4AN7B

Kunitz type trypsin inhibitor complex with porcine trypsin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
174
structure length
156
Chain Sequence
b'YTVHDTDGKPVLNNAGQYYILPAKGGGLGLSNDDDGNCPLTVSQTPIDIPIGLPVRFSSRARISHITTALSLNIEFTIAPACAPKPARWRIYTPVKISDDFSSAAPFQIKKFEEDYKLVYCSRKCVDLGIKIDNEKNRRLVLKEGDPFKVKFKKVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structural Basis for Dual Inhibitory Role of Tamarind Kunitz Inhibitor (Tki) Against Factor Xa and Trypsin.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 31
structure length 156
sequence length 174
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4an7B00
2XOAA 2K8RA 1F31A 4ZOTA 3HALA 4EFRA 7I1BA 1V6VA 2FO1A 1BFFA 4I4XA 3BAHA 1S0LA 2KI4A 4JQ0A 1IT0A 2KH2A 1FMZA 3AJ6A 4X38A 4A7YA 1WD4A 2GO2A 3UD8A 4ENDA 4QD2C 4Q9PA 3BAQA 4KEKA 4OWLA 3WA1A 2D20A 2LIQA 1QQKA 3O4BA 1JLYA 1JLXA 3NBDA 3VT1A 1S0BA 2VSEA 4XFSA 5BXPA 1RZOB 3BAGA 4JKXB 4ZLBB 5FNWA 2NZ9A 2F8XC 4Z9WB 3POKA 1ISWA 4ZBVB 1EYLA 3V0BA 3PHZA 4YOLA 1BLAA 1YTOA 5DUYA 5EG6C 4USOA 4I96A 3UJ4A 1XYFA 4Q9GA 2DS0A 3O4AA 3BB2A 2RG9B 3WO4A 4LO1C 1G9BA 1TFMB 1BFBA 1YYNA 3FJCA 3FFZA 1BARA 3FJ8A 3FJFA 3O4CA 3CA6A 3A07A 3PG0A 4JRAA 3VT2A 4XFTA 4G6MA 4QO3A 3BAVA 2AXMA 4I6IA 3BRFA 2D7IA 3CRIA 4JKQA 3IAGC 1IRPA 4LO1A 3A22A 3HOMA 2L5XA 1IILA 1BASA 3CU1B 3FUQA 1T4QA 5I1BA 4LO7C 3CA3A 1TWEA 2P39A 4I4PA 3AKFA 1V6UA 4J2KA 3I29B 2M49A 4J2YA 3FUOA 1QQLA 1NZKA 1OQLB 3O5WB 3V0AA 1FQ9A 3HMYA 3T8SA 3RMXA 5DSSB 3WMVA 1AVXB 2ERMA 5FZUA 3I2AA 5EHAA 4I7IA 3N7JA 3FGMA 1I1EA 2QN4A 1YF8B 2NM1A 2Y9XE 3H6RA 3OGGA 4ISQA 4L4IA 3OJ2A 5B2HA 3BTAA 4P0KA 3CA5A 3AH2A 1IOBA 3FJJA 5D61A 4I0YA 3QYDA 2BEAA 1YBIA 5EC5A 1M2TB 1XG6A 4Q91A 1FWVA 1FN0A 4J2SA 2I1BA 1VCLA 5GAQA 2ZQOA 2DREA 3F1RA 3NBEA 5FZYA 1AF9A 2VLCA 2Q3NB 3OBTA 5DZUA 1AXMA 1V6XA 2Q9XA 2D24A 3NJ5A 2D1ZA 2VSAA 3KMVA 3N7KA 4I4VA 3SNVA 3OGFA 4GAFA 4OEEA 1IHKA 1Q1UA 4G9NA 4R6UB 41BIA 3FJIA 4GAIA 1E0OA 4XKIA 2FGFA 4QD2B 3WINA 1HWNB 4OWKA 5BVPI 3AH4A 2D43A 2DRZA 3FJHA 4FGFA 1AVAC 3AKIA 3EF2A 4G1RA 3RMYA 6I1BA 2Y9WC 3BADA 4QALA 2ZQNA 4EKXB 4QBVA 4FVVA 4L4HA 2IHOA 1HIBA 5BXRA 2HW9A 4I37A 3O4OA 3BAUA 3NBNA 2ET2A 1TWMA 1DFCA 1FV2A 1FWUA 3OJVA 1AFCA 1WBCA 3ZX7A 4AN7B 1K5UA 3RSJA 1JT4A 1IRAX 1TTUA 1Q03A 2NTDA 1JQZA 4ISRA 1I1BA 1W3FA 4DCKC 5BOWA 1G9DA 1WBAA 2MC2A 2FFUA 3IM6A 1RMLA 3F62B 5F8YA 3BRDA 4I4UA 5BQUA 3P53A 3BX1C 1FGAA 1BFGA 1ISYA 4D0TA 4OWJA 2AQZA 2MIBA 1RY7A 3BA5A 3TC2A 3V0AB 2NP0A 2VXRA 4LO2A 2KKIA 3MALA 3IIRA 4X39A 1XZZA 1DZDA 3RTJB 4I4SA 4LO7B 3HSMA 3JUTA 2K43A 4JP0A 4IQPA 1S0CA 2D7RA 3UJ0A 3HBWA 1S0GA 3H6RB 4X3AA 2WBCA 4TLPA 3VT0A 3ILAA 2RSTA 1DZCA 2K4AB 4KC3A 3ZXGA 4IZEA 3IM5A 4PC4A 3FJBA 1HCEA 3W9TA 5F8SA 3LLPA 5JMCA 1SR4C 3PUBA 1S0FA 2FFVA 4QKRA 1MD6A 3O3QA 1ISZA 4XFUA 4GP3A 3FJ9A 3HN1A 1ITBA 1ISXA 4JPZA 1HWMB 3WMUA 1DJSB 1PWAA 4EB2B 4GP0A 3NBCA 1DQOA 1ABRB 1W3GA 1SR4A 2D23A 4P6AA 2LIEA 4I4OA 3AKHA 3R4SA 4IHZA 2HZ9A 3Q7YA 3E8LC 1D0HA 1PUUB 3R4UA 2GZBA 3K1XA 3H6QA 3WINC 3PMEA 3FJAA 3QR5A 1J0SA 4ZKTB 2E4MC 1PUMB 3AKGA 1Z2VA 3VWCA 1HKNA 4G6JA 3P6IA 3CRHA 4I1EA 1P63A 3VUOA 5D62A 4GOVA 2YUGA 1UPSA 3RTIB 4Z8SB 4F34A 4I4QA 1K5VA 2AAIB 3P6JA 3C9ZA 4WBCA 2F2FA 1R8OA 1XHBA 2J3PA 3H6SE 4DENA 2X2SA 3UDAA 1ONKB 3V0BB 2QYIB 1FMMS 1HWPB 1JT5A 2E4MA 4EFQA 5BP5C 4I1BA 1YXWA 21BIA 2Y9GA 4KEIA 2KLLA 5G00A 3UD7A 3UD9A 4LO0A 5FNXA 4LO3C 1II4A 1EV2A 2NVHA 3Q7WA 4EEEB 3FJEA 4HR6C 1FV3A 5E24E 1G82A 2VUAA 1R8NA 3JRRA 2RQ9A 1HCDA 4OEGA 5F8WA 2FDBM 3A21A 4F83A 1PC8B 4I8MA 1Z0HA 4OW4A 3WO3A 5BP5A 5BQUC 3O44A 1BFCA 1G9AA 1ISVA 3N0KA 3O4DA 1JY0A 4LO3A 3CQAA 3AZVA 4I4YA 4LO2C 3OBRA 1JT3A 1WD3A 3OJMA 4I2SA 1GGPB 2BEBA 1DFQA 3S8KA 4KEJA 3N7MA 4P0JA 1TIEA 2WRYA 1S0EA 4KBBA 1L2HA 2R9KB 3FJKA 3AJ5A 1M16A 2IWTB 4J23B 4DEPA 1ILR1 4IONA 1CVSA 4H04A 3VEQA 3Q7XA 4ZFWB 4LO8B 1W3AA 4II0A 3AH1A 3FJDA 4D8HA 1EPWA 4IYBA 4QBCA 3CA1A 4EFPA 3S8JA 4H9WA 1N4KA 4QKSA 9ILBA 1KNMA 1TOOA 4ZGRB 2BFHA 2HWMA 1BLDA 4IZXA 2ESUA 4ZFYB 1DLLA 1Q04A 5BXTA 3VSZA 1TP0A 2KI6B 1Z4SA 1S0DA 3I2XA 3LTQA 4JAWA 2X2TA 4OEFA 4D0ZA 1A8DA 4IY8A 1IJTA 5DVHA 1T9FA 4HJJA 3AZWA 1DQGA 3CA4A 2Z48A 3V79C 31BIA 4A7KA 1DIWA 3BA4A 3O49A 3ZXDA 1HWOB 1EVTA 1JTCA 2HWAA 3WO2A 3B9UA 1AVUA 3CAHA 4ZFUB 2VU9A 2VXTI 2F2FC 1QXMA 3ZC9A 1V6WA 3MPPG 4P0LA 2DRYA 1PZZA 4GOYA 4G9MA 3BRGC 4I4RA 4AN6A 4QC4A 2Z49A 1NUNA 4I3NA 2Y9FA 3BAOA 2MLLB 4X37A 4CJMA 2AFGA 5F90A 3IM7A 1JT7A 4J2XA 3ZC8A 4LO0C 3N7LA 3CRGA 4USPA 3CA0A 3D7WB 4A7ZA 2D22A 2D44A 3VSFA 2P23A 4ZA3B 4OUJA 2UUSA 5BXSA 2ZR1B 4IY9A 1G9CA 1CE7B 1BA7A 5HPZA 3A23A 5D63A 3BA7A 5JLVA 8I1BA 4HA2A 1AVWB 1MC9A 1RG8A 1SZ6B 5FZZA 2NYYA
chains in the Genus database with same CATH superfamily
2XOAA 2K8RA 1F31A 4ZOTA 3HALA 4EFRA 7I1BA 1V6VA 2FO1A 1BFFA 4I4XA 3BAHA 1S0LA 2KI4A 4JQ0A 1IT0A 2KH2A 1FMZA 3AJ6A 4X38A 4A7YA 1WD4A 2GO2A 3UD8A 4ENDA 4QD2C 4Q9PA 3BAQA 4KEKA 4OWLA 3WA1A 2D20A 2LIQA 1QQKA 3O4BA 1JLYA 1JLXA 3NBDA 3VT1A 1S0BA 2VSEA 4XFSA 5BXPA 1RZOB 3BAGA 4JKXB 4ZLBB 5FNWA 2NZ9A 2F8XC 4Z9WB 3POKA 1ISWA 4ZBVB 1EYLA 3V0BA 3PHZA 4YOLA 1BLAA 1YTOA 5DUYA 5EG6C 4USOA 4I96A 3UJ4A 1XYFA 4Q9GA 2DS0A 3O4AA 3BB2A 2RG9B 3WO4A 4LO1C 1G9BA 1TFMB 1BFBA 1YYNA 3FJCA 3FFZA 1BARA 3FJ8A 3FJFA 3O4CA 3CA6A 3A07A 3PG0A 4JRAA 3VT2A 4XFTA 4G6MA 4QO3A 3BAVA 2AXMA 4I6IA 3BRFA 2D7IA 3CRIA 4JKQA 3IAGC 1IRPA 4LO1A 3A22A 3HOMA 2L5XA 1IILA 1BASA 3CU1B 3FUQA 1T4QA 5I1BA 4LO7C 3CA3A 1TWEA 2P39A 4I4PA 3AKFA 1V6UA 4J2KA 3I29B 2M49A 4J2YA 3FUOA 1QQLA 1NZKA 1OQLB 3O5WB 3V0AA 1FQ9A 3HMYA 3T8SA 3RMXA 5DSSB 3WMVA 1AVXB 2ERMA 5FZUA 3I2AA 5EHAA 4I7IA 3N7JA 3FGMA 1I1EA 2QN4A 1YF8B 2NM1A 2Y9XE 3H6RA 3OGGA 4ISQA 4L4IA 3OJ2A 5B2HA 3BTAA 4P0KA 3CA5A 3AH2A 1IOBA 3FJJA 5D61A 4I0YA 3QYDA 2BEAA 1YBIA 5EC5A 1M2TB 1XG6A 4Q91A 1FWVA 1FN0A 4J2SA 2I1BA 1VCLA 5GAQA 2ZQOA 2DREA 3F1RA 3NBEA 5FZYA 1AF9A 2VLCA 2Q3NB 3OBTA 5DZUA 1AXMA 1V6XA 2Q9XA 2D24A 3NJ5A 2D1ZA 2VSAA 3KMVA 3N7KA 4I4VA 3SNVA 3OGFA 4GAFA 4OEEA 1IHKA 1Q1UA 4G9NA 4R6UB 41BIA 3FJIA 4GAIA 1E0OA 4XKIA 2FGFA 4QD2B 3WINA 1HWNB 4OWKA 5BVPI 4MZFB 3AH4A 2D43A 2DRZA 3FJHA 4FGFA 1AVAC 3AKIA 3EF2A 4G1RA 3RMYA 6I1BA 2Y9WC 3BADA 4QALA 2ZQNA 4EKXB 4QBVA 4FVVA 4L4HA 2IHOA 1HIBA 5BXRA 2HW9A 4I37A 3O4OA 3BAUA 3NBNA 2ET2A 1TWMA 1DFCA 1FV2A 1FWUA 3OJVA 1AFCA 1WBCA 3ZX7A 4AN7B 1K5UA 3RSJA 1JT4A 1IRAX 1TTUA 1Q03A 2NTDA 1JQZA 4ISRA 1I1BA 1W3FA 4DCKC 5BOWA 1G9DA 1WBAA 2MC2A 2FFUA 3IM6A 1RMLA 3F62B 5F8YA 3BRDA 4I4UA 5BQUA 3P53A 4H75A 3BX1C 1FGAA 1BFGA 1ISYA 4D0TA 4OWJA 2AQZA 2MIBA 1RY7A 3BA5A 3TC2A 3V0AB 2NP0A 2VXRA 4LO2A 2KKIA 3MALA 3IIRA 4X39A 1XZZA 1DZDA 3RTJB 4I4SA 4LO7B 3HSMA 3JUTA 2K43A 4JP0A 4IQPA 1S0CA 2D7RA 3UJ0A 3HBWA 1S0GA 3H6RB 4X3AA 2WBCA 4MZGB 4TLPA 3VT0A 3ILAA 2RSTA 1DZCA 2K4AB 4KC3A 3ZXGA 4IZEA 3IM5A 4PC4A 3FJBA 1HCEA 3W9TA 5F8SA 3LLPA 5JMCA 1SR4C 3PUBA 1S0FA 2FFVA 4QKRA 1MD6A 3O3QA 1ISZA 4XFUA 4GP3A 3FJ9A 3HN1A 1ITBA 1ISXA 4JPZA 1HWMB 3WMUA 1DJSB 1PWAA 4EB2B 4GP0A 3NBCA 1DQOA 1ABRB 1W3GA 1SR4A 2D23A 4P6AA 2LIEA 4I4OA 3AKHA 3R4SA 4IHZA 2HZ9A 3Q7YA 3E8LC 1D0HA 1PUUB 3R4UA 4MZHA 2GZBA 3K1XA 3H6QA 3WINC 3PMEA 3FJAA 3QR5A 1J0SA 4ZKTB 2E4MC 1PUMB 3AKGA 1Z2VA 3VWCA 1HKNA 4G6JA 3P6IA 3CRHA 4I1EA 1P63A 3VUOA 5D62A 4GOVA 2YUGA 1UPSA 3RTIB 4Z8SB 4F34A 4I4QA 1K5VA 2AAIB 3P6JA 3C9ZA 4WBCA 2F2FA 1R8OA 1XHBA 2J3PA 3H6SE 4DENA 2X2SA 3UDAA 1ONKB 3V0BB 2QYIB 1FMMS 1HWPB 1JT5A 2E4MA 4EFQA 5BP5C 4I1BA 1YXWA 21BIA 2Y9GA 4KEIA 2KLLA 5G00A 3UD7A 3UD9A 4LO0A 5FNXA 4LO3C 1II4A 1EV2A 2NVHA 3Q7WA 4EEEB 3FJEA 4HR6C 1FV3A 5E24E 1G82A 2VUAA 1R8NA 3JRRA 2RQ9A 1HCDA 4OEGA 5F8WA 2FDBM 3A21A 4F83A 1PC8B 4I8MA 1Z0HA 4OW4A 3WO3A 5BP5A 5BQUC 3O44A 1BFCA 1G9AA 1ISVA 3N0KA 3O4DA 1JY0A 4LO3A 3CQAA 3AZVA 4I4YA 4LO2C 3OBRA 1JT3A 1WD3A 3OJMA 4I2SA 1GGPB 2BEBA 1DFQA 3S8KA 2NS2A 4KEJA 3N7MA 4P0JA 1TIEA 2WRYA 1S0EA 4KBBA 1L2HA 2R9KB 3FJKA 3AJ5A 1M16A 2IWTB 4J23B 4DEPA 1ILR1 4IONA 1CVSA 4H04A 3VEQA 3Q7XA 4ZFWB 4LO8B 1W3AA 4II0A 3AH1A 3FJDA 4D8HA 1EPWA 4IYBA 4QBCA 3CA1A 4EFPA 3S8JA 4H9WA 1N4KA 4QKSA 9ILBA 1KNMA 1TOOA 4ZGRB 2BFHA 2HWMA 1BLDA 4IZXA 4UY4A 2ESUA 4ZFYB 1DLLA 1Q04A 5BXTA 3VSZA 1TP0A 2KI6B 1Z4SA 1S0DA 3I2XA 3LTQA 4JAWA 2X2TA 4OEFA 4D0ZA 1A8DA 4IY8A 1IJTA 5DVHA 1T9FA 4HJJA 3AZWA 1DQGA 3CA4A 2Z48A 3V79C 31BIA 4A7KA 1DIWA 3BA4A 3O49A 3ZXDA 1HWOB 1EVTA 1JTCA 2HWAA 3WO2A 3B9UA 1AVUA 3CAHA 4ZFUB 2VU9A 2VXTI 2F2FC 1QXMA 3ZC9A 1V6WA 3MPPG 4P0LA 2DRYA 1PZZA 4GOYA 4G9MA 3BRGC 4I4RA 4AN6A 4QC4A 2Z49A 1NUNA 4I3NA 2Y9FA 3BAOA 2MLLB 4X37A 4CJMA 2AFGA 5F90A 3IM7A 1JT7A 4J2XA 3ZC8A 4LO0C 3N7LA 3CRGA 4USPA 3CA0A 3D7WB 4A7ZA 2D22A 2D44A 3VSFA 2P23A 4ZA3B 4OUJA 2UUSA 5BXSA 2ZR1B 4IY9A 1G9CA 1CE7B 1BA7A 5HPZA 3A23A 5D63A 3BA7A 5JLVA 8I1BA 4HA2A 1AVWB 1MC9A 1RG8A 1SZ6B 5FZZA 2NYYA
chains in the Genus database with same CATH topology
2XOAA 2K8RA 1F31A 4ZOTA 3HALA 4EFRA 7I1BA 1V6VA 2FO1A 1BFFA 4I4XA 3BAHA 1S0LA 2KI4A 4JQ0A 1IT0A 2KH2A 1FMZA 3AJ6A 4X38A 4A7YA 1WD4A 2GO2A 3UD8A 4ENDA 4QD2C 4Q9PA 3BAQA 4KEKA 4OWLA 3WA1A 2D20A 2LIQA 1QQKA 3O4BA 1JLYA 1JLXA 3NBDA 3VT1A 1S0BA 2VSEA 4XFSA 5BXPA 1RZOB 3BAGA 4JKXB 4ZLBB 5FNWA 2NZ9A 2F8XC 4Z9WB 3POKA 1ISWA 4ZBVB 1EYLA 3V0BA 3PHZA 4YOLA 1BLAA 1YTOA 5DUYA 5EG6C 4USOA 4I96A 3UJ4A 1XYFA 4Q9GA 2DS0A 3O4AA 3BB2A 2RG9B 3WO4A 4LO1C 1G9BA 1TFMB 1BFBA 1YYNA 3FJCA 3FFZA 1BARA 3FJ8A 3FJFA 3O4CA 3CA6A 3A07A 3PG0A 4JRAA 3VT2A 4XFTA 4G6MA 4QO3A 3BAVA 2AXMA 4I6IA 3BRFA 2D7IA 3CRIA 4JKQA 3IAGC 1IRPA 4LO1A 3A22A 3HOMA 2L5XA 1IILA 1BASA 3CU1B 3FUQA 1T4QA 5I1BA 4LO7C 3CA3A 1TWEA 2P39A 4I4PA 3AKFA 1V6UA 4J2KA 3I29B 2M49A 4J2YA 3FUOA 1QQLA 1NZKA 1OQLB 3O5WB 3V0AA 1FQ9A 3HMYA 3T8SA 3RMXA 5DSSB 3WMVA 1AVXB 2ERMA 5FZUA 3I2AA 5EHAA 4I7IA 3N7JA 3FGMA 1I1EA 2QN4A 1YF8B 2NM1A 2Y9XE 3H6RA 3OGGA 4ISQA 4L4IA 3OJ2A 5B2HA 3BTAA 4P0KA 3CA5A 3AH2A 1IOBA 3FJJA 5D61A 4I0YA 3QYDA 2BEAA 1YBIA 5EC5A 1M2TB 1XG6A 4Q91A 1FWVA 1FN0A 4J2SA 2I1BA 1VCLA 5GAQA 2ZQOA 2DREA 3F1RA 3NBEA 5FZYA 1AF9A 2VLCA 2Q3NB 3OBTA 5DZUA 1AXMA 1V6XA 2Q9XA 2D24A 3NJ5A 2D1ZA 2VSAA 3KMVA 3N7KA 4I4VA 3SNVA 3OGFA 4GAFA 4OEEA 1IHKA 1Q1UA 4G9NA 4R6UB 41BIA 3FJIA 4GAIA 1E0OA 4XKIA 2FGFA 4QD2B 3WINA 1HWNB 4OWKA 5BVPI 4MZFB 3AH4A 2D43A 2DRZA 3FJHA 4FGFA 1AVAC 3AKIA 3EF2A 4G1RA 3RMYA 6I1BA 2Y9WC 3BADA 4QALA 2ZQNA 4EKXB 4QBVA 4FVVA 4L4HA 2IHOA 1HIBA 5BXRA 2HW9A 4I37A 3O4OA 3BAUA 3NBNA 2ET2A 1TWMA 1DFCA 1FV2A 1FWUA 3OJVA 1AFCA 1WBCA 3ZX7A 4AN7B 1K5UA 3RSJA 1JT4A 1IRAX 1TTUA 1Q03A 2NTDA 1JQZA 4ISRA 1I1BA 1W3FA 4DCKC 5BOWA 1G9DA 1WBAA 2MC2A 2FFUA 3IM6A 1RMLA 3F62B 5F8YA 3BRDA 4I4UA 5BQUA 3P53A 4H75A 3BX1C 1FGAA 1BFGA 1ISYA 4D0TA 4OWJA 2AQZA 2MIBA 1RY7A 3BA5A 3TC2A 3V0AB 2NP0A 2VXRA 4LO2A 2KKIA 3MALA 3IIRA 4X39A 1XZZA 1DZDA 3RTJB 4I4SA 4LO7B 3HSMA 3JUTA 2K43A 4JP0A 4IQPA 1S0CA 2D7RA 3UJ0A 3HBWA 1S0GA 3H6RB 4X3AA 2WBCA 4MZGB 4TLPA 3VT0A 3ILAA 2RSTA 1DZCA 2K4AB 4KC3A 3ZXGA 4IZEA 3IM5A 4PC4A 3FJBA 1HCEA 3W9TA 5F8SA 3LLPA 5JMCA 1SR4C 3PUBA 1S0FA 2FFVA 4QKRA 1MD6A 3O3QA 1ISZA 4XFUA 4GP3A 3FJ9A 3HN1A 1ITBA 1ISXA 4JPZA 1HWMB 3WMUA 1DJSB 1PWAA 4EB2B 4GP0A 3NBCA 1DQOA 1ABRB 1W3GA 1SR4A 2D23A 4P6AA 2LIEA 4I4OA 3AKHA 3R4SA 4IHZA 2HZ9A 3Q7YA 3E8LC 1D0HA 1PUUB 3R4UA 4MZHA 2GZBA 3K1XA 3H6QA 3WINC 3PMEA 3FJAA 3QR5A 1J0SA 4ZKTB 2E4MC 1PUMB 3AKGA 1Z2VA 3VWCA 1HKNA 4G6JA 3P6IA 3CRHA 4I1EA 1P63A 3VUOA 5D62A 4GOVA 2YUGA 1UPSA 3RTIB 4Z8SB 4F34A 4I4QA 1K5VA 2AAIB 3P6JA 3C9ZA 4WBCA 2F2FA 1R8OA 1XHBA 2J3PA 3H6SE 4DENA 2X2SA 3UDAA 1ONKB 3V0BB 2QYIB 1FMMS 1HWPB 1JT5A 2E4MA 4EFQA 5BP5C 4I1BA 1YXWA 21BIA 2Y9GA 4KEIA 2KLLA 5G00A 3UD7A 3UD9A 4LO0A 5FNXA 4LO3C 1II4A 1EV2A 2NVHA 3Q7WA 4EEEB 3FJEA 4HR6C 1FV3A 5E24E 1G82A 2VUAA 1R8NA 3JRRA 2RQ9A 1HCDA 4OEGA 5F8WA 2FDBM 3A21A 4F83A 1PC8B 4I8MA 1Z0HA 4OW4A 3WO3A 5BP5A 5BQUC 3O44A 1BFCA 1G9AA 1ISVA 3N0KA 3O4DA 1JY0A 4LO3A 3CQAA 3AZVA 4I4YA 4LO2C 3OBRA 1JT3A 1WD3A 3OJMA 4I2SA 1GGPB 2BEBA 1DFQA 3S8KA 2NS2A 4KEJA 3N7MA 4P0JA 1TIEA 2WRYA 1S0EA 4KBBA 1L2HA 2R9KB 3FJKA 3AJ5A 1M16A 2IWTB 4J23B 4DEPA 1ILR1 4IONA 1CVSA 4H04A 3VEQA 3Q7XA 4ZFWB 4LO8B 1W3AA 4II0A 3AH1A 3FJDA 4D8HA 1EPWA 4IYBA 4QBCA 3CA1A 4EFPA 3S8JA 4H9WA 1N4KA 4QKSA 9ILBA 1KNMA 1TOOA 4ZGRB 2BFHA 2HWMA 1BLDA 4IZXA 4UY4A 2ESUA 4ZFYB 1DLLA 1Q04A 5BXTA 3VSZA 1TP0A 2KI6B 1Z4SA 1S0DA 3I2XA 3LTQA 4JAWA 2X2TA 4OEFA 4D0ZA 1A8DA 4IY8A 1IJTA 5DVHA 1T9FA 4HJJA 3AZWA 1DQGA 3CA4A 2Z48A 3V79C 31BIA 4A7KA 1DIWA 3BA4A 3O49A 3ZXDA 1HWOB 1EVTA 1JTCA 2HWAA 3WO2A 3B9UA 1AVUA 3CAHA 4ZFUB 2VU9A 2VXTI 2F2FC 1QXMA 3ZC9A 1V6WA 3MPPG 4P0LA 2DRYA 1PZZA 4GOYA 4G9MA 3BRGC 4I4RA 4AN6A 4QC4A 2Z49A 1NUNA 4I3NA 2Y9FA 3BAOA 2MLLB 4X37A 4CJMA 2AFGA 5F90A 3IM7A 1JT7A 4J2XA 3ZC8A 4LO0C 3N7LA 3CRGA 4USPA 3CA0A 3D7WB 4A7ZA 2D22A 2D44A 3VSFA 2P23A 4ZA3B 4OUJA 2UUSA 5BXSA 2ZR1B 4IY9A 1G9CA 1CE7B 1BA7A 5HPZA 3A23A 5D63A 3BA7A 5JLVA 8I1BA 4HA2A 1AVWB 1MC9A 1RG8A 1SZ6B 5FZZA 2NYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XOA A;  2K8R A;  1F31 A;  4ZOT A;  3HAL A;  4EFR A;  7I1B A;  1V6V A;  2FO1 A;  1BFF A;  4I4X A;  3BAH A;  1S0L A;  2KI4 A;  4JQ0 A;  1IT0 A;  2KH2 A;  1FMZ A;  3AJ6 A;  4X38 A;  4A7Y A;  1WD4 A;  2GO2 A;  3UD8 A;  4END A;  4QD2 C;  4Q9P A;  3BAQ A;  4KEK A;  4OWL A;  3WA1 A;  2D20 A;  2LIQ A;  1QQK A;  3O4B A;  1JLY A;  1JLX A;  3NBD A;  3VT1 A;  1S0B A;  2VSE A;  4XFS A;  5BXP A;  1RZO B;  3BAG A;  4JKX B;  4ZLB B;  5FNW A;  2NZ9 A;  2F8X C;  4Z9W B;  3POK A;  1ISW A;  4ZBV B;  1EYL A;  3V0B A;  3PHZ A;  4YOL A;  1BLA A;  1YTO A;  5DUY A;  5EG6 C;  4USO A;  4I96 A;  3UJ4 A;  1XYF A;  4Q9G A;  2DS0 A;  3O4A A;  3BB2 A;  2RG9 B;  3WO4 A;  4LO1 C;  1G9B A;  1TFM B;  1BFB A;  1YYN A;  3FJC A;  3FFZ A;  1BAR A;  3FJ8 A;  3FJF A;  3O4C A;  3CA6 A;  3A07 A;  3PG0 A;  4JRA A;  3VT2 A;  4XFT A;  4G6M A;  4QO3 A;  3BAV A;  2AXM A;  4I6I A;  3BRF A;  2D7I A;  3CRI A;  4JKQ A;  3IAG C;  1IRP A;  4LO1 A;  3A22 A;  3HOM A;  2L5X A;  1IIL A;  1BAS A;  3CU1 B;  3FUQ A;  1T4Q A;  5I1B A;  4LO7 C;  3CA3 A;  1TWE A;  2P39 A;  4I4P A;  3AKF A;  1V6U A;  4J2K A;  3I29 B;  2M49 A;  4J2Y A;  3FUO A;  1QQL A;  1NZK A;  1OQL B;  3O5W B;  3V0A A;  1FQ9 A;  3HMY A;  3T8S A;  3RMX A;  5DSS B;  3WMV A;  1AVX B;  2ERM A;  5FZU A;  3I2A A;  5EHA A;  4I7I A;  3N7J A;  3FGM A;  1I1E A;  2QN4 A;  1YF8 B;  2NM1 A;  2Y9X E;  3H6R A;  3OGG A;  4ISQ A;  4L4I A;  3OJ2 A;  5B2H A;  3BTA A;  4P0K A;  3CA5 A;  3AH2 A;  1IOB A;  3FJJ A;  5D61 A;  4I0Y A;  3QYD A;  2BEA A;  1YBI A;  5EC5 A;  1M2T B;  1XG6 A;  4Q91 A;  1FWV A;  1FN0 A;  4J2S A;  2I1B A;  1VCL A;  5GAQ A;  2ZQO A;  2DRE A;  3F1R A;  3NBE A;  5FZY A;  1AF9 A;  2VLC A;  2Q3N B;  3OBT A;  5DZU A;  1AXM A;  1V6X A;  2Q9X A;  2D24 A;  3NJ5 A;  2D1Z A;  2VSA A;  3KMV A;  3N7K A;  4I4V A;  3SNV A;  3OGF A;  4GAF A;  4OEE A;  1IHK A;  1Q1U A;  4G9N A;  4R6U B;  41BI A;  3FJI A;  4GAI A;  1E0O A;  4XKI A;  2FGF A;  4QD2 B;  3WIN A;  1HWN B;  4OWK A;  5BVP I;  3AH4 A;  2D43 A;  2DRZ A;  3FJH A;  4FGF A;  1AVA C;  3AKI A;  3EF2 A;  4G1R A;  3RMY A;  6I1B A;  2Y9W C;  3BAD A;  4QAL A;  2ZQN A;  4EKX B;  4QBV A;  4FVV A;  4L4H A;  2IHO A;  1HIB A;  5BXR A;  2HW9 A;  4I37 A;  3O4O A;  3BAU A;  3NBN A;  2ET2 A;  1TWM A;  1DFC A;  1FV2 A;  1FWU A;  3OJV A;  1AFC A;  1WBC A;  3ZX7 A;  4AN7 B;  1K5U A;  3RSJ A;  1JT4 A;  1IRA X;  1TTU A;  1Q03 A;  2NTD A;  1JQZ A;  4ISR A;  1I1B A;  1W3F A;  4DCK C;  5BOW A;  1G9D A;  1WBA A;  2MC2 A;  2FFU A;  3IM6 A;  1RML A;  3F62 B;  5F8Y A;  3BRD A;  4I4U A;  5BQU A;  3P53 A;  3BX1 C;  1FGA A;  1BFG A;  1ISY A;  4D0T A;  4OWJ A;  2AQZ A;  2MIB A;  1RY7 A;  3BA5 A;  3TC2 A;  3V0A B;  2NP0 A;  2VXR A;  4LO2 A;  2KKI A;  3MAL A;  3IIR A;  4X39 A;  1XZZ A;  1DZD A;  3RTJ B;  4I4S A;  4LO7 B;  3HSM A;  3JUT A;  2K43 A;  4JP0 A;  4IQP A;  1S0C A;  2D7R A;  3UJ0 A;  3HBW A;  1S0G A;  3H6R B;  4X3A A;  2WBC A;  4TLP A;  3VT0 A;  3ILA A;  2RST A;  1DZC A;  2K4A B;  4KC3 A;  3ZXG A;  4IZE A;  3IM5 A;  4PC4 A;  3FJB A;  1HCE A;  3W9T A;  5F8S A;  3LLP A;  5JMC A;  1SR4 C;  3PUB A;  1S0F A;  2FFV A;  4QKR A;  1MD6 A;  3O3Q A;  1ISZ A;  4XFU A;  4GP3 A;  3FJ9 A;  3HN1 A;  1ITB A;  1ISX A;  4JPZ A;  1HWM B;  3WMU A;  1DJS B;  1PWA A;  4EB2 B;  4GP0 A;  3NBC A;  1DQO A;  1ABR B;  1W3G A;  1SR4 A;  2D23 A;  4P6A A;  2LIE A;  4I4O A;  3AKH A;  3R4S A;  4IHZ A;  2HZ9 A;  3Q7Y A;  3E8L C;  1D0H A;  1PUU B;  3R4U A;  2GZB A;  3K1X A;  3H6Q A;  3WIN C;  3PME A;  3FJA A;  3QR5 A;  1J0S A;  4ZKT B;  2E4M C;  1PUM B;  3AKG A;  1Z2V A;  3VWC A;  1HKN A;  4G6J A;  3P6I A;  3CRH A;  4I1E A;  1P63 A;  3VUO A;  5D62 A;  4GOV A;  2YUG A;  1UPS A;  3RTI B;  4Z8S B;  4F34 A;  4I4Q A;  1K5V A;  2AAI B;  3P6J A;  3C9Z A;  4WBC A;  2F2F A;  1R8O A;  1XHB A;  2J3P A;  3H6S E;  4DEN A;  2X2S A;  3UDA A;  1ONK B;  3V0B B;  2QYI B;  1FMM S;  1HWP B;  1JT5 A;  2E4M A;  4EFQ A;  5BP5 C;  4I1B A;  1YXW A;  21BI A;  2Y9G A;  4KEI A;  2KLL A;  5G00 A;  3UD7 A;  3UD9 A;  4LO0 A;  5FNX A;  4LO3 C;  1II4 A;  1EV2 A;  2NVH A;  3Q7W A;  4EEE B;  3FJE A;  4HR6 C;  1FV3 A;  5E24 E;  1G82 A;  2VUA A;  1R8N A;  3JRR A;  2RQ9 A;  1HCD A;  4OEG A;  5F8W A;  2FDB M;  3A21 A;  4F83 A;  1PC8 B;  4I8M A;  1Z0H A;  4OW4 A;  3WO3 A;  5BP5 A;  5BQU C;  3O44 A;  1BFC A;  1G9A A;  1ISV A;  3N0K A;  3O4D A;  1JY0 A;  4LO3 A;  3CQA A;  3AZV A;  4I4Y A;  4LO2 C;  3OBR A;  1JT3 A;  1WD3 A;  3OJM A;  4I2S A;  1GGP B;  2BEB A;  1DFQ A;  3S8K A;  4KEJ A;  3N7M A;  4P0J A;  1TIE A;  2WRY A;  1S0E A;  4KBB A;  1L2H A;  2R9K B;  3FJK A;  3AJ5 A;  1M16 A;  2IWT B;  4J23 B;  4DEP A;  1ILR 1;  4ION A;  1CVS A;  4H04 A;  3VEQ A;  3Q7X A;  4ZFW B;  4LO8 B;  1W3A A;  4II0 A;  3AH1 A;  3FJD A;  4D8H A;  1EPW A;  4IYB A;  4QBC A;  3CA1 A;  4EFP A;  3S8J A;  4H9W A;  1N4K A;  4QKS A;  9ILB A;  1KNM A;  1TOO A;  4ZGR B;  2BFH A;  2HWM A;  1BLD A;  4IZX A;  2ESU A;  4ZFY B;  1DLL A;  1Q04 A;  5BXT A;  3VSZ A;  1TP0 A;  2KI6 B;  1Z4S A;  1S0D A;  3I2X A;  3LTQ A;  4JAW A;  2X2T A;  4OEF A;  4D0Z A;  1A8D A;  4IY8 A;  1IJT A;  5DVH A;  1T9F A;  4HJJ A;  3AZW A;  1DQG A;  3CA4 A;  2Z48 A;  3V79 C;  31BI A;  4A7K A;  1DIW A;  3BA4 A;  3O49 A;  3ZXD A;  1HWO B;  1EVT A;  1JTC A;  2HWA A;  3WO2 A;  3B9U A;  1AVU A;  3CAH A;  4ZFU B;  2VU9 A;  2VXT I;  2F2F C;  1QXM A;  3ZC9 A;  1V6W A;  3MPP G;  4P0L A;  2DRY A;  1PZZ A;  4GOY A;  4G9M A;  3BRG C;  4I4R A;  4AN6 A;  4QC4 A;  2Z49 A;  1NUN A;  4I3N A;  2Y9F A;  3BAO A;  2MLL B;  4X37 A;  4CJM A;  2AFG A;  5F90 A;  3IM7 A;  1JT7 A;  4J2X A;  3ZC8 A;  4LO0 C;  3N7L A;  3CRG A;  4USP A;  3CA0 A;  3D7W B;  4A7Z A;  2D22 A;  2D44 A;  3VSF A;  2P23 A;  4ZA3 B;  4OUJ A;  2UUS A;  5BXS A;  2ZR1 B;  4IY9 A;  1G9C A;  1CE7 B;  1BA7 A;  5HPZ A;  3A23 A;  5D63 A;  3BA7 A;  5JLV A;  8I1B A;  4HA2 A;  1AVW B;  1MC9 A;  1RG8 A;  1SZ6 B;  5FZZ A;  2NYY A; 
#chains in the Genus database with same CATH topology
 2XOA A;  2K8R A;  1F31 A;  4ZOT A;  3HAL A;  4EFR A;  7I1B A;  1V6V A;  2FO1 A;  1BFF A;  4I4X A;  3BAH A;  1S0L A;  2KI4 A;  4JQ0 A;  1IT0 A;  2KH2 A;  1FMZ A;  3AJ6 A;  4X38 A;  4A7Y A;  1WD4 A;  2GO2 A;  3UD8 A;  4END A;  4QD2 C;  4Q9P A;  3BAQ A;  4KEK A;  4OWL A;  3WA1 A;  2D20 A;  2LIQ A;  1QQK A;  3O4B A;  1JLY A;  1JLX A;  3NBD A;  3VT1 A;  1S0B A;  2VSE A;  4XFS A;  5BXP A;  1RZO B;  3BAG A;  4JKX B;  4ZLB B;  5FNW A;  2NZ9 A;  2F8X C;  4Z9W B;  3POK A;  1ISW A;  4ZBV B;  1EYL A;  3V0B A;  3PHZ A;  4YOL A;  1BLA A;  1YTO A;  5DUY A;  5EG6 C;  4USO A;  4I96 A;  3UJ4 A;  1XYF A;  4Q9G A;  2DS0 A;  3O4A A;  3BB2 A;  2RG9 B;  3WO4 A;  4LO1 C;  1G9B A;  1TFM B;  1BFB A;  1YYN A;  3FJC A;  3FFZ A;  1BAR A;  3FJ8 A;  3FJF A;  3O4C A;  3CA6 A;  3A07 A;  3PG0 A;  4JRA A;  3VT2 A;  4XFT A;  4G6M A;  4QO3 A;  3BAV A;  2AXM A;  4I6I A;  3BRF A;  2D7I A;  3CRI A;  4JKQ A;  3IAG C;  1IRP A;  4LO1 A;  3A22 A;  3HOM A;  2L5X A;  1IIL A;  1BAS A;  3CU1 B;  3FUQ A;  1T4Q A;  5I1B A;  4LO7 C;  3CA3 A;  1TWE A;  2P39 A;  4I4P A;  3AKF A;  1V6U A;  4J2K A;  3I29 B;  2M49 A;  4J2Y A;  3FUO A;  1QQL A;  1NZK A;  1OQL B;  3O5W B;  3V0A A;  1FQ9 A;  3HMY A;  3T8S A;  3RMX A;  5DSS B;  3WMV A;  1AVX B;  2ERM A;  5FZU A;  3I2A A;  5EHA A;  4I7I A;  3N7J A;  3FGM A;  1I1E A;  2QN4 A;  1YF8 B;  2NM1 A;  2Y9X E;  3H6R A;  3OGG A;  4ISQ A;  4L4I A;  3OJ2 A;  5B2H A;  3BTA A;  4P0K A;  3CA5 A;  3AH2 A;  1IOB A;  3FJJ A;  5D61 A;  4I0Y A;  3QYD A;  2BEA A;  1YBI A;  5EC5 A;  1M2T B;  1XG6 A;  4Q91 A;  1FWV A;  1FN0 A;  4J2S A;  2I1B A;  1VCL A;  5GAQ A;  2ZQO A;  2DRE A;  3F1R A;  3NBE A;  5FZY A;  1AF9 A;  2VLC A;  2Q3N B;  3OBT A;  5DZU A;  1AXM A;  1V6X A;  2Q9X A;  2D24 A;  3NJ5 A;  2D1Z A;  2VSA A;  3KMV A;  3N7K A;  4I4V A;  3SNV A;  3OGF A;  4GAF A;  4OEE A;  1IHK A;  1Q1U A;  4G9N A;  4R6U B;  41BI A;  3FJI A;  4GAI A;  1E0O A;  4XKI A;  2FGF A;  4QD2 B;  3WIN A;  1HWN B;  4OWK A;  5BVP I;  4MZF B;  3AH4 A;  2D43 A;  2DRZ A;  3FJH A;  4FGF A;  1AVA C;  3AKI A;  3EF2 A;  4G1R A;  3RMY A;  6I1B A;  2Y9W C;  3BAD A;  4QAL A;  2ZQN A;  4EKX B;  4QBV A;  4FVV A;  4L4H A;  2IHO A;  1HIB A;  5BXR A;  2HW9 A;  4I37 A;  3O4O A;  3BAU A;  3NBN A;  2ET2 A;  1TWM A;  1DFC A;  1FV2 A;  1FWU A;  3OJV A;  1AFC A;  1WBC A;  3ZX7 A;  4AN7 B;  1K5U A;  3RSJ A;  1JT4 A;  1IRA X;  1TTU A;  1Q03 A;  2NTD A;  1JQZ A;  4ISR A;  1I1B A;  1W3F A;  4DCK C;  5BOW A;  1G9D A;  1WBA A;  2MC2 A;  2FFU A;  3IM6 A;  1RML A;  3F62 B;  5F8Y A;  3BRD A;  4I4U A;  5BQU A;  3P53 A;  4H75 A;  3BX1 C;  1FGA A;  1BFG A;  1ISY A;  4D0T A;  4OWJ A;  2AQZ A;  2MIB A;  1RY7 A;  3BA5 A;  3TC2 A;  3V0A B;  2NP0 A;  2VXR A;  4LO2 A;  2KKI A;  3MAL A;  3IIR A;  4X39 A;  1XZZ A;  1DZD A;  3RTJ B;  4I4S A;  4LO7 B;  3HSM A;  3JUT A;  2K43 A;  4JP0 A;  4IQP A;  1S0C A;  2D7R A;  3UJ0 A;  3HBW A;  1S0G A;  3H6R B;  4X3A A;  2WBC A;  4MZG B;  4TLP A;  3VT0 A;  3ILA A;  2RST A;  1DZC A;  2K4A B;  4KC3 A;  3ZXG A;  4IZE A;  3IM5 A;  4PC4 A;  3FJB A;  1HCE A;  3W9T A;  5F8S A;  3LLP A;  5JMC A;  1SR4 C;  3PUB A;  1S0F A;  2FFV A;  4QKR A;  1MD6 A;  3O3Q A;  1ISZ A;  4XFU A;  4GP3 A;  3FJ9 A;  3HN1 A;  1ITB A;  1ISX A;  4JPZ A;  1HWM B;  3WMU A;  1DJS B;  1PWA A;  4EB2 B;  4GP0 A;  3NBC A;  1DQO A;  1ABR B;  1W3G A;  1SR4 A;  2D23 A;  4P6A A;  2LIE A;  4I4O A;  3AKH A;  3R4S A;  4IHZ A;  2HZ9 A;  3Q7Y A;  3E8L C;  1D0H A;  1PUU B;  3R4U A;  4MZH A;  2GZB A;  3K1X A;  3H6Q A;  3WIN C;  3PME A;  3FJA A;  3QR5 A;  1J0S A;  4ZKT B;  2E4M C;  1PUM B;  3AKG A;  1Z2V A;  3VWC A;  1HKN A;  4G6J A;  3P6I A;  3CRH A;  4I1E A;  1P63 A;  3VUO A;  5D62 A;  4GOV A;  2YUG A;  1UPS A;  3RTI B;  4Z8S B;  4F34 A;  4I4Q A;  1K5V A;  2AAI B;  3P6J A;  3C9Z A;  4WBC A;  2F2F A;  1R8O A;  1XHB A;  2J3P A;  3H6S E;  4DEN A;  2X2S A;  3UDA A;  1ONK B;  3V0B B;  2QYI B;  1FMM S;  1HWP B;  1JT5 A;  2E4M A;  4EFQ A;  5BP5 C;  4I1B A;  1YXW A;  21BI A;  2Y9G A;  4KEI A;  2KLL A;  5G00 A;  3UD7 A;  3UD9 A;  4LO0 A;  5FNX A;  4LO3 C;  1II4 A;  1EV2 A;  2NVH A;  3Q7W A;  4EEE B;  3FJE A;  4HR6 C;  1FV3 A;  5E24 E;  1G82 A;  2VUA A;  1R8N A;  3JRR A;  2RQ9 A;  1HCD A;  4OEG A;  5F8W A;  2FDB M;  3A21 A;  4F83 A;  1PC8 B;  4I8M A;  1Z0H A;  4OW4 A;  3WO3 A;  5BP5 A;  5BQU C;  3O44 A;  1BFC A;  1G9A A;  1ISV A;  3N0K A;  3O4D A;  1JY0 A;  4LO3 A;  3CQA A;  3AZV A;  4I4Y A;  4LO2 C;  3OBR A;  1JT3 A;  1WD3 A;  3OJM A;  4I2S A;  1GGP B;  2BEB A;  1DFQ A;  3S8K A;  2NS2 A;  4KEJ A;  3N7M A;  4P0J A;  1TIE A;  2WRY A;  1S0E A;  4KBB A;  1L2H A;  2R9K B;  3FJK A;  3AJ5 A;  1M16 A;  2IWT B;  4J23 B;  4DEP A;  1ILR 1;  4ION A;  1CVS A;  4H04 A;  3VEQ A;  3Q7X A;  4ZFW B;  4LO8 B;  1W3A A;  4II0 A;  3AH1 A;  3FJD A;  4D8H A;  1EPW A;  4IYB A;  4QBC A;  3CA1 A;  4EFP A;  3S8J A;  4H9W A;  1N4K A;  4QKS A;  9ILB A;  1KNM A;  1TOO A;  4ZGR B;  2BFH A;  2HWM A;  1BLD A;  4IZX A;  4UY4 A;  2ESU A;  4ZFY B;  1DLL A;  1Q04 A;  5BXT A;  3VSZ A;  1TP0 A;  2KI6 B;  1Z4S A;  1S0D A;  3I2X A;  3LTQ A;  4JAW A;  2X2T A;  4OEF A;  4D0Z A;  1A8D A;  4IY8 A;  1IJT A;  5DVH A;  1T9F A;  4HJJ A;  3AZW A;  1DQG A;  3CA4 A;  2Z48 A;  3V79 C;  31BI A;  4A7K A;  1DIW A;  3BA4 A;  3O49 A;  3ZXD A;  1HWO B;  1EVT A;  1JTC A;  2HWA A;  3WO2 A;  3B9U A;  1AVU A;  3CAH A;  4ZFU B;  2VU9 A;  2VXT I;  2F2F C;  1QXM A;  3ZC9 A;  1V6W A;  3MPP G;  4P0L A;  2DRY A;  1PZZ A;  4GOY A;  4G9M A;  3BRG C;  4I4R A;  4AN6 A;  4QC4 A;  2Z49 A;  1NUN A;  4I3N A;  2Y9F A;  3BAO A;  2MLL B;  4X37 A;  4CJM A;  2AFG A;  5F90 A;  3IM7 A;  1JT7 A;  4J2X A;  3ZC8 A;  4LO0 C;  3N7L A;  3CRG A;  4USP A;  3CA0 A;  3D7W B;  4A7Z A;  2D22 A;  2D44 A;  3VSF A;  2P23 A;  4ZA3 B;  4OUJ A;  2UUS A;  5BXS A;  2ZR1 B;  4IY9 A;  1G9C A;  1CE7 B;  1BA7 A;  5HPZ A;  3A23 A;  5D63 A;  3BA7 A;  5JLV A;  8I1B A;  4HA2 A;  1AVW B;  1MC9 A;  1RG8 A;  1SZ6 B;  5FZZ A;  2NYY A; 
#chains in the Genus database with same CATH homology
 2XOA A;  2K8R A;  1F31 A;  4ZOT A;  3HAL A;  4EFR A;  7I1B A;  1V6V A;  2FO1 A;  1BFF A;  4I4X A;  3BAH A;  1S0L A;  2KI4 A;  4JQ0 A;  1IT0 A;  2KH2 A;  1FMZ A;  3AJ6 A;  4X38 A;  4A7Y A;  1WD4 A;  2GO2 A;  3UD8 A;  4END A;  4QD2 C;  4Q9P A;  3BAQ A;  4KEK A;  4OWL A;  3WA1 A;  2D20 A;  2LIQ A;  1QQK A;  3O4B A;  1JLY A;  1JLX A;  3NBD A;  3VT1 A;  1S0B A;  2VSE A;  4XFS A;  5BXP A;  1RZO B;  3BAG A;  4JKX B;  4ZLB B;  5FNW A;  2NZ9 A;  2F8X C;  4Z9W B;  3POK A;  1ISW A;  4ZBV B;  1EYL A;  3V0B A;  3PHZ A;  4YOL A;  1BLA A;  1YTO A;  5DUY A;  5EG6 C;  4USO A;  4I96 A;  3UJ4 A;  1XYF A;  4Q9G A;  2DS0 A;  3O4A A;  3BB2 A;  2RG9 B;  3WO4 A;  4LO1 C;  1G9B A;  1TFM B;  1BFB A;  1YYN A;  3FJC A;  3FFZ A;  1BAR A;  3FJ8 A;  3FJF A;  3O4C A;  3CA6 A;  3A07 A;  3PG0 A;  4JRA A;  3VT2 A;  4XFT A;  4G6M A;  4QO3 A;  3BAV A;  2AXM A;  4I6I A;  3BRF A;  2D7I A;  3CRI A;  4JKQ A;  3IAG C;  1IRP A;  4LO1 A;  3A22 A;  3HOM A;  2L5X A;  1IIL A;  1BAS A;  3CU1 B;  3FUQ A;  1T4Q A;  5I1B A;  4LO7 C;  3CA3 A;  1TWE A;  2P39 A;  4I4P A;  3AKF A;  1V6U A;  4J2K A;  3I29 B;  2M49 A;  4J2Y A;  3FUO A;  1QQL A;  1NZK A;  1OQL B;  3O5W B;  3V0A A;  1FQ9 A;  3HMY A;  3T8S A;  3RMX A;  5DSS B;  3WMV A;  1AVX B;  2ERM A;  5FZU A;  3I2A A;  5EHA A;  4I7I A;  3N7J A;  3FGM A;  1I1E A;  2QN4 A;  1YF8 B;  2NM1 A;  2Y9X E;  3H6R A;  3OGG A;  4ISQ A;  4L4I A;  3OJ2 A;  5B2H A;  3BTA A;  4P0K A;  3CA5 A;  3AH2 A;  1IOB A;  3FJJ A;  5D61 A;  4I0Y A;  3QYD A;  2BEA A;  1YBI A;  5EC5 A;  1M2T B;  1XG6 A;  4Q91 A;  1FWV A;  1FN0 A;  4J2S A;  2I1B A;  1VCL A;  5GAQ A;  2ZQO A;  2DRE A;  3F1R A;  3NBE A;  5FZY A;  1AF9 A;  2VLC A;  2Q3N B;  3OBT A;  5DZU A;  1AXM A;  1V6X A;  2Q9X A;  2D24 A;  3NJ5 A;  2D1Z A;  2VSA A;  3KMV A;  3N7K A;  4I4V A;  3SNV A;  3OGF A;  4GAF A;  4OEE A;  1IHK A;  1Q1U A;  4G9N A;  4R6U B;  41BI A;  3FJI A;  4GAI A;  1E0O A;  4XKI A;  2FGF A;  4QD2 B;  3WIN A;  1HWN B;  4OWK A;  5BVP I;  4MZF B;  3AH4 A;  2D43 A;  2DRZ A;  3FJH A;  4FGF A;  1AVA C;  3AKI A;  3EF2 A;  4G1R A;  3RMY A;  6I1B A;  2Y9W C;  3BAD A;  4QAL A;  2ZQN A;  4EKX B;  4QBV A;  4FVV A;  4L4H A;  2IHO A;  1HIB A;  5BXR A;  2HW9 A;  4I37 A;  3O4O A;  3BAU A;  3NBN A;  2ET2 A;  1TWM A;  1DFC A;  1FV2 A;  1FWU A;  3OJV A;  1AFC A;  1WBC A;  3ZX7 A;  4AN7 B;  1K5U A;  3RSJ A;  1JT4 A;  1IRA X;  1TTU A;  1Q03 A;  2NTD A;  1JQZ A;  4ISR A;  1I1B A;  1W3F A;  4DCK C;  5BOW A;  1G9D A;  1WBA A;  2MC2 A;  2FFU A;  3IM6 A;  1RML A;  3F62 B;  5F8Y A;  3BRD A;  4I4U A;  5BQU A;  3P53 A;  4H75 A;  3BX1 C;  1FGA A;  1BFG A;  1ISY A;  4D0T A;  4OWJ A;  2AQZ A;  2MIB A;  1RY7 A;  3BA5 A;  3TC2 A;  3V0A B;  2NP0 A;  2VXR A;  4LO2 A;  2KKI A;  3MAL A;  3IIR A;  4X39 A;  1XZZ A;  1DZD A;  3RTJ B;  4I4S A;  4LO7 B;  3HSM A;  3JUT A;  2K43 A;  4JP0 A;  4IQP A;  1S0C A;  2D7R A;  3UJ0 A;  3HBW A;  1S0G A;  3H6R B;  4X3A A;  2WBC A;  4MZG B;  4TLP A;  3VT0 A;  3ILA A;  2RST A;  1DZC A;  2K4A B;  4KC3 A;  3ZXG A;  4IZE A;  3IM5 A;  4PC4 A;  3FJB A;  1HCE A;  3W9T A;  5F8S A;  3LLP A;  5JMC A;  1SR4 C;  3PUB A;  1S0F A;  2FFV A;  4QKR A;  1MD6 A;  3O3Q A;  1ISZ A;  4XFU A;  4GP3 A;  3FJ9 A;  3HN1 A;  1ITB A;  1ISX A;  4JPZ A;  1HWM B;  3WMU A;  1DJS B;  1PWA A;  4EB2 B;  4GP0 A;  3NBC A;  1DQO A;  1ABR B;  1W3G A;  1SR4 A;  2D23 A;  4P6A A;  2LIE A;  4I4O A;  3AKH A;  3R4S A;  4IHZ A;  2HZ9 A;  3Q7Y A;  3E8L C;  1D0H A;  1PUU B;  3R4U A;  4MZH A;  2GZB A;  3K1X A;  3H6Q A;  3WIN C;  3PME A;  3FJA A;  3QR5 A;  1J0S A;  4ZKT B;  2E4M C;  1PUM B;  3AKG A;  1Z2V A;  3VWC A;  1HKN A;  4G6J A;  3P6I A;  3CRH A;  4I1E A;  1P63 A;  3VUO A;  5D62 A;  4GOV A;  2YUG A;  1UPS A;  3RTI B;  4Z8S B;  4F34 A;  4I4Q A;  1K5V A;  2AAI B;  3P6J A;  3C9Z A;  4WBC A;  2F2F A;  1R8O A;  1XHB A;  2J3P A;  3H6S E;  4DEN A;  2X2S A;  3UDA A;  1ONK B;  3V0B B;  2QYI B;  1FMM S;  1HWP B;  1JT5 A;  2E4M A;  4EFQ A;  5BP5 C;  4I1B A;  1YXW A;  21BI A;  2Y9G A;  4KEI A;  2KLL A;  5G00 A;  3UD7 A;  3UD9 A;  4LO0 A;  5FNX A;  4LO3 C;  1II4 A;  1EV2 A;  2NVH A;  3Q7W A;  4EEE B;  3FJE A;  4HR6 C;  1FV3 A;  5E24 E;  1G82 A;  2VUA A;  1R8N A;  3JRR A;  2RQ9 A;  1HCD A;  4OEG A;  5F8W A;  2FDB M;  3A21 A;  4F83 A;  1PC8 B;  4I8M A;  1Z0H A;  4OW4 A;  3WO3 A;  5BP5 A;  5BQU C;  3O44 A;  1BFC A;  1G9A A;  1ISV A;  3N0K A;  3O4D A;  1JY0 A;  4LO3 A;  3CQA A;  3AZV A;  4I4Y A;  4LO2 C;  3OBR A;  1JT3 A;  1WD3 A;  3OJM A;  4I2S A;  1GGP B;  2BEB A;  1DFQ A;  3S8K A;  2NS2 A;  4KEJ A;  3N7M A;  4P0J A;  1TIE A;  2WRY A;  1S0E A;  4KBB A;  1L2H A;  2R9K B;  3FJK A;  3AJ5 A;  1M16 A;  2IWT B;  4J23 B;  4DEP A;  1ILR 1;  4ION A;  1CVS A;  4H04 A;  3VEQ A;  3Q7X A;  4ZFW B;  4LO8 B;  1W3A A;  4II0 A;  3AH1 A;  3FJD A;  4D8H A;  1EPW A;  4IYB A;  4QBC A;  3CA1 A;  4EFP A;  3S8J A;  4H9W A;  1N4K A;  4QKS A;  9ILB A;  1KNM A;  1TOO A;  4ZGR B;  2BFH A;  2HWM A;  1BLD A;  4IZX A;  4UY4 A;  2ESU A;  4ZFY B;  1DLL A;  1Q04 A;  5BXT A;  3VSZ A;  1TP0 A;  2KI6 B;  1Z4S A;  1S0D A;  3I2X A;  3LTQ A;  4JAW A;  2X2T A;  4OEF A;  4D0Z A;  1A8D A;  4IY8 A;  1IJT A;  5DVH A;  1T9F A;  4HJJ A;  3AZW A;  1DQG A;  3CA4 A;  2Z48 A;  3V79 C;  31BI A;  4A7K A;  1DIW A;  3BA4 A;  3O49 A;  3ZXD A;  1HWO B;  1EVT A;  1JTC A;  2HWA A;  3WO2 A;  3B9U A;  1AVU A;  3CAH A;  4ZFU B;  2VU9 A;  2VXT I;  2F2F C;  1QXM A;  3ZC9 A;  1V6W A;  3MPP G;  4P0L A;  2DRY A;  1PZZ A;  4GOY A;  4G9M A;  3BRG C;  4I4R A;  4AN6 A;  4QC4 A;  2Z49 A;  1NUN A;  4I3N A;  2Y9F A;  3BAO A;  2MLL B;  4X37 A;  4CJM A;  2AFG A;  5F90 A;  3IM7 A;  1JT7 A;  4J2X A;  3ZC8 A;  4LO0 C;  3N7L A;  3CRG A;  4USP A;  3CA0 A;  3D7W B;  4A7Z A;  2D22 A;  2D44 A;  3VSF A;  2P23 A;  4ZA3 B;  4OUJ A;  2UUS A;  5BXS A;  2ZR1 B;  4IY9 A;  1G9C A;  1CE7 B;  1BA7 A;  5HPZ A;  3A23 A;  5D63 A;  3BA7 A;  5JLV A;  8I1B A;  4HA2 A;  1AVW B;  1MC9 A;  1RG8 A;  1SZ6 B;  5FZZ A;  2NYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...