW A;  4EFR A;  1ISX A;  5D62 A;  1VCL A;  3VSF A;  3WA1 A;  3RMY A;  3V0B B;  1WBA A;  4TLP A;  3UD9 A;  1ONK B;  4ZKT B;  2VXT I;  1AVW B;  1JY0 A;  3WMV A;  4X39 A;  4J2K A;  4QAL A;  2FO1 A;  2ERM A;  2D7R A;  1PC8 B;  3BAU A;  4EFQ A;  2AAI B;  1DIW A;  1CE7 B;  1DFC A;  1G82 A;  5EC5 A;  2J3P A;  3NBE A;  2D24 A;  4A7K A;  1ISY A;  2I1B A;  3T8S A;  1JLX A;  1FWV A;  3B9U A;  3P6J A;  4IY8 A;  3VT0 A;  1JT7 A;  3UJ4 A;  4R6U B;  3AZV A;  3IAG C;  2BFH A;  3FJF A;  3O4A A;  2NM1 A;  3I2A A;  5F8Y A;  1IJT A;  3MPP G;  3FJB A;  1FWU A;  3AH4 A;  3VEQ A;  3UD8 A;  3PHZ A;  1S0L A;  1QQL A;  1FN0 A;  2DRY A;  3CA3 A;  3N7K A;  4G6M A;  4KEK A;  4GAF A;  3BAD A;  3V0A A;  4I1B A;  4I0Y A;  1HKN A;  4X3A A;  4LO7 C;  3VT1 A;  1RZO B;  1JT5 A;  2AFG A;  3FJJ A;  4QD2 B;  3K1X A;  1QQK A;  3OBT A;  5FZZ A;  1L2H A;  3EF2 A;  3MAL A;  4XFU A;  2MC2 A;  2KLL A;  2NYY A;  5FNX A;  2VSE A;  2ESU A;  4LO2 C;  1K5U A;  4EFP A;  4I4O A;  4ION A;  1W3A A;  1RG8 A;  4I4V A;  1AFC A;  2VSA A;  4LO3 A;  1HWM B;  3BA7 A;  4JAW A;  4JRA A;  1ITB A; 
#chains in the Genus database with same CATH homology
 2MIB A;  4QKR A;  3WIN C;  1WD3 A;  4I96 A;  2RQ9 A;  3NBC A;  2Y9G A;  2NP0 A;  1K5V A;  3O4B A;  3D7W B;  3FJD A;  3HAL A;  1DQG A;  3HOM A;  2FDB M;  1JT4 A;  5BP5 A;  2HW9 A;  4I1E A;  4IYB A;  1IT0 A;  1PZZ A;  2D22 A;  2E4M A;  1BLA A;  1A8D A;  1M2T B;  2K4A B;  3JRR A;  2AXM A;  4EEE B;  1TTU A;  1DJS B;  1BLD A;  3BAG A;  1I1E A;  4PC4 A;  4H9W A;  2F2F A;  4LO7 B;  3AJ6 A;  4DEP A;  3BRG C;  5BXT A;  4J2S A;  3IM6 A;  1G9B A;  3CRI A;  1FV3 A;  2XOA A;  3R4S A;  3KMV A;  1BAR A;  2X2S A;  4WBC A;  1OQL B;  3N0K A;  4FVV A;  1IOB A;  2Y9X E;  4LO8 B;  1SR4 A;  1TWM A;  1Q04 A;  2FFU A;  1G9C A;  4OWL A;  1SZ6 B;  2DRZ A;  2NVH A;  3OBR A;  5FZY A;  4MZF B;  4OEF A;  2QN4 A;  4J2Y A;  4QD2 C;  1BFC A;  3ZC9 A;  4I4X A;  3WO4 A;  4JPZ A;  4P6A A;  2D23 A;  2NZ9 A;  4I7I A;  4ZOT A;  1ISV A;  4JKX B;  1GGP B;  3VWC A;  1IIL A;  7I1B A;  1HWN B;  5BQU C;  3Q7X A;  1G9D A;  3CU1 B;  4ISR A;  3AKH A;  3ZC8 A;  1JTC A;  4XFT A;  2IWT B;  4OEE A;  2Q9X A;  3NJ5 A;  4LO0 C;  5B2H A;  3PUB A;  4UY4 A;  1ISZ A;  4IQP A;  3ZXD A;  5BOW A;  1BFF A;  4QBV A;  1BFB A;  1YF8 B;  4AN6 A;  2M49 A;  2NTD A;  3H6S E;  2P39 A;  4DCK C;  4OWK A;  1JT3 A;  1V6V A;  2KH2 A;  2GZB A;  2HWM A;  3UJ0 A;  1YXW A;  4LO1 A;  4P0L A;  4II0 A;  3AJ5 A;  3PG0 A;  1R8N A;  3AKF A;  3IM7 A;  3BA4 A;  1YTO A;  1Z4S A;  4ZGR B;  5DSS B;  1PUU B;  4P0K A;  5E24 E;  3A07 A;  4I4P A;  4J23 B;  4I2S A;  4Q91 A;  9ILB A;  3H6R B;  1AXM A;  4A7Y A;  3OGG A;  3R4U A;  2VXR A;  1AVA C;  4HJJ A;  3O44 A;  4GP0 A;  4AN7 B;  3AH2 A;  1XG6 A;  1DQO A;  4Z8S B;  3ZX7 A;  41BI A;  1XZZ A;  3BAH A;  2YUG A;  4X38 A;  4I8M A;  1T4Q A;  1KNM A;  3O4O A;  3FGM A;  3P53 A;  4GP3 A;  1IRA X;  1DZD A;  1NZK A;  1ISW A;  1W3G A;  2F8X C;  2Y9W C;  1TP0 A;  5DUY A;  5DVH A;  1AVX B;  4I4U A;  1QXM A;  2K8R A;  4END A;  2X2T A;  4XKI A;  3RTI B;  3C9Z A;  3TC2 A;  4GOV A;  4LO3 C;  2WRY A;  2ET2 A;  4DEN A;  3FFZ A;  3S8K A;  2UUS A;  3A22 A;  3O4D A;  4ISQ A;  5DZU A;  3A23 A;  2K43 A;  1I1B A;  4QC4 A;  2ZQN A;  1S0E A;  1FMM S;  3HBW A;  2DS0 A;  5D63 A;  3IM5 A;  3WO2 A;  3BAQ A;  2QYI B;  3VSZ A;  4IZX A;  5F8W A;  5BP5 C;  3CQA A;  4KEI A;  4EKX B;  5BXR A;  5D61 A;  5F90 A;  1DZC A;  2Q3N B;  2D1Z A;  2E4M C;  2KI6 B;  1V6W A;  3O49 A;  3AKG A;  1T9F A;  3UD7 A;  4H75 A;  3CRG A;  3JUT A;  3FUQ A;  3BAO A;  3V0A B;  1Z0H A;  3CA6 A;  2F2F C;  1JLY A;  1AVU A;  5FZU A;  1BAS A;  1XYF A;  4I4R A;  3W9T A;  5JMC A;  3V79 C;  4IHZ A;  4F34 A;  4D0T A;  1BFG A;  3H6Q A;  3NBD A;  1AF9 A;  3NBN A;  4USO A;  3S8J A;  3BAV A;  1S0F A;  1FV2 A;  2RST A;  1ABR B;  3HSM A;  5EHA A;  3VUO A;  1SR4 C;  2ZR1 B;  4J2X A;  4GAI A;  4L4I A;  4QO3 A;  1EVT A;  1W3F A;  2HZ9 A;  2ZQO A;  3AKI A;  3RMX A;  4ZFW B;  3VT2 A;  2D44 A;  4A7Z A;  3OJV A;  3BTA A;  4I6I A;  4KC3 A;  4ZLB B;  3WO3 A;  4ZFU B;  3Q7Y A;  3CA5 A;  1FMZ A;  1TOO A;  3OGF A;  4XFS A;  4MZH A;  2KI4 A;  1S0C A;  4G6J A;  1BA7 A;  3BRF A;  2GO2 A;  4I37 A;  1R8O A;  1MC9 A;  1ILR 1;  3FUO A;  3E8L C;  2BEB A;  1PUM B;  3FJK A;  3BB2 A;  1FQ9 A;  2WBC A;  4IZE A;  4JP0 A;  1EYL A;  4I4S A;  3FJA A;  3ILA A;  1HWO B;  4HA2 A;  5F8S A;  31BI A;  3CA0 A;  4I4Q A;  4Z9W B;  4LO2 A;  1EV2 A;  4G9M A;  1S0D A;  2BEA A;  4QBC A;  4FGF A;  2MLL B;  2D7I A;  5BXP A;  1Q03 A;  2Z49 A;  3N7J A;  1RY7 A;  3WIN A;  3CA4 A;  3FJE A;  2FFV A;  3P6I A;  4LO1 C;  1HCE A;  1NUN A;  2NS2 A;  6I1B A;  4HR6 C;  3F62 B;  3FJH A;  3N7M A;  3FJI A;  2Z48 A;  3CRH A;  1V6U A;  1S0G A;  3I29 B;  1Q1U A;  3AH1 A;  3BX1 C;  3O5W B;  5I1B A;  3V0B A;  1M16 A;  3RSJ A;  1TIE A;  3HN1 A;  1HWP B;  21BI A;  4L4H A;  3N7L A;  3QYD A;  3F1R A;  8I1B A;  4USP A;  3SNV A;  1Z2V A;  2HWA A;  3OJM A;  4GOY A;  1CVS A;  1V6X A;  4G9N A;  3I2X A;  4F83 A;  3WMU A;  3ZXG A;  1HIB A;  3PME A;  2RG9 B;  4P0J A;  4ZA3 B;  2P23 A;  1WD4 A;  1YBI A;  2IHO A;  1HCD A;  2VLC A;  1RML A;  5GAQ A;  4OEG A;  4Q9P A;  1MD6 A;  1S0B A;  4OW4 A;  1DFQ A;  5EG6 C;  4H04 A;  3CA1 A;  3Q7W A;  5G00 A;  1JQZ A;  3FJC A;  4I4Y A;  2R9K B;  4JQ0 A;  4EB2 B;  4ZFY B;  4OWJ A;  1J0S A;  1EPW A;  4KBB A;  2Y9F A;  3CAH A;  3POK A;  5HPZ A;  2LIE A;  5BXS A;  2AQZ A;  3BA5 A;  4D8H A;  4I3N A;  1D0H A;  4ZBV B;  3IIR A;  1FGA A;  4OUJ A;  1PWA A;  4X37 A;  3AZW A;  4IY9 A;  3FJ9 A;  3O4C A;  1II4 A;  2LIQ A;  4MZG B;  3UDA A;  1DLL A;  3LLP A;  2KKI A;  3H6R A;  1E0O A;  5JLV A;  3OJ2 A;  2VUA A;  5BQU A;  1IHK A;  4G1R A;  3BRD A;  3RTJ B;  3A21 A;  3HMY A;  2FGF A;  2D20 A;  1N4K A;  1IRP A;  1UPS A;  4D0Z A;  1G9A A;  4KEJ A;  1XHB A;  2DRE A;  2VU9 A;  4Q9G A;  2D43 A;  4CJM A;  3O3Q A;  1TFM B;  4QKS A;  4YOL A;  5BVP I;  1TWE A;  1YYN A;  3FJ8 A;  1F31 A;  3QR5 A;  4LO0 A;  4JKQ A;  2L5X A;  1WBC A;  1P63 A;  3LTQ A;  5FNW A;  4EFR A;  1ISX A;  5D62 A;  1VCL A;  3VSF A;  3WA1 A;  3RMY A;  3V0B B;  1WBA A;  4TLP A;  3UD9 A;  1ONK B;  4ZKT B;  2VXT I;  1AVW B;  1JY0 A;  3WMV A;  4X39 A;  4J2K A;  4QAL A;  2FO1 A;  2ERM A;  2D7R A;  1PC8 B;  3BAU A;  4EFQ A;  2AAI B;  1DIW A;  1CE7 B;  1DFC A;  1G82 A;  5EC5 A;  2J3P A;  3NBE A;  2D24 A;  4A7K A;  1ISY A;  2I1B A;  3T8S A;  1JLX A;  1FWV A;  3B9U A;  3P6J A;  4IY8 A;  3VT0 A;  1JT7 A;  3UJ4 A;  4R6U B;  3AZV A;  3IAG C;  2BFH A;  3FJF A;  3O4A A;  2NM1 A;  3I2A A;  5F8Y A;  1IJT A;  3MPP G;  3FJB A;  1FWU A;  3AH4 A;  3VEQ A;  3UD8 A;  3PHZ A;  1S0L A;  1QQL A;  1FN0 A;  2DRY A;  3CA3 A;  3N7K A;  4G6M A;  4KEK A;  4GAF A;  3BAD A;  3V0A A;  4I1B A;  4I0Y A;  1HKN A;  4X3A A;  4LO7 C;  3VT1 A;  1RZO B;  1JT5 A;  2AFG A;  3FJJ A;  4QD2 B;  3K1X A;  1QQK A;  3OBT A;  5FZZ A;  1L2H A;  3EF2 A;  3MAL A;  4XFU A;  2MC2 A;  2KLL A;  2NYY A;  5FNX A;  2VSE A;  2ESU A;  4LO2 C;  1K5U A;  4EFP A;  4I4O A;  4ION A;  1W3A A;  1RG8 A;  4I4V A;  1AFC A;  2VSA A;  4LO3 A;  1HWM B;  3BA7 A;  4JAW A;  4JRA A;  1ITB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...