4AN7B

Kunitz type trypsin inhibitor complex with porcine trypsin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
174
structure length
156
Chain Sequence
YTVHDTDGKPVLNNAGQYYILPAKGGGLGLSNDDDGNCPLTVSQTPIDIPIGLPVRFSSRARISHITTALSLNIEFTIAPACAPKPARWRIYTPVKISDDFSSAAPFQIKKFEEDYKLVYCSRKCVDLGIKIDNEKNRRLVLKEGDPFKVKFKKVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structural Basis for Dual Inhibitory Role of Tamarind Kunitz Inhibitor (Tki) Against Factor Xa and Trypsin.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 31
structure length 156
sequence length 174
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4an7B00
1S0GA 3VEQA 4IZXA 1R8OA 2Q9XA 1NUNA 1EYLA 1SZ6B 1V6WA 2VXRA 1BA7A 3W9TA 4GP3A 4J23B 5FZZA 2Q3NB 3WMVA 4Z9WB 3BAQA 2FFUA 1I1EA 2NYYA 3AKIA 1AFCA 4D8HA 5D63A 4I8MA 1WD4A 3RSJA 1IOBA 3FJDA 1Z0HA 4OWLA 3RMXA 3IM7A 3WO3A 5BXPA 1RG8A 3N7LA 1BFBA 5DVHA 4QD2B 5B2HA 4HJJA 5BQUA 1BLDA 3FUQA 1G9CA 4EEEB 1FWUA 3K1XA 4OUJA 3CA1A 4ZFYB 4F34A 4JQ0A 1S0LA 2DRZA 4QKRA 2LIEA 1XG6A 3AH2A 2F8XC 2FGFA 1TWEA 3RMYA 4X37A 2RSTA 3BA7A 2X2TA 4LO1A 4X39A 2J3PA 4OEFA 3AJ5A 2X2SA 1AF9A 2RG9B 2P39A 1JT5A 1UPSA 1J0SA 2XOAA 2DS0A 2HWAA 3CA0A 4LO3C 5BVPI 1KNMA 5D62A 3H6SE 1YF8B 1YTOA 1G9AA 4ZGRB 1G9DA 1BFCA 1AVWB 4J2YA 4G6JA 2VSAA 4GOVA 5BOWA 3FJ9A 3BAGA 4QO3A 2I1BA 2P23A 1DIWA 1FMMS 1S0EA 1P63A 1ABRB 1ISXA 3D7WB 3H6QA 3ILAA 4JKQA 4GOYA 5GAQA 3WO4A 1BFFA 2LIQA 1S0DA 2K8RA 3UD9A 4LO0C 2ESUA 4OEGA 4EFPA 1SR4A 2Z49A 3S8KA 2D22A 4A7YA 3OJMA 4GAFA 2NP0A 1DQOA 3FJHA 31BIA 3BRFA 5BP5C 3OJ2A 4P6AA 4G6MA 1S0BA 1NZKA 3FJKA 2VSEA 2MC2A 2RQ9A 3AJ6A 5E24E 1N4KA 3E8LC 1JLXA 4ZBVB 3ZC8A 2QN4A 1HIBA 4WBCA 2ET2A 3FGMA 4D0ZA 21BIA 1M16A 4I4RA 4L4IA 5EHAA 5BXSA 4IYBA 3F1RA 3F62B 3BRDA 1BASA 3VWCA 1Q04A 2FO1A 2K4AB 2GZBA 2ZR1B 5FZYA 3FJEA 3O3QA 3SNVA 1JT3A 3Q7XA 4IY9A 1BLAA 1HWPB 1MC9A 1WD3A 3Q7WA 4X38A 5DSSB 5I1BA 1QQKA 1XZZA 4FGFA 4KBBA 3O4AA 3UDAA 1DQGA 4KEKA 1DLLA 4LO3A 1DJSB 1EPWA 3A21A 1JLYA 3AKFA 1T4QA 3BB2A 3CQAA 2K43A 1EVTA 1FV3A 1PWAA 4J2SA 1JT7A 5D61A 4I7IA 1BARA 1W3GA 3EF2A 3NJ5A 3PHZA 2D1ZA 1YYNA 4OWJA 1ILR1 3O49A 2YUGA 3N7MA 3CA4A 1OQLB 1I1BA 4QC4A 1AVXB 2NZ9A 3KMVA 3O5WB 2KLLA 3RTIB 4LO0A 3H6RA 4JPZA 1TTUA 7I1BA 3AKHA 3BAUA 3CA5A 2WBCA 1TP0A 3NBCA 4I3NA 4KC3A 1Z4SA 1IT0A 2D7RA 4I4XA 1AVUA 4IQPA 4L4HA 3IAGC 4IZEA 4EFRA 4I37A 3BA4A 4X3AA 3OBRA 3R4SA 4HR6C 2QYIB 2IWTB 3A23A 4AN6A 2M49A 2NVHA 1IJTA 3NBDA 2HZ9A 4ZOTA 4J2XA 4QD2C 1ISWA 1RZOB 1IRAX 1ISVA 1FGAA 1Q1UA 4FVVA 4IY8A 1G82A 2VUAA 2AFGA 3WO2A 3HN1A 4OEEA 2BEBA 4G9MA 2BEAA 1ISZA 3BAVA 3PUBA 3UD8A 2AQZA 4P0LA 4YOLA 5G00A 3CRHA 1PUUB 3O4DA 4ISQA 1VCLA 1II4A 1FN0A 4TLPA 1TWMA 3N7KA 4ENDA 3I2XA 1E0OA 3HBWA 3TC2A 1BFGA 2Y9GA 3BAOA 4OW4A 4QALA 2L5XA 4II0A 2NTDA 1DFCA 2D44A 3BX1C 3O4BA 4LO2C 1IHKA 1W3FA 4DENA 3V0BA 4CJMA 3RTJB 1JQZA 4ZLBB 3T8SA 3AKGA 5DZUA 4I4UA 3OGGA 4XFUA 5EC5A 4I1EA 4QKSA 4AN7B 3IM6A 2DRYA 4QBVA 2KKIA 1T9FA 5BXTA 1Q03A 2AXMA 1YXWA 3FJBA 1S0CA 1RMLA 1W3AA 4EFQA 2BFHA 3VT1A 2UUSA 3ZXGA 3OBTA 4I4SA 3POKA 2R9KB 3FJ8A 2F2FC 2Y9FA 1EV2A 1RY7A 1IILA 3VSFA 2AAIB 1D0HA 1DZCA 2Y9WC 3P6JA 1L2HA 1HWNB 2WRYA 3JRRA 4I0YA 2ZQNA 2E4MC 1K5VA 3N7JA 1ITBA 3VSZA 1R8NA 5HPZA 1HWOB 4DEPA 4LO8B 3CA6A 1V6UA 4H9WA 4LO7C 4Q9PA 2Y9XE 3HOMA 5F90A 1AVAC 3LTQA 4ZKTB 3JUTA 3HSMA 3QR5A 3V0AA 3LLPA 4XFTA 1JT4A 1MD6A 3VUOA 3V0BB 1FWVA 2D20A 4I1BA 1JTCA 3MALA 2DREA 4GP0A 3R4UA 4G1RA 2KH2A 5FNXA 5EG6C 5BXRA 3NBNA 1M2TB 1PZZA 3O4CA 3O44A 3NBEA 1CVSA 1DFQA 4HA2A 5BP5A 4JAWA 4LO2A 3AH4A 1HCEA 3I2AA 4GAIA 1JY0A 4EKXB 3UD7A 8I1BA 3VT2A 1ISYA 1FMZA 4OWKA 1TIEA 4KEIA 3ZC9A 2D24A 3FFZA 4I6IA 3FJAA 3QYDA 3CU1B 3BA5A 4ZFWB 1PUMB 3FUOA 2Z48A 3AZWA 4H04A 4Q9GA 5F8WA 3A07A 4I4VA 5FZUA 4EB2B 1F31A 4Z8SB 1ONKB 4DCKC 3PG0A 5F8SA 3AZVA 1HCDA 2F2FA 3N0KA 3OGFA 3WMUA 1HKNA 3B9UA 2HW9A 4I4YA 3V0AB 4QBCA 4F83A 4ISRA 5DUYA 3WINC 4I4PA 4IONA 2IHOA 2E4MA 3VT0A 3AH1A 3BTAA 3H6RB 2ERMA 3Q7YA 2D23A 5JLVA 1QXMA 4XFSA 4KEJA 3HMYA 1DZDA 4I4QA 2HWMA 41BIA 1YBIA 5FNWA 9ILBA 2FDBM 4J2KA 4ZFUB 2KI6B 1IRPA 3I29B 1S0FA 4Q91A 5F8YA 3MPPG 4JP0A 1XHBA 3IIRA 2D7IA 4IHZA 4A7ZA 1TFMB 3PMEA 1CE7B 2FFVA 4I2SA 1G9BA 5BQUC 4USOA 4USPA 4P0KA 6I1BA 3V79C 4ZA3B 1HWMB 3P6IA 1V6VA 3FJFA 4JKXB 2GO2A 4LO1C 3IM5A 3HALA 3BRGC 3FJJA 2VU9A 4P0JA 4R6UB 1AXMA 1K5UA 4A7KA 2KI4A 1QQLA 2MLLB 4G9NA 3ZXDA 2MIBA 2VLCA 3BADA 3O4OA 2VXTI 3C9ZA 4I96A 1A8DA 4XKIA 2NM1A 1TOOA 3A22A 4D0TA 3P53A 3CRIA 1FQ9A 2D43A 3ZX7A 1V6XA 3CA3A 4LO7B 3CAHA 2ZQOA 3FJCA 3OJVA 3S8JA 1PC8B 3UJ0A 4JRAA 3CRGA 1WBCA 4I4OA 1Z2VA 3UJ4A 1WBAA 5JMCA 1FV2A 1SR4C 1GGPB 1XYFA 3FJIA 3WINA 3BAHA 3WA1A 4PC4A
chains in the Genus database with same CATH superfamily
1S0GA 3VEQA 4IZXA 1R8OA 2Q9XA 1NUNA 1EYLA 1SZ6B 1V6WA 2VXRA 1BA7A 3W9TA 4GP3A 4J23B 5FZZA 2Q3NB 3WMVA 4Z9WB 3BAQA 2FFUA 1I1EA 2NYYA 3AKIA 1AFCA 4D8HA 5D63A 4I8MA 1WD4A 3RSJA 1IOBA 3FJDA 1Z0HA 4OWLA 3RMXA 3IM7A 3WO3A 5BXPA 1RG8A 3N7LA 1BFBA 5DVHA 4QD2B 5B2HA 4HJJA 5BQUA 1BLDA 3FUQA 1G9CA 4EEEB 1FWUA 3K1XA 4OUJA 3CA1A 4ZFYB 4F34A 4JQ0A 1S0LA 2DRZA 4QKRA 2LIEA 1XG6A 3AH2A 2F8XC 2FGFA 1TWEA 3RMYA 4X37A 2RSTA 3BA7A 2X2TA 4LO1A 4X39A 2J3PA 4OEFA 3AJ5A 2X2SA 1AF9A 2RG9B 2P39A 1JT5A 1UPSA 1J0SA 2XOAA 2DS0A 2HWAA 3CA0A 4LO3C 5BVPI 1KNMA 5D62A 3H6SE 1YF8B 1YTOA 1G9AA 4ZGRB 1G9DA 1BFCA 1AVWB 4J2YA 4G6JA 2VSAA 4GOVA 5BOWA 3FJ9A 3BAGA 4QO3A 2I1BA 2P23A 1DIWA 1FMMS 1S0EA 1P63A 1ABRB 1ISXA 3D7WB 3H6QA 3ILAA 4JKQA 4GOYA 5GAQA 3WO4A 1BFFA 2LIQA 1S0DA 2K8RA 3UD9A 4LO0C 2ESUA 4OEGA 4EFPA 1SR4A 2Z49A 3S8KA 2D22A 2NS2A 4A7YA 3OJMA 4GAFA 2NP0A 1DQOA 3FJHA 31BIA 3BRFA 5BP5C 3OJ2A 4P6AA 4G6MA 4MZGB 1S0BA 1NZKA 3FJKA 2VSEA 2MC2A 2RQ9A 3AJ6A 5E24E 1N4KA 3E8LC 1JLXA 4ZBVB 3ZC8A 2QN4A 1HIBA 4WBCA 2ET2A 3FGMA 4D0ZA 21BIA 1M16A 4I4RA 4L4IA 5EHAA 5BXSA 4IYBA 3F1RA 3F62B 3BRDA 1BASA 3VWCA 1Q04A 2FO1A 2K4AB 2GZBA 2ZR1B 5FZYA 3FJEA 3O3QA 3SNVA 1JT3A 3Q7XA 4IY9A 1BLAA 1HWPB 1MC9A 1WD3A 3Q7WA 4X38A 5DSSB 5I1BA 1QQKA 1XZZA 4FGFA 4KBBA 3O4AA 3UDAA 1DQGA 4KEKA 1DLLA 4LO3A 1DJSB 1EPWA 3A21A 1JLYA 3AKFA 1T4QA 3BB2A 3CQAA 2K43A 1EVTA 1FV3A 1PWAA 4J2SA 1JT7A 5D61A 4I7IA 1BARA 1W3GA 3EF2A 3NJ5A 3PHZA 2D1ZA 1YYNA 4OWJA 1ILR1 3O49A 2YUGA 3N7MA 3CA4A 1OQLB 1I1BA 4QC4A 1AVXB 2NZ9A 3KMVA 3O5WB 2KLLA 3RTIB 4LO0A 3H6RA 4JPZA 1TTUA 7I1BA 3AKHA 3BAUA 3CA5A 2WBCA 1TP0A 3NBCA 4I3NA 4KC3A 1Z4SA 1IT0A 2D7RA 4I4XA 1AVUA 4IQPA 4L4HA 3IAGC 4IZEA 4EFRA 4I37A 3BA4A 4X3AA 3OBRA 3R4SA 4HR6C 2QYIB 2IWTB 3A23A 4AN6A 2M49A 2NVHA 1IJTA 3NBDA 2HZ9A 4ZOTA 4J2XA 4QD2C 1ISWA 1RZOB 1IRAX 1ISVA 1FGAA 1Q1UA 4FVVA 4IY8A 1G82A 2VUAA 2AFGA 4MZHA 3WO2A 3HN1A 4OEEA 2BEBA 4G9MA 2BEAA 1ISZA 3BAVA 3PUBA 3UD8A 2AQZA 4P0LA 4YOLA 5G00A 3CRHA 1PUUB 3O4DA 4ISQA 1VCLA 1II4A 1FN0A 4TLPA 1TWMA 3N7KA 4ENDA 3I2XA 1E0OA 3HBWA 3TC2A 1BFGA 4UY4A 2Y9GA 3BAOA 4OW4A 4QALA 2L5XA 4II0A 2NTDA 1DFCA 2D44A 3BX1C 3O4BA 4LO2C 1IHKA 1W3FA 4DENA 3V0BA 4CJMA 3RTJB 1JQZA 4ZLBB 3T8SA 3AKGA 5DZUA 4I4UA 3OGGA 4XFUA 5EC5A 4I1EA 4QKSA 4AN7B 3IM6A 2DRYA 4QBVA 2KKIA 1T9FA 5BXTA 1Q03A 2AXMA 1YXWA 3FJBA 1S0CA 1RMLA 1W3AA 4EFQA 2BFHA 3VT1A 2UUSA 3ZXGA 3OBTA 4I4SA 3POKA 2R9KB 3FJ8A 2F2FC 2Y9FA 1EV2A 1RY7A 1IILA 3VSFA 2AAIB 1D0HA 1DZCA 2Y9WC 3P6JA 1L2HA 1HWNB 2WRYA 3JRRA 4I0YA 2ZQNA 2E4MC 1K5VA 3N7JA 1ITBA 3VSZA 1R8NA 5HPZA 1HWOB 4DEPA 4LO8B 3CA6A 1V6UA 4H9WA 4LO7C 4Q9PA 2Y9XE 3HOMA 5F90A 1AVAC 3LTQA 4ZKTB 3JUTA 3HSMA 3QR5A 3V0AA 3LLPA 4XFTA 1JT4A 1MD6A 3VUOA 3V0BB 1FWVA 2D20A 4I1BA 1JTCA 3MALA 2DREA 4GP0A 3R4UA 4G1RA 2KH2A 5FNXA 5EG6C 5BXRA 3NBNA 1M2TB 1PZZA 3O4CA 3O44A 3NBEA 1CVSA 1DFQA 4HA2A 5BP5A 4JAWA 4LO2A 3AH4A 1HCEA 3I2AA 4GAIA 1JY0A 4EKXB 3UD7A 8I1BA 3VT2A 1ISYA 1FMZA 4OWKA 1TIEA 4KEIA 4MZFB 2D24A 3ZC9A 3FFZA 4I6IA 3FJAA 3QYDA 3CU1B 3BA5A 4ZFWB 1PUMB 3FUOA 2Z48A 3AZWA 4H04A 4Q9GA 5F8WA 3A07A 4I4VA 5FZUA 4EB2B 1F31A 4Z8SB 1ONKB 4DCKC 3PG0A 5F8SA 4H75A 3AZVA 1HCDA 2F2FA 3N0KA 3OGFA 3WMUA 1HKNA 3B9UA 2HW9A 4I4YA 3V0AB 4QBCA 4F83A 4ISRA 5DUYA 3WINC 4I4PA 4IONA 2IHOA 2E4MA 3VT0A 3AH1A 3BTAA 3H6RB 2ERMA 3Q7YA 2D23A 5JLVA 1QXMA 4XFSA 4KEJA 3HMYA 1DZDA 4I4QA 2HWMA 41BIA 1YBIA 5FNWA 9ILBA 2FDBM 4J2KA 4ZFUB 2KI6B 1IRPA 3I29B 1S0FA 4Q91A 5F8YA 3MPPG 4JP0A 1XHBA 3IIRA 2D7IA 4IHZA 4A7ZA 1TFMB 3PMEA 1CE7B 2FFVA 4I2SA 1G9BA 5BQUC 4USOA 4USPA 4P0KA 6I1BA 3V79C 4ZA3B 1HWMB 3P6IA 1V6VA 3FJFA 4JKXB 2GO2A 4LO1C 3IM5A 3HALA 3BRGC 3FJJA 2VU9A 4P0JA 4R6UB 1AXMA 1K5UA 4A7KA 2KI4A 1QQLA 2MLLB 4G9NA 3ZXDA 2MIBA 2VLCA 3BADA 3O4OA 2VXTI 3C9ZA 4I96A 1A8DA 4XKIA 2NM1A 1TOOA 3A22A 4D0TA 3P53A 3CRIA 1FQ9A 2D43A 3ZX7A 1V6XA 3CA3A 4LO7B 3CAHA 2ZQOA 3FJCA 3OJVA 3S8JA 1PC8B 3UJ0A 4JRAA 3CRGA 1WBCA 4I4OA 1Z2VA 3UJ4A 1WBAA 5JMCA 1FV2A 1SR4C 1GGPB 1XYFA 3FJIA 3WINA 3BAHA 3WA1A 4PC4A
chains in the Genus database with same CATH topology
1S0GA 3VEQA 4IZXA 1R8OA 2Q9XA 1NUNA 1EYLA 1SZ6B 1V6WA 2VXRA 1BA7A 3W9TA 4GP3A 4J23B 5FZZA 2Q3NB 3WMVA 4Z9WB 3BAQA 2FFUA 1I1EA 2NYYA 3AKIA 1AFCA 4D8HA 5D63A 4I8MA 1WD4A 3RSJA 1IOBA 3FJDA 1Z0HA 4OWLA 3RMXA 3IM7A 3WO3A 5BXPA 1RG8A 3N7LA 1BFBA 5DVHA 4QD2B 5B2HA 4HJJA 5BQUA 1BLDA 3FUQA 1G9CA 4EEEB 1FWUA 3K1XA 4OUJA 3CA1A 4ZFYB 4F34A 4JQ0A 1S0LA 2DRZA 4QKRA 2LIEA 1XG6A 3AH2A 2F8XC 2FGFA 1TWEA 3RMYA 4X37A 2RSTA 3BA7A 2X2TA 4LO1A 4X39A 2J3PA 4OEFA 3AJ5A 2X2SA 1AF9A 2RG9B 2P39A 1JT5A 1UPSA 1J0SA 2XOAA 2DS0A 2HWAA 3CA0A 4LO3C 5BVPI 1KNMA 5D62A 3H6SE 1YF8B 1YTOA 1G9AA 4ZGRB 1G9DA 1BFCA 1AVWB 4J2YA 4G6JA 2VSAA 4GOVA 5BOWA 3FJ9A 3BAGA 4QO3A 2I1BA 2P23A 1DIWA 1FMMS 1S0EA 1P63A 1ABRB 1ISXA 3D7WB 3H6QA 3ILAA 4JKQA 4GOYA 5GAQA 3WO4A 1BFFA 2LIQA 1S0DA 2K8RA 3UD9A 4LO0C 2ESUA 4OEGA 4EFPA 1SR4A 2Z49A 3S8KA 2D22A 2NS2A 4A7YA 3OJMA 4GAFA 2NP0A 1DQOA 3FJHA 31BIA 3BRFA 5BP5C 3OJ2A 4P6AA 4G6MA 4MZGB 1S0BA 1NZKA 3FJKA 2VSEA 2MC2A 2RQ9A 3AJ6A 5E24E 1N4KA 3E8LC 1JLXA 4ZBVB 3ZC8A 2QN4A 1HIBA 4WBCA 2ET2A 3FGMA 4D0ZA 21BIA 1M16A 4I4RA 4L4IA 5EHAA 5BXSA 4IYBA 3F1RA 3F62B 3BRDA 1BASA 3VWCA 1Q04A 2FO1A 2K4AB 2GZBA 2ZR1B 5FZYA 3FJEA 3O3QA 3SNVA 1JT3A 3Q7XA 4IY9A 1BLAA 1HWPB 1MC9A 1WD3A 3Q7WA 4X38A 5DSSB 5I1BA 1QQKA 1XZZA 4FGFA 4KBBA 3O4AA 3UDAA 1DQGA 4KEKA 1DLLA 4LO3A 1DJSB 1EPWA 3A21A 1JLYA 3AKFA 1T4QA 3BB2A 3CQAA 2K43A 1EVTA 1FV3A 1PWAA 4J2SA 1JT7A 5D61A 4I7IA 1BARA 1W3GA 3EF2A 3NJ5A 3PHZA 2D1ZA 1YYNA 4OWJA 1ILR1 3O49A 2YUGA 3N7MA 3CA4A 1OQLB 1I1BA 4QC4A 1AVXB 2NZ9A 3KMVA 3O5WB 2KLLA 3RTIB 4LO0A 3H6RA 4JPZA 1TTUA 7I1BA 3AKHA 3BAUA 3CA5A 2WBCA 1TP0A 3NBCA 4I3NA 4KC3A 1Z4SA 1IT0A 2D7RA 4I4XA 1AVUA 4IQPA 4L4HA 3IAGC 4IZEA 4EFRA 4I37A 3BA4A 4X3AA 3OBRA 3R4SA 4HR6C 2QYIB 2IWTB 3A23A 4AN6A 2M49A 2NVHA 1IJTA 3NBDA 2HZ9A 4ZOTA 4J2XA 4QD2C 1ISWA 1RZOB 1IRAX 1ISVA 1FGAA 1Q1UA 4FVVA 4IY8A 1G82A 2VUAA 2AFGA 4MZHA 3WO2A 3HN1A 4OEEA 2BEBA 4G9MA 2BEAA 1ISZA 3BAVA 3PUBA 3UD8A 2AQZA 4P0LA 4YOLA 5G00A 3CRHA 1PUUB 3O4DA 4ISQA 1VCLA 1II4A 1FN0A 4TLPA 1TWMA 3N7KA 4ENDA 3I2XA 1E0OA 3HBWA 3TC2A 1BFGA 4UY4A 2Y9GA 3BAOA 4OW4A 4QALA 2L5XA 4II0A 2NTDA 1DFCA 2D44A 3BX1C 3O4BA 4LO2C 1IHKA 1W3FA 4DENA 3V0BA 4CJMA 3RTJB 1JQZA 4ZLBB 3T8SA 3AKGA 5DZUA 4I4UA 3OGGA 4XFUA 5EC5A 4I1EA 4QKSA 4AN7B 3IM6A 2DRYA 4QBVA 2KKIA 1T9FA 5BXTA 1Q03A 2AXMA 1YXWA 3FJBA 1S0CA 1RMLA 1W3AA 4EFQA 2BFHA 3VT1A 2UUSA 3ZXGA 3OBTA 4I4SA 3POKA 2R9KB 3FJ8A 2F2FC 2Y9FA 1EV2A 1RY7A 1IILA 3VSFA 2AAIB 1D0HA 1DZCA 2Y9WC 3P6JA 1L2HA 1HWNB 2WRYA 3JRRA 4I0YA 2ZQNA 2E4MC 1K5VA 3N7JA 1ITBA 3VSZA 1R8NA 5HPZA 1HWOB 4DEPA 4LO8B 3CA6A 1V6UA 4H9WA 4LO7C 4Q9PA 2Y9XE 3HOMA 5F90A 1AVAC 3LTQA 4ZKTB 3JUTA 3HSMA 3QR5A 3V0AA 3LLPA 4XFTA 1JT4A 1MD6A 3VUOA 3V0BB 1FWVA 2D20A 4I1BA 1JTCA 3MALA 2DREA 4GP0A 3R4UA 4G1RA 2KH2A 5FNXA 5EG6C 5BXRA 3NBNA 1M2TB 1PZZA 3O4CA 3O44A 3NBEA 1CVSA 1DFQA 4HA2A 5BP5A 4JAWA 4LO2A 3AH4A 1HCEA 3I2AA 4GAIA 1JY0A 4EKXB 3UD7A 8I1BA 3VT2A 1ISYA 1FMZA 4OWKA 1TIEA 4KEIA 4MZFB 2D24A 3ZC9A 3FFZA 4I6IA 3FJAA 3QYDA 3CU1B 3BA5A 4ZFWB 1PUMB 3FUOA 2Z48A 3AZWA 4H04A 4Q9GA 5F8WA 3A07A 4I4VA 5FZUA 4EB2B 1F31A 4Z8SB 1ONKB 4DCKC 3PG0A 5F8SA 4H75A 3AZVA 1HCDA 2F2FA 3N0KA 3OGFA 3WMUA 1HKNA 3B9UA 2HW9A 4I4YA 3V0AB 4QBCA 4F83A 4ISRA 5DUYA 3WINC 4I4PA 4IONA 2IHOA 2E4MA 3VT0A 3AH1A 3BTAA 3H6RB 2ERMA 3Q7YA 2D23A 5JLVA 1QXMA 4XFSA 4KEJA 3HMYA 1DZDA 4I4QA 2HWMA 41BIA 1YBIA 5FNWA 9ILBA 2FDBM 4J2KA 4ZFUB 2KI6B 1IRPA 3I29B 1S0FA 4Q91A 5F8YA 3MPPG 4JP0A 1XHBA 3IIRA 2D7IA 4IHZA 4A7ZA 1TFMB 3PMEA 1CE7B 2FFVA 4I2SA 1G9BA 5BQUC 4USOA 4USPA 4P0KA 6I1BA 3V79C 4ZA3B 1HWMB 3P6IA 1V6VA 3FJFA 4JKXB 2GO2A 4LO1C 3IM5A 3HALA 3BRGC 3FJJA 2VU9A 4P0JA 4R6UB 1AXMA 1K5UA 4A7KA 2KI4A 1QQLA 2MLLB 4G9NA 3ZXDA 2MIBA 2VLCA 3BADA 3O4OA 2VXTI 3C9ZA 4I96A 1A8DA 4XKIA 2NM1A 1TOOA 3A22A 4D0TA 3P53A 3CRIA 1FQ9A 2D43A 3ZX7A 1V6XA 3CA3A 4LO7B 3CAHA 2ZQOA 3FJCA 3OJVA 3S8JA 1PC8B 3UJ0A 4JRAA 3CRGA 1WBCA 4I4OA 1Z2VA 3UJ4A 1WBAA 5JMCA 1FV2A 1SR4C 1GGPB 1XYFA 3FJIA 3WINA 3BAHA 3WA1A 4PC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0G A;  3VEQ A;  4IZX A;  1R8O A;  2Q9X A;  1NUN A;  1EYL A;  1SZ6 B;  1V6W A;  2VXR A;  1BA7 A;  3W9T A;  4GP3 A;  4J23 B;  5FZZ A;  2Q3N B;  3WMV A;  4Z9W B;  3BAQ A;  2FFU A;  1I1E A;  2NYY A;  3AKI A;  1AFC A;  4D8H A;  5D63 A;  4I8M A;  1WD4 A;  3RSJ A;  1IOB A;  3FJD A;  1Z0H A;  4OWL A;  3RMX A;  3IM7 A;  3WO3 A;  5BXP A;  1RG8 A;  3N7L A;  1BFB A;  5DVH A;  4QD2 B;  5B2H A;  4HJJ A;  5BQU A;  1BLD A;  3FUQ A;  1G9C A;  4EEE B;  1FWU A;  3K1X A;  4OUJ A;  3CA1 A;  4ZFY B;  4F34 A;  4JQ0 A;  1S0L A;  2DRZ A;  4QKR A;  2LIE A;  1XG6 A;  3AH2 A;  2F8X C;  2FGF A;  1TWE A;  3RMY A;  4X37 A;  2RST A;  3BA7 A;  2X2T A;  4LO1 A;  4X39 A;  2J3P A;  4OEF A;  3AJ5 A;  2X2S A;  1AF9 A;  2RG9 B;  2P39 A;  1JT5 A;  1UPS A;  1J0S A;  2XOA A;  2DS0 A;  2HWA A;  3CA0 A;  4LO3 C;  5BVP I;  1KNM A;  5D62 A;  3H6S E;  1YF8 B;  1YTO A;  1G9A A;  4ZGR B;  1G9D A;  1BFC A;  1AVW B;  4J2Y A;  4G6J A;  2VSA A;  4GOV A;  5BOW A;  3FJ9 A;  3BAG A;  4QO3 A;  2I1B A;  2P23 A;  1DIW A;  1FMM S;  1S0E A;  1P63 A;  1ABR B;  1ISX A;  3D7W B;  3H6Q A;  3ILA A;  4JKQ A;  4GOY A;  5GAQ A;  3WO4 A;  1BFF A;  2LIQ A;  1S0D A;  2K8R A;  3UD9 A;  4LO0 C;  2ESU A;  4OEG A;  4EFP A;  1SR4 A;  2Z49 A;  3S8K A;  2D22 A;  4A7Y A;  3OJM A;  4GAF A;  2NP0 A;  1DQO A;  3FJH A;  31BI A;  3BRF A;  5BP5 C;  3OJ2 A;  4P6A A;  4G6M A;  1S0B A;  1NZK A;  3FJK A;  2VSE A;  2MC2 A;  2RQ9 A;  3AJ6 A;  5E24 E;  1N4K A;  3E8L C;  1JLX A;  4ZBV B;  3ZC8 A;  2QN4 A;  1HIB A;  4WBC A;  2ET2 A;  3FGM A;  4D0Z A;  21BI A;  1M16 A;  4I4R A;  4L4I A;  5EHA A;  5BXS A;  4IYB A;  3F1R A;  3F62 B;  3BRD A;  1BAS A;  3VWC A;  1Q04 A;  2FO1 A;  2K4A B;  2GZB A;  2ZR1 B;  5FZY A;  3FJE A;  3O3Q A;  3SNV A;  1JT3 A;  3Q7X A;  4IY9 A;  1BLA A;  1HWP B;  1MC9 A;  1WD3 A;  3Q7W A;  4X38 A;  5DSS B;  5I1B A;  1QQK A;  1XZZ A;  4FGF A;  4KBB A;  3O4A A;  3UDA A;  1DQG A;  4KEK A;  1DLL A;  4LO3 A;  1DJS B;  1EPW A;  3A21 A;  1JLY A;  3AKF A;  1T4Q A;  3BB2 A;  3CQA A;  2K43 A;  1EVT A;  1FV3 A;  1PWA A;  4J2S A;  1JT7 A;  5D61 A;  4I7I A;  1BAR A;  1W3G A;  3EF2 A;  3NJ5 A;  3PHZ A;  2D1Z A;  1YYN A;  4OWJ A;  1ILR 1;  3O49 A;  2YUG A;  3N7M A;  3CA4 A;  1OQL B;  1I1B A;  4QC4 A;  1AVX B;  2NZ9 A;  3KMV A;  3O5W B;  2KLL A;  3RTI B;  4LO0 A;  3H6R A;  4JPZ A;  1TTU A;  7I1B A;  3AKH A;  3BAU A;  3CA5 A;  2WBC A;  1TP0 A;  3NBC A;  4I3N A;  4KC3 A;  1Z4S A;  1IT0 A;  2D7R A;  4I4X A;  1AVU A;  4IQP A;  4L4H A;  3IAG C;  4IZE A;  4EFR A;  4I37 A;  3BA4 A;  4X3A A;  3OBR A;  3R4S A;  4HR6 C;  2QYI B;  2IWT B;  3A23 A;  4AN6 A;  2M49 A;  2NVH A;  1IJT A;  3NBD A;  2HZ9 A;  4ZOT A;  4J2X A;  4QD2 C;  1ISW A;  1RZO B;  1IRA X;  1ISV A;  1FGA A;  1Q1U A;  4FVV A;  4IY8 A;  1G82 A;  2VUA A;  2AFG A;  3WO2 A;  3HN1 A;  4OEE A;  2BEB A;  4G9M A;  2BEA A;  1ISZ A;  3BAV A;  3PUB A;  3UD8 A;  2AQZ A;  4P0L A;  4YOL A;  5G00 A;  3CRH A;  1PUU B;  3O4D A;  4ISQ A;  1VCL A;  1II4 A;  1FN0 A;  4TLP A;  1TWM A;  3N7K A;  4END A;  3I2X A;  1E0O A;  3HBW A;  3TC2 A;  1BFG A;  2Y9G A;  3BAO A;  4OW4 A;  4QAL A;  2L5X A;  4II0 A;  2NTD A;  1DFC A;  2D44 A;  3BX1 C;  3O4B A;  4LO2 C;  1IHK A;  1W3F A;  4DEN A;  3V0B A;  4CJM A;  3RTJ B;  1JQZ A;  4ZLB B;  3T8S A;  3AKG A;  5DZU A;  4I4U A;  3OGG A;  4XFU A;  5EC5 A;  4I1E A;  4QKS A;  4AN7 B;  3IM6 A;  2DRY A;  4QBV A;  2KKI A;  1T9F A;  5BXT A;  1Q03 A;  2AXM A;  1YXW A;  3FJB A;  1S0C A;  1RML A;  1W3A A;  4EFQ A;  2BFH A;  3VT1 A;  2UUS A;  3ZXG A;  3OBT A;  4I4S A;  3POK A;  2R9K B;  3FJ8 A;  2F2F C;  2Y9F A;  1EV2 A;  1RY7 A;  1IIL A;  3VSF A;  2AAI B;  1D0H A;  1DZC A;  2Y9W C;  3P6J A;  1L2H A;  1HWN B;  2WRY A;  3JRR A;  4I0Y A;  2ZQN A;  2E4M C;  1K5V A;  3N7J A;  1ITB A;  3VSZ A;  1R8N A;  5HPZ A;  1HWO B;  4DEP A;  4LO8 B;  3CA6 A;  1V6U A;  4H9W A;  4LO7 C;  4Q9P A;  2Y9X E;  3HOM A;  5F90 A;  1AVA C;  3LTQ A;  4ZKT B;  3JUT A;  3HSM A;  3QR5 A;  3V0A A;  3LLP A;  4XFT A;  1JT4 A;  1MD6 A;  3VUO A;  3V0B B;  1FWV A;  2D20 A;  4I1B A;  1JTC A;  3MAL A;  2DRE A;  4GP0 A;  3R4U A;  4G1R A;  2KH2 A;  5FNX A;  5EG6 C;  5BXR A;  3NBN A;  1M2T B;  1PZZ A;  3O4C A;  3O44 A;  3NBE A;  1CVS A;  1DFQ A;  4HA2 A;  5BP5 A;  4JAW A;  4LO2 A;  3AH4 A;  1HCE A;  3I2A A;  4GAI A;  1JY0 A;  4EKX B;  3UD7 A;  8I1B A;  3VT2 A;  1ISY A;  1FMZ A;  4OWK A;  1TIE A;  4KEI A;  3ZC9 A;  2D24 A;  3FFZ A;  4I6I A;  3FJA A;  3QYD A;  3CU1 B;  3BA5 A;  4ZFW B;  1PUM B;  3FUO A;  2Z48 A;  3AZW A;  4H04 A;  4Q9G A;  5F8W A;  3A07 A;  4I4V A;  5FZU A;  4EB2 B;  1F31 A;  4Z8S B;  1ONK B;  4DCK C;  3PG0 A;  5F8S A;  3AZV A;  1HCD A;  2F2F A;  3N0K A;  3OGF A;  3WMU A;  1HKN A;  3B9U A;  2HW9 A;  4I4Y A;  3V0A B;  4QBC A;  4F83 A;  4ISR A;  5DUY A;  3WIN C;  4I4P A;  4ION A;  2IHO A;  2E4M A;  3VT0 A;  3AH1 A;  3BTA A;  3H6R B;  2ERM A;  3Q7Y A;  2D23 A;  5JLV A;  1QXM A;  4XFS A;  4KEJ A;  3HMY A;  1DZD A;  4I4Q A;  2HWM A;  41BI A;  1YBI A;  5FNW A;  9ILB A;  2FDB M;  4J2K A;  4ZFU B;  2KI6 B;  1IRP A;  3I29 B;  1S0F A;  4Q91 A;  5F8Y A;  3MPP G;  4JP0 A;  1XHB A;  3IIR A;  2D7I A;  4IHZ A;  4A7Z A;  1TFM B;  3PME A;  1CE7 B;  2FFV A;  4I2S A;  1G9B A;  5BQU C;  4USO A;  4USP A;  4P0K A;  6I1B A;  3V79 C;  4ZA3 B;  1HWM B;  3P6I A;  1V6V A;  3FJF A;  4JKX B;  2GO2 A;  4LO1 C;  3IM5 A;  3HAL A;  3BRG C;  3FJJ A;  2VU9 A;  4P0J A;  4R6U B;  1AXM A;  1K5U A;  4A7K A;  2KI4 A;  1QQL A;  2MLL B;  4G9N A;  3ZXD A;  2MIB A;  2VLC A;  3BAD A;  3O4O A;  2VXT I;  3C9Z A;  4I96 A;  1A8D A;  4XKI A;  2NM1 A;  1TOO A;  3A22 A;  4D0T A;  3P53 A;  3CRI A;  1FQ9 A;  2D43 A;  3ZX7 A;  1V6X A;  3CA3 A;  4LO7 B;  3CAH A;  2ZQO A;  3FJC A;  3OJV A;  3S8J A;  1PC8 B;  3UJ0 A;  4JRA A;  3CRG A;  1WBC A;  4I4O A;  1Z2V A;  3UJ4 A;  1WBA A;  5JMC A;  1FV2 A;  1SR4 C;  1GGP B;  1XYF A;  3FJI A;  3WIN A;  3BAH A;  3WA1 A;  4PC4 A; 
#chains in the Genus database with same CATH topology
 1S0G A;  3VEQ A;  4IZX A;  1R8O A;  2Q9X A;  1NUN A;  1EYL A;  1SZ6 B;  1V6W A;  2VXR A;  1BA7 A;  3W9T A;  4GP3 A;  4J23 B;  5FZZ A;  2Q3N B;  3WMV A;  4Z9W B;  3BAQ A;  2FFU A;  1I1E A;  2NYY A;  3AKI A;  1AFC A;  4D8H A;  5D63 A;  4I8M A;  1WD4 A;  3RSJ A;  1IOB A;  3FJD A;  1Z0H A;  4OWL A;  3RMX A;  3IM7 A;  3WO3 A;  5BXP A;  1RG8 A;  3N7L A;  1BFB A;  5DVH A;  4QD2 B;  5B2H A;  4HJJ A;  5BQU A;  1BLD A;  3FUQ A;  1G9C A;  4EEE B;  1FWU A;  3K1X A;  4OUJ A;  3CA1 A;  4ZFY B;  4F34 A;  4JQ0 A;  1S0L A;  2DRZ A;  4QKR A;  2LIE A;  1XG6 A;  3AH2 A;  2F8X C;  2FGF A;  1TWE A;  3RMY A;  4X37 A;  2RST A;  3BA7 A;  2X2T A;  4LO1 A;  4X39 A;  2J3P A;  4OEF A;  3AJ5 A;  2X2S A;  1AF9 A;  2RG9 B;  2P39 A;  1JT5 A;  1UPS A;  1J0S A;  2XOA A;  2DS0 A;  2HWA A;  3CA0 A;  4LO3 C;  5BVP I;  1KNM A;  5D62 A;  3H6S E;  1YF8 B;  1YTO A;  1G9A A;  4ZGR B;  1G9D A;  1BFC A;  1AVW B;  4J2Y A;  4G6J A;  2VSA A;  4GOV A;  5BOW A;  3FJ9 A;  3BAG A;  4QO3 A;  2I1B A;  2P23 A;  1DIW A;  1FMM S;  1S0E A;  1P63 A;  1ABR B;  1ISX A;  3D7W B;  3H6Q A;  3ILA A;  4JKQ A;  4GOY A;  5GAQ A;  3WO4 A;  1BFF A;  2LIQ A;  1S0D A;  2K8R A;  3UD9 A;  4LO0 C;  2ESU A;  4OEG A;  4EFP A;  1SR4 A;  2Z49 A;  3S8K A;  2D22 A;  2NS2 A;  4A7Y A;  3OJM A;  4GAF A;  2NP0 A;  1DQO A;  3FJH A;  31BI A;  3BRF A;  5BP5 C;  3OJ2 A;  4P6A A;  4G6M A;  4MZG B;  1S0B A;  1NZK A;  3FJK A;  2VSE A;  2MC2 A;  2RQ9 A;  3AJ6 A;  5E24 E;  1N4K A;  3E8L C;  1JLX A;  4ZBV B;  3ZC8 A;  2QN4 A;  1HIB A;  4WBC A;  2ET2 A;  3FGM A;  4D0Z A;  21BI A;  1M16 A;  4I4R A;  4L4I A;  5EHA A;  5BXS A;  4IYB A;  3F1R A;  3F62 B;  3BRD A;  1BAS A;  3VWC A;  1Q04 A;  2FO1 A;  2K4A B;  2GZB A;  2ZR1 B;  5FZY A;  3FJE A;  3O3Q A;  3SNV A;  1JT3 A;  3Q7X A;  4IY9 A;  1BLA A;  1HWP B;  1MC9 A;  1WD3 A;  3Q7W A;  4X38 A;  5DSS B;  5I1B A;  1QQK A;  1XZZ A;  4FGF A;  4KBB A;  3O4A A;  3UDA A;  1DQG A;  4KEK A;  1DLL A;  4LO3 A;  1DJS B;  1EPW A;  3A21 A;  1JLY A;  3AKF A;  1T4Q A;  3BB2 A;  3CQA A;  2K43 A;  1EVT A;  1FV3 A;  1PWA A;  4J2S A;  1JT7 A;  5D61 A;  4I7I A;  1BAR A;  1W3G A;  3EF2 A;  3NJ5 A;  3PHZ A;  2D1Z A;  1YYN A;  4OWJ A;  1ILR 1;  3O49 A;  2YUG A;  3N7M A;  3CA4 A;  1OQL B;  1I1B A;  4QC4 A;  1AVX B;  2NZ9 A;  3KMV A;  3O5W B;  2KLL A;  3RTI B;  4LO0 A;  3H6R A;  4JPZ A;  1TTU A;  7I1B A;  3AKH A;  3BAU A;  3CA5 A;  2WBC A;  1TP0 A;  3NBC A;  4I3N A;  4KC3 A;  1Z4S A;  1IT0 A;  2D7R A;  4I4X A;  1AVU A;  4IQP A;  4L4H A;  3IAG C;  4IZE A;  4EFR A;  4I37 A;  3BA4 A;  4X3A A;  3OBR A;  3R4S A;  4HR6 C;  2QYI B;  2IWT B;  3A23 A;  4AN6 A;  2M49 A;  2NVH A;  1IJT A;  3NBD A;  2HZ9 A;  4ZOT A;  4J2X A;  4QD2 C;  1ISW A;  1RZO B;  1IRA X;  1ISV A;  1FGA A;  1Q1U A;  4FVV A;  4IY8 A;  1G82 A;  2VUA A;  2AFG A;  4MZH A;  3WO2 A;  3HN1 A;  4OEE A;  2BEB A;  4G9M A;  2BEA A;  1ISZ A;  3BAV A;  3PUB A;  3UD8 A;  2AQZ A;  4P0L A;  4YOL A;  5G00 A;  3CRH A;  1PUU B;  3O4D A;  4ISQ A;  1VCL A;  1II4 A;  1FN0 A;  4TLP A;  1TWM A;  3N7K A;  4END A;  3I2X A;  1E0O A;  3HBW A;  3TC2 A;  1BFG A;  4UY4 A;  2Y9G A;  3BAO A;  4OW4 A;  4QAL A;  2L5X A;  4II0 A;  2NTD A;  1DFC A;  2D44 A;  3BX1 C;  3O4B A;  4LO2 C;  1IHK A;  1W3F A;  4DEN A;  3V0B A;  4CJM A;  3RTJ B;  1JQZ A;  4ZLB B;  3T8S A;  3AKG A;  5DZU A;  4I4U A;  3OGG A;  4XFU A;  5EC5 A;  4I1E A;  4QKS A;  4AN7 B;  3IM6 A;  2DRY A;  4QBV A;  2KKI A;  1T9F A;  5BXT A;  1Q03 A;  2AXM A;  1YXW A;  3FJB A;  1S0C A;  1RML A;  1W3A A;  4EFQ A;  2BFH A;  3VT1 A;  2UUS A;  3ZXG A;  3OBT A;  4I4S A;  3POK A;  2R9K B;  3FJ8 A;  2F2F C;  2Y9F A;  1EV2 A;  1RY7 A;  1IIL A;  3VSF A;  2AAI B;  1D0H A;  1DZC A;  2Y9W C;  3P6J A;  1L2H A;  1HWN B;  2WRY A;  3JRR A;  4I0Y A;  2ZQN A;  2E4M C;  1K5V A;  3N7J A;  1ITB A;  3VSZ A;  1R8N A;  5HPZ A;  1HWO B;  4DEP A;  4LO8 B;  3CA6 A;  1V6U A;  4H9W A;  4LO7 C;  4Q9P A;  2Y9X E;  3HOM A;  5F90 A;  1AVA C;  3LTQ A;  4ZKT B;  3JUT A;  3HSM A;  3QR5 A;  3V0A A;  3LLP A;  4XFT A;  1JT4 A;  1MD6 A;  3VUO A;  3V0B B;  1FWV A;  2D20 A;  4I1B A;  1JTC A;  3MAL A;  2DRE A;  4GP0 A;  3R4U A;  4G1R A;  2KH2 A;  5FNX A;  5EG6 C;  5BXR A;  3NBN A;  1M2T B;  1PZZ A;  3O4C A;  3O44 A;  3NBE A;  1CVS A;  1DFQ A;  4HA2 A;  5BP5 A;  4JAW A;  4LO2 A;  3AH4 A;  1HCE A;  3I2A A;  4GAI A;  1JY0 A;  4EKX B;  3UD7 A;  8I1B A;  3VT2 A;  1ISY A;  1FMZ A;  4OWK A;  1TIE A;  4KEI A;  4MZF B;  2D24 A;  3ZC9 A;  3FFZ A;  4I6I A;  3FJA A;  3QYD A;  3CU1 B;  3BA5 A;  4ZFW B;  1PUM B;  3FUO A;  2Z48 A;  3AZW A;  4H04 A;  4Q9G A;  5F8W A;  3A07 A;  4I4V A;  5FZU A;  4EB2 B;  1F31 A;  4Z8S B;  1ONK B;  4DCK C;  3PG0 A;  5F8S A;  4H75 A;  3AZV A;  1HCD A;  2F2F A;  3N0K A;  3OGF A;  3WMU A;  1HKN A;  3B9U A;  2HW9 A;  4I4Y A;  3V0A B;  4QBC A;  4F83 A;  4ISR A;  5DUY A;  3WIN C;  4I4P A;  4ION A;  2IHO A;  2E4M A;  3VT0 A;  3AH1 A;  3BTA A;  3H6R B;  2ERM A;  3Q7Y A;  2D23 A;  5JLV A;  1QXM A;  4XFS A;  4KEJ A;  3HMY A;  1DZD A;  4I4Q A;  2HWM A;  41BI A;  1YBI A;  5FNW A;  9ILB A;  2FDB M;  4J2K A;  4ZFU B;  2KI6 B;  1IRP A;  3I29 B;  1S0F A;  4Q91 A;  5F8Y A;  3MPP G;  4JP0 A;  1XHB A;  3IIR A;  2D7I A;  4IHZ A;  4A7Z A;  1TFM B;  3PME A;  1CE7 B;  2FFV A;  4I2S A;  1G9B A;  5BQU C;  4USO A;  4USP A;  4P0K A;  6I1B A;  3V79 C;  4ZA3 B;  1HWM B;  3P6I A;  1V6V A;  3FJF A;  4JKX B;  2GO2 A;  4LO1 C;  3IM5 A;  3HAL A;  3BRG C;  3FJJ A;  2VU9 A;  4P0J A;  4R6U B;  1AXM A;  1K5U A;  4A7K A;  2KI4 A;  1QQL A;  2MLL B;  4G9N A;  3ZXD A;  2MIB A;  2VLC A;  3BAD A;  3O4O A;  2VXT I;  3C9Z A;  4I96 A;  1A8D A;  4XKI A;  2NM1 A;  1TOO A;  3A22 A;  4D0T A;  3P53 A;  3CRI A;  1FQ9 A;  2D43 A;  3ZX7 A;  1V6X A;  3CA3 A;  4LO7 B;  3CAH A;  2ZQO A;  3FJC A;  3OJV A;  3S8J A;  1PC8 B;  3UJ0 A;  4JRA A;  3CRG A;  1WBC A;  4I4O A;  1Z2V A;  3UJ4 A;  1WBA A;  5JMC A;  1FV2 A;  1SR4 C;  1GGP B;  1XYF A;  3FJI A;  3WIN A;  3BAH A;  3WA1 A;  4PC4 A; 
#chains in the Genus database with same CATH homology
 1S0G A;  3VEQ A;  4IZX A;  1R8O A;  2Q9X A;  1NUN A;  1EYL A;  1SZ6 B;  1V6W A;  2VXR A;  1BA7 A;  3W9T A;  4GP3 A;  4J23 B;  5FZZ A;  2Q3N B;  3WMV A;  4Z9W B;  3BAQ A;  2FFU A;  1I1E A;  2NYY A;  3AKI A;  1AFC A;  4D8H A;  5D63 A;  4I8M A;  1WD4 A;  3RSJ A;  1IOB A;  3FJD A;  1Z0H A;  4OWL A;  3RMX A;  3IM7 A;  3WO3 A;  5BXP A;  1RG8 A;  3N7L A;  1BFB A;  5DVH A;  4QD2 B;  5B2H A;  4HJJ A;  5BQU A;  1BLD A;  3FUQ A;  1G9C A;  4EEE B;  1FWU A;  3K1X A;  4OUJ A;  3CA1 A;  4ZFY B;  4F34 A;  4JQ0 A;  1S0L A;  2DRZ A;  4QKR A;  2LIE A;  1XG6 A;  3AH2 A;  2F8X C;  2FGF A;  1TWE A;  3RMY A;  4X37 A;  2RST A;  3BA7 A;  2X2T A;  4LO1 A;  4X39 A;  2J3P A;  4OEF A;  3AJ5 A;  2X2S A;  1AF9 A;  2RG9 B;  2P39 A;  1JT5 A;  1UPS A;  1J0S A;  2XOA A;  2DS0 A;  2HWA A;  3CA0 A;  4LO3 C;  5BVP I;  1KNM A;  5D62 A;  3H6S E;  1YF8 B;  1YTO A;  1G9A A;  4ZGR B;  1G9D A;  1BFC A;  1AVW B;  4J2Y A;  4G6J A;  2VSA A;  4GOV A;  5BOW A;  3FJ9 A;  3BAG A;  4QO3 A;  2I1B A;  2P23 A;  1DIW A;  1FMM S;  1S0E A;  1P63 A;  1ABR B;  1ISX A;  3D7W B;  3H6Q A;  3ILA A;  4JKQ A;  4GOY A;  5GAQ A;  3WO4 A;  1BFF A;  2LIQ A;  1S0D A;  2K8R A;  3UD9 A;  4LO0 C;  2ESU A;  4OEG A;  4EFP A;  1SR4 A;  2Z49 A;  3S8K A;  2D22 A;  2NS2 A;  4A7Y A;  3OJM A;  4GAF A;  2NP0 A;  1DQO A;  3FJH A;  31BI A;  3BRF A;  5BP5 C;  3OJ2 A;  4P6A A;  4G6M A;  4MZG B;  1S0B A;  1NZK A;  3FJK A;  2VSE A;  2MC2 A;  2RQ9 A;  3AJ6 A;  5E24 E;  1N4K A;  3E8L C;  1JLX A;  4ZBV B;  3ZC8 A;  2QN4 A;  1HIB A;  4WBC A;  2ET2 A;  3FGM A;  4D0Z A;  21BI A;  1M16 A;  4I4R A;  4L4I A;  5EHA A;  5BXS A;  4IYB A;  3F1R A;  3F62 B;  3BRD A;  1BAS A;  3VWC A;  1Q04 A;  2FO1 A;  2K4A B;  2GZB A;  2ZR1 B;  5FZY A;  3FJE A;  3O3Q A;  3SNV A;  1JT3 A;  3Q7X A;  4IY9 A;  1BLA A;  1HWP B;  1MC9 A;  1WD3 A;  3Q7W A;  4X38 A;  5DSS B;  5I1B A;  1QQK A;  1XZZ A;  4FGF A;  4KBB A;  3O4A A;  3UDA A;  1DQG A;  4KEK A;  1DLL A;  4LO3 A;  1DJS B;  1EPW A;  3A21 A;  1JLY A;  3AKF A;  1T4Q A;  3BB2 A;  3CQA A;  2K43 A;  1EVT A;  1FV3 A;  1PWA A;  4J2S A;  1JT7 A;  5D61 A;  4I7I A;  1BAR A;  1W3G A;  3EF2 A;  3NJ5 A;  3PHZ A;  2D1Z A;  1YYN A;  4OWJ A;  1ILR 1;  3O49 A;  2YUG A;  3N7M A;  3CA4 A;  1OQL B;  1I1B A;  4QC4 A;  1AVX B;  2NZ9 A;  3KMV A;  3O5W B;  2KLL A;  3RTI B;  4LO0 A;  3H6R A;  4JPZ A;  1TTU A;  7I1B A;  3AKH A;  3BAU A;  3CA5 A;  2WBC A;  1TP0 A;  3NBC A;  4I3N A;  4KC3 A;  1Z4S A;  1IT0 A;  2D7R A;  4I4X A;  1AVU A;  4IQP A;  4L4H A;  3IAG C;  4IZE A;  4EFR A;  4I37 A;  3BA4 A;  4X3A A;  3OBR A;  3R4S A;  4HR6 C;  2QYI B;  2IWT B;  3A23 A;  4AN6 A;  2M49 A;  2NVH A;  1IJT A;  3NBD A;  2HZ9 A;  4ZOT A;  4J2X A;  4QD2 C;  1ISW A;  1RZO B;  1IRA X;  1ISV A;  1FGA A;  1Q1U A;  4FVV A;  4IY8 A;  1G82 A;  2VUA A;  2AFG A;  4MZH A;  3WO2 A;  3HN1 A;  4OEE A;  2BEB A;  4G9M A;  2BEA A;  1ISZ A;  3BAV A;  3PUB A;  3UD8 A;  2AQZ A;  4P0L A;  4YOL A;  5G00 A;  3CRH A;  1PUU B;  3O4D A;  4ISQ A;  1VCL A;  1II4 A;  1FN0 A;  4TLP A;  1TWM A;  3N7K A;  4END A;  3I2X A;  1E0O A;  3HBW A;  3TC2 A;  1BFG A;  4UY4 A;  2Y9G A;  3BAO A;  4OW4 A;  4QAL A;  2L5X A;  4II0 A;  2NTD A;  1DFC A;  2D44 A;  3BX1 C;  3O4B A;  4LO2 C;  1IHK A;  1W3F A;  4DEN A;  3V0B A;  4CJM A;  3RTJ B;  1JQZ A;  4ZLB B;  3T8S A;  3AKG A;  5DZU A;  4I4U A;  3OGG A;  4XFU A;  5EC5 A;  4I1E A;  4QKS A;  4AN7 B;  3IM6 A;  2DRY A;  4QBV A;  2KKI A;  1T9F A;  5BXT A;  1Q03 A;  2AXM A;  1YXW A;  3FJB A;  1S0C A;  1RML A;  1W3A A;  4EFQ A;  2BFH A;  3VT1 A;  2UUS A;  3ZXG A;  3OBT A;  4I4S A;  3POK A;  2R9K B;  3FJ8 A;  2F2F C;  2Y9F A;  1EV2 A;  1RY7 A;  1IIL A;  3VSF A;  2AAI B;  1D0H A;  1DZC A;  2Y9W C;  3P6J A;  1L2H A;  1HWN B;  2WRY A;  3JRR A;  4I0Y A;  2ZQN A;  2E4M C;  1K5V A;  3N7J A;  1ITB A;  3VSZ A;  1R8N A;  5HPZ A;  1HWO B;  4DEP A;  4LO8 B;  3CA6 A;  1V6U A;  4H9W A;  4LO7 C;  4Q9P A;  2Y9X E;  3HOM A;  5F90 A;  1AVA C;  3LTQ A;  4ZKT B;  3JUT A;  3HSM A;  3QR5 A;  3V0A A;  3LLP A;  4XFT A;  1JT4 A;  1MD6 A;  3VUO A;  3V0B B;  1FWV A;  2D20 A;  4I1B A;  1JTC A;  3MAL A;  2DRE A;  4GP0 A;  3R4U A;  4G1R A;  2KH2 A;  5FNX A;  5EG6 C;  5BXR A;  3NBN A;  1M2T B;  1PZZ A;  3O4C A;  3O44 A;  3NBE A;  1CVS A;  1DFQ A;  4HA2 A;  5BP5 A;  4JAW A;  4LO2 A;  3AH4 A;  1HCE A;  3I2A A;  4GAI A;  1JY0 A;  4EKX B;  3UD7 A;  8I1B A;  3VT2 A;  1ISY A;  1FMZ A;  4OWK A;  1TIE A;  4KEI A;  4MZF B;  2D24 A;  3ZC9 A;  3FFZ A;  4I6I A;  3FJA A;  3QYD A;  3CU1 B;  3BA5 A;  4ZFW B;  1PUM B;  3FUO A;  2Z48 A;  3AZW A;  4H04 A;  4Q9G A;  5F8W A;  3A07 A;  4I4V A;  5FZU A;  4EB2 B;  1F31 A;  4Z8S B;  1ONK B;  4DCK C;  3PG0 A;  5F8S A;  4H75 A;  3AZV A;  1HCD A;  2F2F A;  3N0K A;  3OGF A;  3WMU A;  1HKN A;  3B9U A;  2HW9 A;  4I4Y A;  3V0A B;  4QBC A;  4F83 A;  4ISR A;  5DUY A;  3WIN C;  4I4P A;  4ION A;  2IHO A;  2E4M A;  3VT0 A;  3AH1 A;  3BTA A;  3H6R B;  2ERM A;  3Q7Y A;  2D23 A;  5JLV A;  1QXM A;  4XFS A;  4KEJ A;  3HMY A;  1DZD A;  4I4Q A;  2HWM A;  41BI A;  1YBI A;  5FNW A;  9ILB A;  2FDB M;  4J2K A;  4ZFU B;  2KI6 B;  1IRP A;  3I29 B;  1S0F A;  4Q91 A;  5F8Y A;  3MPP G;  4JP0 A;  1XHB A;  3IIR A;  2D7I A;  4IHZ A;  4A7Z A;  1TFM B;  3PME A;  1CE7 B;  2FFV A;  4I2S A;  1G9B A;  5BQU C;  4USO A;  4USP A;  4P0K A;  6I1B A;  3V79 C;  4ZA3 B;  1HWM B;  3P6I A;  1V6V A;  3FJF A;  4JKX B;  2GO2 A;  4LO1 C;  3IM5 A;  3HAL A;  3BRG C;  3FJJ A;  2VU9 A;  4P0J A;  4R6U B;  1AXM A;  1K5U A;  4A7K A;  2KI4 A;  1QQL A;  2MLL B;  4G9N A;  3ZXD A;  2MIB A;  2VLC A;  3BAD A;  3O4O A;  2VXT I;  3C9Z A;  4I96 A;  1A8D A;  4XKI A;  2NM1 A;  1TOO A;  3A22 A;  4D0T A;  3P53 A;  3CRI A;  1FQ9 A;  2D43 A;  3ZX7 A;  1V6X A;  3CA3 A;  4LO7 B;  3CAH A;  2ZQO A;  3FJC A;  3OJV A;  3S8J A;  1PC8 B;  3UJ0 A;  4JRA A;  3CRG A;  1WBC A;  4I4O A;  1Z2V A;  3UJ4 A;  1WBA A;  5JMC A;  1FV2 A;  1SR4 C;  1GGP B;  1XYF A;  3FJI A;  3WIN A;  3BAH A;  3WA1 A;  4PC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...