1EYLA

Structure of a recombinant winged bean chymotrypsin inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
179
structure length
179
Chain Sequence
EFDDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of Asn14 in the stability and conformation of the reactive-site loop of winged bean chymotrypsin inhibitor: crystal structures of two point mutants Asn14-->Lys and Asn14-->Asp.
pubmed doi rcsb
molecule keywords CHYMOTRYPSIN INHIBITOR
molecule tags Hydrolase inhibitor
source organism Psophocarpus tetragonolobus
total genus 28
structure length 179
sequence length 179
ec nomenclature
pdb deposition date 2000-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1eylA00
2AAIB 4QO3A 4OEGA 1IHKA 2FO1A 1D0HA 5F8YA 1MC9A 2Z49A 2HZ9A 1XYFA 4XFUA 2D20A 4EB2B 4LO7B 3V0AB 3VT1A 3BAVA 3FJIA 1RMLA 3POKA 4YOLA 1AXMA 2BFHA 2D24A 3C9ZA 3AKGA 4DEPA 4ZFWB 5FZZA 4ZFUB 2IWTB 3ZC9A 1W3GA 4J2KA 5BXTA 1NZKA 2DS0A 4I4XA 3IAGC 1ISWA 1J0SA 1HCEA 2Z48A 3R4SA 1HWOB 2ET2A 1W3AA 4D0TA 1TWMA 3R4UA 1BFFA 3MPPG 1A8DA 1R8OA 1V6XA 1IJTA 3BTAA 3QR5A 3NJ5A 5BP5A 4QALA 4A7KA 1XG6A 1BFBA 4A7ZA 2BEAA 2ZQOA 4AN7B 5FZUA 3WINA 3O5WB 1PUMB 1OQLB 1S0FA 3CRIA 4I6IA 2RQ9A 4Q9GA 3IIRA 1BLAA 4IY8A 4CJMA 4F83A 3BADA 1QQKA 3OBRA 1AVWB 5BQUA 5BOWA 2D1ZA 5D62A 4AN6A 1P63A 1JT5A 3CA6A 2ESUA 3FGMA 4ZGRB 4EKXB 1AVUA 3WO2A 3OJVA 3HSMA 3N7KA 2MLLB 1PC8B 1JT7A 2Y9GA 1BA7A 3HBWA 3P6IA 4X38A 1FWUA 4HJJA 4P0JA 1XHBA 1ITBA 2Q3NB 1RZOB 2J3PA 3BRGC 3NBNA 2AFGA 4GOVA 3O49A 3BA7A 1CE7B 4Z9WB 2D22A 1ABRB 4EEEB 4F34A 1ONKB 4OWLA 4QD2C 3RTJB 4I4SA 2LIEA 4KEKA 2KI6B 4I4UA 1JQZA 4KC3A 1KNMA 3CRGA 2MC2A 5BXRA 5FNXA 2KLLA 3OJ2A 2M49A 1SR4C 3N7JA 21BIA 3HALA 3A22A 5DZUA 1N4KA 1YXWA 2FGFA 3FJKA 3OJMA 3FJJA 4IZEA 4IYBA 1FV3A 3HOMA 4ENDA 4KBBA 2AQZA 3ZX7A 1Z4SA 4I8MA 3I29B 4J2XA 4J23B 1V6VA 3HMYA 1BASA 4LO0A 1M2TB 4LO3C 2NP0A 1IT0A 3O4CA 2L5XA 1JLXA 5G00A 1IRPA 2E4MC 1TIEA 3WA1A 3D7WB 3O4DA 4XFTA 3PHZA 1ISXA 1DQOA 6I1BA 41BIA 3BAQA 4X3AA 3JUTA 3H6RB 3PMEA 4QKRA 3V0AA 1XZZA 4D0ZA 4H04A 2Y9WC 1R8NA 4DENA 1FN0A 4I4YA 1G82A 2X2SA 5F90A 5EHAA 4ZOTA 1S0DA 3IM6A 5F8WA 5BXPA 5I1BA 3B9UA 1PWAA 3V79C 4EFPA 3FJHA 3AKHA 3E8LC 3AH4A 4ZA3B 4OEEA 4R6UB 7I1BA 3CA3A 3S8JA 3O4BA 4I2SA 1Z0HA 4ZBVB 3K1XA 3W9TA 1RG8A 3UD8A 1Q03A 4LO2A 1EPWA 2K4AB 1HWMB 4P0KA 5D63A 2RSTA 2FDBM 5F8SA 1Q04A 4HR6C 4GAIA 2GO2A 1DLLA 3AZWA 8I1BA 1M16A 2ZQNA 4XKIA 3UDAA 3AH2A 3WMUA 2WBCA 1WBCA 1S0LA 1S0BA 3BAGA 5FZYA 3JRRA 4I4VA 4JQ0A 1YYNA 3A07A 4IY9A 4ISQA 2ZR1B 4GOYA 2R9KB 3NBCA 4ZLBB 3F62B 4IZXA 3NBDA 4GAFA 2VLCA 2QYIB 1HWPB 4Q9PA 4I4QA 4I7IA 2VSAA 4G6JA 2Q9XA 2X2TA 3CA5A 5EG6C 1BFCA 2VU9A 5DSSB 4XFSA 5BP5C 3WINC 5HPZA 1ISVA 3N7MA 5EC5A 3MALA 4ZKTB 3O4OA 5BQUC 1SZ6B 1TWEA 3VSFA 4USPA 4J2YA 2Y9FA 4LO1A 3AKIA 3P6JA 3VSZA 1I1BA 1JLYA 9ILBA 4P0LA 3PG0A 4H9WA 3FJEA 4QD2B 2I1BA 3ILAA 2P23A 4ZFYB 3NBEA 4L4HA 1T4QA 3EF2A 1TP0A 1AVAC 2F8XC 4HA2A 5BVPI 2HWAA 1YF8B 3IM5A 3VWCA 4QBVA 1S0EA 4I37A 1G9AA 4IONA 5BXSA 3FJ9A 5JLVA 3H6RA 2NZ9A 3UJ0A 2D7IA 3TC2A 4KEIA 3RMXA 2KH2A 5B2HA 1S0GA 2HW9A 1AFCA 1PZZA 4OEFA 3BAUA 4G1RA 1NUNA 3LTQA 2YUGA 3N0KA 4FVVA 4LO8B 4OWJA 1G9CA 1FV2A 2NM1A 4X39A 3VUOA 3BRFA 1TOOA 1HKNA 1II4A 1MD6A 5FNWA 1V6WA 2QN4A 4JAWA 4I3NA 3AJ5A 3O44A 1FWVA 1HIBA 1YTOA 1W3FA 1FGAA 4J2SA 4II0A 1JTCA 2NYYA 4LO0C 3WMVA 2FFVA 4QBCA 4FGFA 3VT0A 2HWMA 3RTIB 4G9MA 4GP0A 3LLPA 4KEJA 1FQ9A 4WBCA 1HWNB 3N7LA 2NTDA 3BA4A 4QKSA 4LO7C 2VXRA 4IHZA 2XOAA 3FJ8A 4JP0A 4L4IA 2D23A 4I4PA 3CA4A 2WRYA 2IHOA 1FMZA 4EFRA 5E24E 3V0BB 1FMMS 3BAHA 1ILR1 2UUSA 1CVSA 3F1RA 1K5UA 3FFZA 1HCDA 3FJCA 31BIA 3A23A 1I1EA 1K5VA 3OGFA 1DZDA 4JPZA 4OUJA 3S8KA 1WD4A 3FUOA 3VEQA 3HN1A 2VUAA 1DIWA 1TTUA 3BAOA 4QC4A 1YBIA 4LO2C 3KMVA 1IOBA 1ISZA 1AVXB 1V6UA 4Q91A 2MIBA 3I2AA 4PC4A 4G6MA 3AZVA 2DREA 1DZCA 4JKXB 2K43A 2AXMA 1TFMB 3UD7A 3FJFA 3CRHA 4X37A 1T9FA 4USOA 4I1BA 3SNVA 2GZBA 3AH1A 3ZC8A 5JMCA 1DJSB 5D61A 3FJDA 1JT4A 4JRAA 1EYLA 1Q1UA 3Q7YA 3PUBA 1EVTA 2VSEA 3Q7WA 3QYDA 4TLPA 3ZXGA 1L2HA 4I96A 1G9BA 5DVHA 3A21A 3CA0A 3BRDA 1SR4A 2NVHA 4P6AA 3H6QA 3WO4A 3AKFA 1WBAA 1IRAX 2DRYA 1RY7A 1BFGA 1Z2VA 2Y9XE 3H6SE 3VT2A 2D7RA 5GAQA 4I0YA 3ZXDA 3CQAA 2RG9B 1G9DA 1GGPB 1QQLA 4DCKC 2F2FA 3UD9A 4LO3A 2D44A 2LIQA 3FUQA 4I4OA 3UJ4A 3FJAA 3OBTA 3I2XA 1DFCA 1DFQA 1WD3A 2BEBA 2E4MA 4I4RA 3RMYA 1JY0A 4LO1C 4GP3A 2D43A 1EV2A 4G9NA 4A7YA 3RSJA 1F31A 4ISRA 1QXMA 1AF9A 3T8SA 4OWKA 1IILA 1VCLA 1JT3A 1S0CA 4I1EA 1UPSA 3BX1C 5DUYA 4Z8SB 2F2FC 1PUUB 1ISYA 3BA5A 1E0OA 1DQGA 3CAHA 2DRZA 4OW4A 3BB2A 4JKQA 3O3QA 4IQPA 3Q7XA 2K8RA 4D8HA 2FFUA 1BARA 3CA1A 3O4AA 2VXTI 3FJBA 3V0BA 2ERMA 3IM7A 2KI4A 3CU1B 3AJ6A 2P39A 2KKIA 3WO3A 4EFQA 1BLDA 3P53A 3OGGA
chains in the Genus database with same CATH superfamily
2AAIB 4QO3A 4OEGA 1IHKA 2FO1A 1D0HA 5F8YA 1MC9A 2Z49A 2HZ9A 1XYFA 4XFUA 2D20A 4EB2B 4LO7B 3V0AB 3VT1A 3BAVA 3FJIA 1RMLA 3POKA 4YOLA 1AXMA 2BFHA 2D24A 3C9ZA 3AKGA 4DEPA 4ZFWB 5FZZA 4ZFUB 2IWTB 3ZC9A 1W3GA 4J2KA 5BXTA 1NZKA 2DS0A 4I4XA 3IAGC 1ISWA 1J0SA 1HCEA 2Z48A 3R4SA 1HWOB 4H75A 2ET2A 1W3AA 4D0TA 1TWMA 3R4UA 1BFFA 3MPPG 1A8DA 1R8OA 1V6XA 1IJTA 3BTAA 3QR5A 3NJ5A 5BP5A 4QALA 4A7KA 1XG6A 1BFBA 4A7ZA 2BEAA 2ZQOA 4AN7B 5FZUA 3WINA 3O5WB 1PUMB 1OQLB 1S0FA 3CRIA 4I6IA 2RQ9A 4Q9GA 3IIRA 1BLAA 4IY8A 4CJMA 4F83A 3BADA 1QQKA 3OBRA 1AVWB 5BQUA 5BOWA 2D1ZA 5D62A 4AN6A 1P63A 1JT5A 3CA6A 2ESUA 3FGMA 4ZGRB 4EKXB 1AVUA 3WO2A 3OJVA 3HSMA 3N7KA 2MLLB 1PC8B 1JT7A 2Y9GA 1BA7A 3HBWA 3P6IA 4X38A 1FWUA 4HJJA 4P0JA 1XHBA 1ITBA 2Q3NB 1RZOB 2J3PA 3BRGC 3NBNA 2AFGA 4GOVA 3O49A 3BA7A 1CE7B 4Z9WB 2D22A 1ABRB 4EEEB 4F34A 1ONKB 4OWLA 4QD2C 3RTJB 4I4SA 2LIEA 4KEKA 2KI6B 4I4UA 1JQZA 4KC3A 1KNMA 3CRGA 2MC2A 5BXRA 5FNXA 2KLLA 3OJ2A 2M49A 1SR4C 3N7JA 21BIA 3HALA 3A22A 5DZUA 1N4KA 1YXWA 2FGFA 3FJKA 3OJMA 3FJJA 4IZEA 4IYBA 1FV3A 3HOMA 4ENDA 4KBBA 2AQZA 3ZX7A 1Z4SA 4I8MA 3I29B 4J2XA 4J23B 1V6VA 3HMYA 1BASA 4LO0A 1M2TB 4LO3C 2NP0A 1IT0A 3O4CA 2L5XA 1JLXA 5G00A 1IRPA 2E4MC 1TIEA 3WA1A 3D7WB 3O4DA 4XFTA 3PHZA 1ISXA 1DQOA 6I1BA 41BIA 3BAQA 4X3AA 3JUTA 3H6RB 3PMEA 4QKRA 3V0AA 1XZZA 4D0ZA 4H04A 2Y9WC 1R8NA 4DENA 1FN0A 4I4YA 1G82A 2X2SA 5F90A 5EHAA 4ZOTA 1S0DA 3IM6A 5F8WA 5BXPA 5I1BA 3B9UA 1PWAA 3V79C 4EFPA 3FJHA 3AKHA 3E8LC 3AH4A 4ZA3B 4OEEA 4R6UB 7I1BA 3CA3A 3S8JA 3O4BA 4I2SA 1Z0HA 4ZBVB 3K1XA 3W9TA 1RG8A 3UD8A 1Q03A 4LO2A 1EPWA 2K4AB 1HWMB 4P0KA 5D63A 2RSTA 2FDBM 5F8SA 1Q04A 4HR6C 4GAIA 2GO2A 1DLLA 3AZWA 8I1BA 1M16A 2ZQNA 4XKIA 3UDAA 3AH2A 3WMUA 2WBCA 1WBCA 1S0LA 1S0BA 3BAGA 5FZYA 3JRRA 4I4VA 4JQ0A 1YYNA 3A07A 4IY9A 4ISQA 2ZR1B 4GOYA 2R9KB 3NBCA 4ZLBB 3F62B 4IZXA 3NBDA 4GAFA 2VLCA 2QYIB 1HWPB 4Q9PA 4I4QA 4I7IA 2VSAA 4G6JA 2Q9XA 2X2TA 3CA5A 5EG6C 1BFCA 2VU9A 5DSSB 4XFSA 5BP5C 4MZGB 3WINC 5HPZA 1ISVA 3N7MA 5EC5A 3MALA 4ZKTB 3O4OA 5BQUC 1SZ6B 1TWEA 3VSFA 4USPA 4J2YA 2Y9FA 4LO1A 3AKIA 3P6JA 3VSZA 1I1BA 1JLYA 9ILBA 4P0LA 3PG0A 4H9WA 3FJEA 4QD2B 2I1BA 3ILAA 2P23A 4ZFYB 3NBEA 4L4HA 1T4QA 3EF2A 1TP0A 1AVAC 2F8XC 4HA2A 5BVPI 2HWAA 1YF8B 3IM5A 3VWCA 4QBVA 1S0EA 4I37A 1G9AA 4IONA 5BXSA 3FJ9A 5JLVA 3H6RA 2NZ9A 3UJ0A 2D7IA 3TC2A 4KEIA 3RMXA 2KH2A 5B2HA 1S0GA 2HW9A 1AFCA 1PZZA 4OEFA 3BAUA 4G1RA 1NUNA 3LTQA 2YUGA 3N0KA 4FVVA 4LO8B 4OWJA 1G9CA 1FV2A 2NM1A 4X39A 3VUOA 3BRFA 1TOOA 1HKNA 1II4A 1MD6A 5FNWA 1V6WA 2QN4A 4JAWA 4I3NA 3AJ5A 3O44A 1FWVA 1HIBA 1YTOA 1W3FA 1FGAA 4J2SA 4II0A 1JTCA 2NYYA 4LO0C 3WMVA 2FFVA 4QBCA 4FGFA 3VT0A 2HWMA 3RTIB 4G9MA 4GP0A 3LLPA 4KEJA 1FQ9A 4WBCA 1HWNB 3N7LA 2NTDA 3BA4A 4QKSA 4LO7C 2VXRA 4IHZA 2XOAA 3FJ8A 4JP0A 4L4IA 2D23A 4I4PA 3CA4A 2WRYA 2IHOA 1FMZA 4EFRA 5E24E 3V0BB 1FMMS 3BAHA 1ILR1 2UUSA 1CVSA 3F1RA 1K5UA 3FFZA 1HCDA 3FJCA 31BIA 3A23A 1I1EA 1K5VA 3OGFA 1DZDA 4JPZA 4OUJA 3S8KA 1WD4A 3FUOA 3VEQA 3HN1A 2VUAA 1DIWA 1TTUA 3BAOA 4QC4A 1YBIA 4LO2C 3KMVA 1IOBA 1ISZA 1AVXB 1V6UA 4Q91A 2MIBA 3I2AA 4PC4A 4G6MA 3AZVA 2DREA 1DZCA 4JKXB 2K43A 2AXMA 1TFMB 3UD7A 3FJFA 3CRHA 4X37A 1T9FA 4USOA 4I1BA 3SNVA 2GZBA 3AH1A 3ZC8A 5JMCA 1DJSB 5D61A 3FJDA 1JT4A 4JRAA 1EYLA 1Q1UA 3Q7YA 3PUBA 1EVTA 2VSEA 3Q7WA 3QYDA 4TLPA 3ZXGA 1L2HA 4I96A 1G9BA 5DVHA 3A21A 3CA0A 3BRDA 1SR4A 2NVHA 4P6AA 3H6QA 3WO4A 3AKFA 1WBAA 1IRAX 2DRYA 1RY7A 1BFGA 1Z2VA 2Y9XE 3H6SE 3VT2A 2D7RA 5GAQA 4I0YA 3ZXDA 3CQAA 2RG9B 1G9DA 1GGPB 1QQLA 4DCKC 2F2FA 3UD9A 4LO3A 2D44A 2LIQA 3FUQA 4I4OA 3UJ4A 3FJAA 3OBTA 3I2XA 1DFCA 1DFQA 1WD3A 2BEBA 2E4MA 4I4RA 3RMYA 1JY0A 4LO1C 4GP3A 2D43A 1EV2A 4G9NA 4A7YA 3RSJA 1F31A 4ISRA 1QXMA 1AF9A 3T8SA 4OWKA 1IILA 1VCLA 1JT3A 1S0CA 4I1EA 1UPSA 3BX1C 5DUYA 4Z8SB 2F2FC 1PUUB 1ISYA 3BA5A 1E0OA 1DQGA 3CAHA 2DRZA 4OW4A 3BB2A 4JKQA 4UY4A 3O3QA 4IQPA 4MZHA 3Q7XA 2K8RA 4D8HA 2FFUA 1BARA 3CA1A 3O4AA 2VXTI 3FJBA 3V0BA 2ERMA 3IM7A 2KI4A 3CU1B 3AJ6A 4MZFB 2P39A 2KKIA 3WO3A 4EFQA 2NS2A 1BLDA 3P53A 3OGGA
chains in the Genus database with same CATH topology
2AAIB 4QO3A 4OEGA 1IHKA 2FO1A 1D0HA 5F8YA 1MC9A 2Z49A 2HZ9A 1XYFA 4XFUA 2D20A 4EB2B 4LO7B 3V0AB 3VT1A 3BAVA 3FJIA 1RMLA 3POKA 4YOLA 1AXMA 2BFHA 2D24A 3C9ZA 3AKGA 4DEPA 4ZFWB 5FZZA 4ZFUB 2IWTB 3ZC9A 1W3GA 4J2KA 5BXTA 1NZKA 2DS0A 4I4XA 3IAGC 1ISWA 1J0SA 1HCEA 2Z48A 3R4SA 1HWOB 4H75A 2ET2A 1W3AA 4D0TA 1TWMA 3R4UA 1BFFA 3MPPG 1A8DA 1R8OA 1V6XA 1IJTA 3BTAA 3QR5A 3NJ5A 5BP5A 4QALA 4A7KA 1XG6A 1BFBA 4A7ZA 2BEAA 2ZQOA 4AN7B 5FZUA 3WINA 3O5WB 1PUMB 1OQLB 1S0FA 3CRIA 4I6IA 2RQ9A 4Q9GA 3IIRA 1BLAA 4IY8A 4CJMA 4F83A 3BADA 1QQKA 3OBRA 1AVWB 5BQUA 5BOWA 2D1ZA 5D62A 4AN6A 1P63A 1JT5A 3CA6A 2ESUA 3FGMA 4ZGRB 4EKXB 1AVUA 3WO2A 3OJVA 3HSMA 3N7KA 2MLLB 1PC8B 1JT7A 2Y9GA 1BA7A 3HBWA 3P6IA 4X38A 1FWUA 4HJJA 4P0JA 1XHBA 1ITBA 2Q3NB 1RZOB 2J3PA 3BRGC 3NBNA 2AFGA 4GOVA 3O49A 3BA7A 1CE7B 4Z9WB 2D22A 1ABRB 4EEEB 4F34A 1ONKB 4OWLA 4QD2C 3RTJB 4I4SA 2LIEA 4KEKA 2KI6B 4I4UA 1JQZA 4KC3A 1KNMA 3CRGA 2MC2A 5BXRA 5FNXA 2KLLA 3OJ2A 2M49A 1SR4C 3N7JA 21BIA 3HALA 3A22A 5DZUA 1N4KA 1YXWA 2FGFA 3FJKA 3OJMA 3FJJA 4IZEA 4IYBA 1FV3A 3HOMA 4ENDA 4KBBA 2AQZA 3ZX7A 1Z4SA 4I8MA 3I29B 4J2XA 4J23B 1V6VA 3HMYA 1BASA 4LO0A 1M2TB 4LO3C 2NP0A 1IT0A 3O4CA 2L5XA 1JLXA 5G00A 1IRPA 2E4MC 1TIEA 3WA1A 3D7WB 3O4DA 4XFTA 3PHZA 1ISXA 1DQOA 6I1BA 41BIA 3BAQA 4X3AA 3JUTA 3H6RB 3PMEA 4QKRA 3V0AA 1XZZA 4D0ZA 4H04A 2Y9WC 1R8NA 4DENA 1FN0A 4I4YA 1G82A 2X2SA 5F90A 5EHAA 4ZOTA 1S0DA 3IM6A 5F8WA 5BXPA 5I1BA 3B9UA 1PWAA 3V79C 4EFPA 3FJHA 3AKHA 3E8LC 3AH4A 4ZA3B 4OEEA 4R6UB 7I1BA 3CA3A 3S8JA 3O4BA 4I2SA 1Z0HA 4ZBVB 3K1XA 3W9TA 1RG8A 3UD8A 1Q03A 4LO2A 1EPWA 2K4AB 1HWMB 4P0KA 5D63A 2RSTA 2FDBM 5F8SA 1Q04A 4HR6C 4GAIA 2GO2A 1DLLA 3AZWA 8I1BA 1M16A 2ZQNA 4XKIA 3UDAA 3AH2A 3WMUA 2WBCA 1WBCA 1S0LA 1S0BA 3BAGA 5FZYA 3JRRA 4I4VA 4JQ0A 1YYNA 3A07A 4IY9A 4ISQA 2ZR1B 4GOYA 2R9KB 3NBCA 4ZLBB 3F62B 4IZXA 3NBDA 4GAFA 2VLCA 2QYIB 1HWPB 4Q9PA 4I4QA 4I7IA 2VSAA 4G6JA 2Q9XA 2X2TA 3CA5A 5EG6C 1BFCA 2VU9A 5DSSB 4XFSA 5BP5C 4MZGB 3WINC 5HPZA 1ISVA 3N7MA 5EC5A 3MALA 4ZKTB 3O4OA 5BQUC 1SZ6B 1TWEA 3VSFA 4USPA 4J2YA 2Y9FA 4LO1A 3AKIA 3P6JA 3VSZA 1I1BA 1JLYA 9ILBA 4P0LA 3PG0A 4H9WA 3FJEA 4QD2B 2I1BA 3ILAA 2P23A 4ZFYB 3NBEA 4L4HA 1T4QA 3EF2A 1TP0A 1AVAC 2F8XC 4HA2A 5BVPI 2HWAA 1YF8B 3IM5A 3VWCA 4QBVA 1S0EA 4I37A 1G9AA 4IONA 5BXSA 3FJ9A 5JLVA 3H6RA 2NZ9A 3UJ0A 2D7IA 3TC2A 4KEIA 3RMXA 2KH2A 5B2HA 1S0GA 2HW9A 1AFCA 1PZZA 4OEFA 3BAUA 4G1RA 1NUNA 3LTQA 2YUGA 3N0KA 4FVVA 4LO8B 4OWJA 1G9CA 1FV2A 2NM1A 4X39A 3VUOA 3BRFA 1TOOA 1HKNA 1II4A 1MD6A 5FNWA 1V6WA 2QN4A 4JAWA 4I3NA 3AJ5A 3O44A 1FWVA 1HIBA 1YTOA 1W3FA 1FGAA 4J2SA 4II0A 1JTCA 2NYYA 4LO0C 3WMVA 2FFVA 4QBCA 4FGFA 3VT0A 2HWMA 3RTIB 4G9MA 4GP0A 3LLPA 4KEJA 1FQ9A 4WBCA 1HWNB 3N7LA 2NTDA 3BA4A 4QKSA 4LO7C 2VXRA 4IHZA 2XOAA 3FJ8A 4JP0A 4L4IA 2D23A 4I4PA 3CA4A 2WRYA 2IHOA 1FMZA 4EFRA 5E24E 3V0BB 1FMMS 3BAHA 1ILR1 2UUSA 1CVSA 3F1RA 1K5UA 3FFZA 1HCDA 3FJCA 31BIA 3A23A 1I1EA 1K5VA 3OGFA 1DZDA 4JPZA 4OUJA 3S8KA 1WD4A 3FUOA 3VEQA 3HN1A 2VUAA 1DIWA 1TTUA 3BAOA 4QC4A 1YBIA 4LO2C 3KMVA 1IOBA 1ISZA 1AVXB 1V6UA 4Q91A 2MIBA 3I2AA 4PC4A 4G6MA 3AZVA 2DREA 1DZCA 4JKXB 2K43A 2AXMA 1TFMB 3UD7A 3FJFA 3CRHA 4X37A 1T9FA 4USOA 4I1BA 3SNVA 2GZBA 3AH1A 3ZC8A 5JMCA 1DJSB 5D61A 3FJDA 1JT4A 4JRAA 1EYLA 1Q1UA 3Q7YA 3PUBA 1EVTA 2VSEA 3Q7WA 3QYDA 4TLPA 3ZXGA 1L2HA 4I96A 1G9BA 5DVHA 3A21A 3CA0A 3BRDA 1SR4A 2NVHA 4P6AA 3H6QA 3WO4A 3AKFA 1WBAA 1IRAX 2DRYA 1RY7A 1BFGA 1Z2VA 2Y9XE 3H6SE 3VT2A 2D7RA 5GAQA 4I0YA 3ZXDA 3CQAA 2RG9B 1G9DA 1GGPB 1QQLA 4DCKC 2F2FA 3UD9A 4LO3A 2D44A 2LIQA 3FUQA 4I4OA 3UJ4A 3FJAA 3OBTA 3I2XA 1DFCA 1DFQA 1WD3A 2BEBA 2E4MA 4I4RA 3RMYA 1JY0A 4LO1C 4GP3A 2D43A 1EV2A 4G9NA 4A7YA 3RSJA 1F31A 4ISRA 1QXMA 1AF9A 3T8SA 4OWKA 1IILA 1VCLA 1JT3A 1S0CA 4I1EA 1UPSA 3BX1C 5DUYA 4Z8SB 2F2FC 1PUUB 1ISYA 3BA5A 1E0OA 1DQGA 3CAHA 2DRZA 4OW4A 3BB2A 4JKQA 4UY4A 3O3QA 4IQPA 4MZHA 3Q7XA 2K8RA 4D8HA 2FFUA 1BARA 3CA1A 3O4AA 2VXTI 3FJBA 3V0BA 2ERMA 3IM7A 2KI4A 3CU1B 3AJ6A 4MZFB 2P39A 2KKIA 3WO3A 4EFQA 2NS2A 1BLDA 3P53A 3OGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AAI B;  4QO3 A;  4OEG A;  1IHK A;  2FO1 A;  1D0H A;  5F8Y A;  1MC9 A;  2Z49 A;  2HZ9 A;  1XYF A;  4XFU A;  2D20 A;  4EB2 B;  4LO7 B;  3V0A B;  3VT1 A;  3BAV A;  3FJI A;  1RML A;  3POK A;  4YOL A;  1AXM A;  2BFH A;  2D24 A;  3C9Z A;  3AKG A;  4DEP A;  4ZFW B;  5FZZ A;  4ZFU B;  2IWT B;  3ZC9 A;  1W3G A;  4J2K A;  5BXT A;  1NZK A;  2DS0 A;  4I4X A;  3IAG C;  1ISW A;  1J0S A;  1HCE A;  2Z48 A;  3R4S A;  1HWO B;  2ET2 A;  1W3A A;  4D0T A;  1TWM A;  3R4U A;  1BFF A;  3MPP G;  1A8D A;  1R8O A;  1V6X A;  1IJT A;  3BTA A;  3QR5 A;  3NJ5 A;  5BP5 A;  4QAL A;  4A7K A;  1XG6 A;  1BFB A;  4A7Z A;  2BEA A;  2ZQO A;  4AN7 B;  5FZU A;  3WIN A;  3O5W B;  1PUM B;  1OQL B;  1S0F A;  3CRI A;  4I6I A;  2RQ9 A;  4Q9G A;  3IIR A;  1BLA A;  4IY8 A;  4CJM A;  4F83 A;  3BAD A;  1QQK A;  3OBR A;  1AVW B;  5BQU A;  5BOW A;  2D1Z A;  5D62 A;  4AN6 A;  1P63 A;  1JT5 A;  3CA6 A;  2ESU A;  3FGM A;  4ZGR B;  4EKX B;  1AVU A;  3WO2 A;  3OJV A;  3HSM A;  3N7K A;  2MLL B;  1PC8 B;  1JT7 A;  2Y9G A;  1BA7 A;  3HBW A;  3P6I A;  4X38 A;  1FWU A;  4HJJ A;  4P0J A;  1XHB A;  1ITB A;  2Q3N B;  1RZO B;  2J3P A;  3BRG C;  3NBN A;  2AFG A;  4GOV A;  3O49 A;  3BA7 A;  1CE7 B;  4Z9W B;  2D22 A;  1ABR B;  4EEE B;  4F34 A;  1ONK B;  4OWL A;  4QD2 C;  3RTJ B;  4I4S A;  2LIE A;  4KEK A;  2KI6 B;  4I4U A;  1JQZ A;  4KC3 A;  1KNM A;  3CRG A;  2MC2 A;  5BXR A;  5FNX A;  2KLL A;  3OJ2 A;  2M49 A;  1SR4 C;  3N7J A;  21BI A;  3HAL A;  3A22 A;  5DZU A;  1N4K A;  1YXW A;  2FGF A;  3FJK A;  3OJM A;  3FJJ A;  4IZE A;  4IYB A;  1FV3 A;  3HOM A;  4END A;  4KBB A;  2AQZ A;  3ZX7 A;  1Z4S A;  4I8M A;  3I29 B;  4J2X A;  4J23 B;  1V6V A;  3HMY A;  1BAS A;  4LO0 A;  1M2T B;  4LO3 C;  2NP0 A;  1IT0 A;  3O4C A;  2L5X A;  1JLX A;  5G00 A;  1IRP A;  2E4M C;  1TIE A;  3WA1 A;  3D7W B;  3O4D A;  4XFT A;  3PHZ A;  1ISX A;  1DQO A;  6I1B A;  41BI A;  3BAQ A;  4X3A A;  3JUT A;  3H6R B;  3PME A;  4QKR A;  3V0A A;  1XZZ A;  4D0Z A;  4H04 A;  2Y9W C;  1R8N A;  4DEN A;  1FN0 A;  4I4Y A;  1G82 A;  2X2S A;  5F90 A;  5EHA A;  4ZOT A;  1S0D A;  3IM6 A;  5F8W A;  5BXP A;  5I1B A;  3B9U A;  1PWA A;  3V79 C;  4EFP A;  3FJH A;  3AKH A;  3E8L C;  3AH4 A;  4ZA3 B;  4OEE A;  4R6U B;  7I1B A;  3CA3 A;  3S8J A;  3O4B A;  4I2S A;  1Z0H A;  4ZBV B;  3K1X A;  3W9T A;  1RG8 A;  3UD8 A;  1Q03 A;  4LO2 A;  1EPW A;  2K4A B;  1HWM B;  4P0K A;  5D63 A;  2RST A;  2FDB M;  5F8S A;  1Q04 A;  4HR6 C;  4GAI A;  2GO2 A;  1DLL A;  3AZW A;  8I1B A;  1M16 A;  2ZQN A;  4XKI A;  3UDA A;  3AH2 A;  3WMU A;  2WBC A;  1WBC A;  1S0L A;  1S0B A;  3BAG A;  5FZY A;  3JRR A;  4I4V A;  4JQ0 A;  1YYN A;  3A07 A;  4IY9 A;  4ISQ A;  2ZR1 B;  4GOY A;  2R9K B;  3NBC A;  4ZLB B;  3F62 B;  4IZX A;  3NBD A;  4GAF A;  2VLC A;  2QYI B;  1HWP B;  4Q9P A;  4I4Q A;  4I7I A;  2VSA A;  4G6J A;  2Q9X A;  2X2T A;  3CA5 A;  5EG6 C;  1BFC A;  2VU9 A;  5DSS B;  4XFS A;  5BP5 C;  3WIN C;  5HPZ A;  1ISV A;  3N7M A;  5EC5 A;  3MAL A;  4ZKT B;  3O4O A;  5BQU C;  1SZ6 B;  1TWE A;  3VSF A;  4USP A;  4J2Y A;  2Y9F A;  4LO1 A;  3AKI A;  3P6J A;  3VSZ A;  1I1B A;  1JLY A;  9ILB A;  4P0L A;  3PG0 A;  4H9W A;  3FJE A;  4QD2 B;  2I1B A;  3ILA A;  2P23 A;  4ZFY B;  3NBE A;  4L4H A;  1T4Q A;  3EF2 A;  1TP0 A;  1AVA C;  2F8X C;  4HA2 A;  5BVP I;  2HWA A;  1YF8 B;  3IM5 A;  3VWC A;  4QBV A;  1S0E A;  4I37 A;  1G9A A;  4ION A;  5BXS A;  3FJ9 A;  5JLV A;  3H6R A;  2NZ9 A;  3UJ0 A;  2D7I A;  3TC2 A;  4KEI A;  3RMX A;  2KH2 A;  5B2H A;  1S0G A;  2HW9 A;  1AFC A;  1PZZ A;  4OEF A;  3BAU A;  4G1R A;  1NUN A;  3LTQ A;  2YUG A;  3N0K A;  4FVV A;  4LO8 B;  4OWJ A;  1G9C A;  1FV2 A;  2NM1 A;  4X39 A;  3VUO A;  3BRF A;  1TOO A;  1HKN A;  1II4 A;  1MD6 A;  5FNW A;  1V6W A;  2QN4 A;  4JAW A;  4I3N A;  3AJ5 A;  3O44 A;  1FWV A;  1HIB A;  1YTO A;  1W3F A;  1FGA A;  4J2S A;  4II0 A;  1JTC A;  2NYY A;  4LO0 C;  3WMV A;  2FFV A;  4QBC A;  4FGF A;  3VT0 A;  2HWM A;  3RTI B;  4G9M A;  4GP0 A;  3LLP A;  4KEJ A;  1FQ9 A;  4WBC A;  1HWN B;  3N7L A;  2NTD A;  3BA4 A;  4QKS A;  4LO7 C;  2VXR A;  4IHZ A;  2XOA A;  3FJ8 A;  4JP0 A;  4L4I A;  2D23 A;  4I4P A;  3CA4 A;  2WRY A;  2IHO A;  1FMZ A;  4EFR A;  5E24 E;  3V0B B;  1FMM S;  3BAH A;  1ILR 1;  2UUS A;  1CVS A;  3F1R A;  1K5U A;  3FFZ A;  1HCD A;  3FJC A;  31BI A;  3A23 A;  1I1E A;  1K5V A;  3OGF A;  1DZD A;  4JPZ A;  4OUJ A;  3S8K A;  1WD4 A;  3FUO A;  3VEQ A;  3HN1 A;  2VUA A;  1DIW A;  1TTU A;  3BAO A;  4QC4 A;  1YBI A;  4LO2 C;  3KMV A;  1IOB A;  1ISZ A;  1AVX B;  1V6U A;  4Q91 A;  2MIB A;  3I2A A;  4PC4 A;  4G6M A;  3AZV A;  2DRE A;  1DZC A;  4JKX B;  2K43 A;  2AXM A;  1TFM B;  3UD7 A;  3FJF A;  3CRH A;  4X37 A;  1T9F A;  4USO A;  4I1B A;  3SNV A;  2GZB A;  3AH1 A;  3ZC8 A;  5JMC A;  1DJS B;  5D61 A;  3FJD A;  1JT4 A;  4JRA A;  1EYL A;  1Q1U A;  3Q7Y A;  3PUB A;  1EVT A;  2VSE A;  3Q7W A;  3QYD A;  4TLP A;  3ZXG A;  1L2H A;  4I96 A;  1G9B A;  5DVH A;  3A21 A;  3CA0 A;  3BRD A;  1SR4 A;  2NVH A;  4P6A A;  3H6Q A;  3WO4 A;  3AKF A;  1WBA A;  1IRA X;  2DRY A;  1RY7 A;  1BFG A;  1Z2V A;  2Y9X E;  3H6S E;  3VT2 A;  2D7R A;  5GAQ A;  4I0Y A;  3ZXD A;  3CQA A;  2RG9 B;  1G9D A;  1GGP B;  1QQL A;  4DCK C;  2F2F A;  3UD9 A;  4LO3 A;  2D44 A;  2LIQ A;  3FUQ A;  4I4O A;  3UJ4 A;  3FJA A;  3OBT A;  3I2X A;  1DFC A;  1DFQ A;  1WD3 A;  2BEB A;  2E4M A;  4I4R A;  3RMY A;  1JY0 A;  4LO1 C;  4GP3 A;  2D43 A;  1EV2 A;  4G9N A;  4A7Y A;  3RSJ A;  1F31 A;  4ISR A;  1QXM A;  1AF9 A;  3T8S A;  4OWK A;  1IIL A;  1VCL A;  1JT3 A;  1S0C A;  4I1E A;  1UPS A;  3BX1 C;  5DUY A;  4Z8S B;  2F2F C;  1PUU B;  1ISY A;  3BA5 A;  1E0O A;  1DQG A;  3CAH A;  2DRZ A;  4OW4 A;  3BB2 A;  4JKQ A;  3O3Q A;  4IQP A;  3Q7X A;  2K8R A;  4D8H A;  2FFU A;  1BAR A;  3CA1 A;  3O4A A;  2VXT I;  3FJB A;  3V0B A;  2ERM A;  3IM7 A;  2KI4 A;  3CU1 B;  3AJ6 A;  2P39 A;  2KKI A;  3WO3 A;  4EFQ A;  1BLD A;  3P53 A;  3OGG A; 
#chains in the Genus database with same CATH topology
 2AAI B;  4QO3 A;  4OEG A;  1IHK A;  2FO1 A;  1D0H A;  5F8Y A;  1MC9 A;  2Z49 A;  2HZ9 A;  1XYF A;  4XFU A;  2D20 A;  4EB2 B;  4LO7 B;  3V0A B;  3VT1 A;  3BAV A;  3FJI A;  1RML A;  3POK A;  4YOL A;  1AXM A;  2BFH A;  2D24 A;  3C9Z A;  3AKG A;  4DEP A;  4ZFW B;  5FZZ A;  4ZFU B;  2IWT B;  3ZC9 A;  1W3G A;  4J2K A;  5BXT A;  1NZK A;  2DS0 A;  4I4X A;  3IAG C;  1ISW A;  1J0S A;  1HCE A;  2Z48 A;  3R4S A;  1HWO B;  4H75 A;  2ET2 A;  1W3A A;  4D0T A;  1TWM A;  3R4U A;  1BFF A;  3MPP G;  1A8D A;  1R8O A;  1V6X A;  1IJT A;  3BTA A;  3QR5 A;  3NJ5 A;  5BP5 A;  4QAL A;  4A7K A;  1XG6 A;  1BFB A;  4A7Z A;  2BEA A;  2ZQO A;  4AN7 B;  5FZU A;  3WIN A;  3O5W B;  1PUM B;  1OQL B;  1S0F A;  3CRI A;  4I6I A;  2RQ9 A;  4Q9G A;  3IIR A;  1BLA A;  4IY8 A;  4CJM A;  4F83 A;  3BAD A;  1QQK A;  3OBR A;  1AVW B;  5BQU A;  5BOW A;  2D1Z A;  5D62 A;  4AN6 A;  1P63 A;  1JT5 A;  3CA6 A;  2ESU A;  3FGM A;  4ZGR B;  4EKX B;  1AVU A;  3WO2 A;  3OJV A;  3HSM A;  3N7K A;  2MLL B;  1PC8 B;  1JT7 A;  2Y9G A;  1BA7 A;  3HBW A;  3P6I A;  4X38 A;  1FWU A;  4HJJ A;  4P0J A;  1XHB A;  1ITB A;  2Q3N B;  1RZO B;  2J3P A;  3BRG C;  3NBN A;  2AFG A;  4GOV A;  3O49 A;  3BA7 A;  1CE7 B;  4Z9W B;  2D22 A;  1ABR B;  4EEE B;  4F34 A;  1ONK B;  4OWL A;  4QD2 C;  3RTJ B;  4I4S A;  2LIE A;  4KEK A;  2KI6 B;  4I4U A;  1JQZ A;  4KC3 A;  1KNM A;  3CRG A;  2MC2 A;  5BXR A;  5FNX A;  2KLL A;  3OJ2 A;  2M49 A;  1SR4 C;  3N7J A;  21BI A;  3HAL A;  3A22 A;  5DZU A;  1N4K A;  1YXW A;  2FGF A;  3FJK A;  3OJM A;  3FJJ A;  4IZE A;  4IYB A;  1FV3 A;  3HOM A;  4END A;  4KBB A;  2AQZ A;  3ZX7 A;  1Z4S A;  4I8M A;  3I29 B;  4J2X A;  4J23 B;  1V6V A;  3HMY A;  1BAS A;  4LO0 A;  1M2T B;  4LO3 C;  2NP0 A;  1IT0 A;  3O4C A;  2L5X A;  1JLX A;  5G00 A;  1IRP A;  2E4M C;  1TIE A;  3WA1 A;  3D7W B;  3O4D A;  4XFT A;  3PHZ A;  1ISX A;  1DQO A;  6I1B A;  41BI A;  3BAQ A;  4X3A A;  3JUT A;  3H6R B;  3PME A;  4QKR A;  3V0A A;  1XZZ A;  4D0Z A;  4H04 A;  2Y9W C;  1R8N A;  4DEN A;  1FN0 A;  4I4Y A;  1G82 A;  2X2S A;  5F90 A;  5EHA A;  4ZOT A;  1S0D A;  3IM6 A;  5F8W A;  5BXP A;  5I1B A;  3B9U A;  1PWA A;  3V79 C;  4EFP A;  3FJH A;  3AKH A;  3E8L C;  3AH4 A;  4ZA3 B;  4OEE A;  4R6U B;  7I1B A;  3CA3 A;  3S8J A;  3O4B A;  4I2S A;  1Z0H A;  4ZBV B;  3K1X A;  3W9T A;  1RG8 A;  3UD8 A;  1Q03 A;  4LO2 A;  1EPW A;  2K4A B;  1HWM B;  4P0K A;  5D63 A;  2RST A;  2FDB M;  5F8S A;  1Q04 A;  4HR6 C;  4GAI A;  2GO2 A;  1DLL A;  3AZW A;  8I1B A;  1M16 A;  2ZQN A;  4XKI A;  3UDA A;  3AH2 A;  3WMU A;  2WBC A;  1WBC A;  1S0L A;  1S0B A;  3BAG A;  5FZY A;  3JRR A;  4I4V A;  4JQ0 A;  1YYN A;  3A07 A;  4IY9 A;  4ISQ A;  2ZR1 B;  4GOY A;  2R9K B;  3NBC A;  4ZLB B;  3F62 B;  4IZX A;  3NBD A;  4GAF A;  2VLC A;  2QYI B;  1HWP B;  4Q9P A;  4I4Q A;  4I7I A;  2VSA A;  4G6J A;  2Q9X A;  2X2T A;  3CA5 A;  5EG6 C;  1BFC A;  2VU9 A;  5DSS B;  4XFS A;  5BP5 C;  4MZG B;  3WIN C;  5HPZ A;  1ISV A;  3N7M A;  5EC5 A;  3MAL A;  4ZKT B;  3O4O A;  5BQU C;  1SZ6 B;  1TWE A;  3VSF A;  4USP A;  4J2Y A;  2Y9F A;  4LO1 A;  3AKI A;  3P6J A;  3VSZ A;  1I1B A;  1JLY A;  9ILB A;  4P0L A;  3PG0 A;  4H9W A;  3FJE A;  4QD2 B;  2I1B A;  3ILA A;  2P23 A;  4ZFY B;  3NBE A;  4L4H A;  1T4Q A;  3EF2 A;  1TP0 A;  1AVA C;  2F8X C;  4HA2 A;  5BVP I;  2HWA A;  1YF8 B;  3IM5 A;  3VWC A;  4QBV A;  1S0E A;  4I37 A;  1G9A A;  4ION A;  5BXS A;  3FJ9 A;  5JLV A;  3H6R A;  2NZ9 A;  3UJ0 A;  2D7I A;  3TC2 A;  4KEI A;  3RMX A;  2KH2 A;  5B2H A;  1S0G A;  2HW9 A;  1AFC A;  1PZZ A;  4OEF A;  3BAU A;  4G1R A;  1NUN A;  3LTQ A;  2YUG A;  3N0K A;  4FVV A;  4LO8 B;  4OWJ A;  1G9C A;  1FV2 A;  2NM1 A;  4X39 A;  3VUO A;  3BRF A;  1TOO A;  1HKN A;  1II4 A;  1MD6 A;  5FNW A;  1V6W A;  2QN4 A;  4JAW A;  4I3N A;  3AJ5 A;  3O44 A;  1FWV A;  1HIB A;  1YTO A;  1W3F A;  1FGA A;  4J2S A;  4II0 A;  1JTC A;  2NYY A;  4LO0 C;  3WMV A;  2FFV A;  4QBC A;  4FGF A;  3VT0 A;  2HWM A;  3RTI B;  4G9M A;  4GP0 A;  3LLP A;  4KEJ A;  1FQ9 A;  4WBC A;  1HWN B;  3N7L A;  2NTD A;  3BA4 A;  4QKS A;  4LO7 C;  2VXR A;  4IHZ A;  2XOA A;  3FJ8 A;  4JP0 A;  4L4I A;  2D23 A;  4I4P A;  3CA4 A;  2WRY A;  2IHO A;  1FMZ A;  4EFR A;  5E24 E;  3V0B B;  1FMM S;  3BAH A;  1ILR 1;  2UUS A;  1CVS A;  3F1R A;  1K5U A;  3FFZ A;  1HCD A;  3FJC A;  31BI A;  3A23 A;  1I1E A;  1K5V A;  3OGF A;  1DZD A;  4JPZ A;  4OUJ A;  3S8K A;  1WD4 A;  3FUO A;  3VEQ A;  3HN1 A;  2VUA A;  1DIW A;  1TTU A;  3BAO A;  4QC4 A;  1YBI A;  4LO2 C;  3KMV A;  1IOB A;  1ISZ A;  1AVX B;  1V6U A;  4Q91 A;  2MIB A;  3I2A A;  4PC4 A;  4G6M A;  3AZV A;  2DRE A;  1DZC A;  4JKX B;  2K43 A;  2AXM A;  1TFM B;  3UD7 A;  3FJF A;  3CRH A;  4X37 A;  1T9F A;  4USO A;  4I1B A;  3SNV A;  2GZB A;  3AH1 A;  3ZC8 A;  5JMC A;  1DJS B;  5D61 A;  3FJD A;  1JT4 A;  4JRA A;  1EYL A;  1Q1U A;  3Q7Y A;  3PUB A;  1EVT A;  2VSE A;  3Q7W A;  3QYD A;  4TLP A;  3ZXG A;  1L2H A;  4I96 A;  1G9B A;  5DVH A;  3A21 A;  3CA0 A;  3BRD A;  1SR4 A;  2NVH A;  4P6A A;  3H6Q A;  3WO4 A;  3AKF A;  1WBA A;  1IRA X;  2DRY A;  1RY7 A;  1BFG A;  1Z2V A;  2Y9X E;  3H6S E;  3VT2 A;  2D7R A;  5GAQ A;  4I0Y A;  3ZXD A;  3CQA A;  2RG9 B;  1G9D A;  1GGP B;  1QQL A;  4DCK C;  2F2F A;  3UD9 A;  4LO3 A;  2D44 A;  2LIQ A;  3FUQ A;  4I4O A;  3UJ4 A;  3FJA A;  3OBT A;  3I2X A;  1DFC A;  1DFQ A;  1WD3 A;  2BEB A;  2E4M A;  4I4R A;  3RMY A;  1JY0 A;  4LO1 C;  4GP3 A;  2D43 A;  1EV2 A;  4G9N A;  4A7Y A;  3RSJ A;  1F31 A;  4ISR A;  1QXM A;  1AF9 A;  3T8S A;  4OWK A;  1IIL A;  1VCL A;  1JT3 A;  1S0C A;  4I1E A;  1UPS A;  3BX1 C;  5DUY A;  4Z8S B;  2F2F C;  1PUU B;  1ISY A;  3BA5 A;  1E0O A;  1DQG A;  3CAH A;  2DRZ A;  4OW4 A;  3BB2 A;  4JKQ A;  4UY4 A;  3O3Q A;  4IQP A;  4MZH A;  3Q7X A;  2K8R A;  4D8H A;  2FFU A;  1BAR A;  3CA1 A;  3O4A A;  2VXT I;  3FJB A;  3V0B A;  2ERM A;  3IM7 A;  2KI4 A;  3CU1 B;  3AJ6 A;  4MZF B;  2P39 A;  2KKI A;  3WO3 A;  4EFQ A;  2NS2 A;  1BLD A;  3P53 A;  3OGG A; 
#chains in the Genus database with same CATH homology
 2AAI B;  4QO3 A;  4OEG A;  1IHK A;  2FO1 A;  1D0H A;  5F8Y A;  1MC9 A;  2Z49 A;  2HZ9 A;  1XYF A;  4XFU A;  2D20 A;  4EB2 B;  4LO7 B;  3V0A B;  3VT1 A;  3BAV A;  3FJI A;  1RML A;  3POK A;  4YOL A;  1AXM A;  2BFH A;  2D24 A;  3C9Z A;  3AKG A;  4DEP A;  4ZFW B;  5FZZ A;  4ZFU B;  2IWT B;  3ZC9 A;  1W3G A;  4J2K A;  5BXT A;  1NZK A;  2DS0 A;  4I4X A;  3IAG C;  1ISW A;  1J0S A;  1HCE A;  2Z48 A;  3R4S A;  1HWO B;  4H75 A;  2ET2 A;  1W3A A;  4D0T A;  1TWM A;  3R4U A;  1BFF A;  3MPP G;  1A8D A;  1R8O A;  1V6X A;  1IJT A;  3BTA A;  3QR5 A;  3NJ5 A;  5BP5 A;  4QAL A;  4A7K A;  1XG6 A;  1BFB A;  4A7Z A;  2BEA A;  2ZQO A;  4AN7 B;  5FZU A;  3WIN A;  3O5W B;  1PUM B;  1OQL B;  1S0F A;  3CRI A;  4I6I A;  2RQ9 A;  4Q9G A;  3IIR A;  1BLA A;  4IY8 A;  4CJM A;  4F83 A;  3BAD A;  1QQK A;  3OBR A;  1AVW B;  5BQU A;  5BOW A;  2D1Z A;  5D62 A;  4AN6 A;  1P63 A;  1JT5 A;  3CA6 A;  2ESU A;  3FGM A;  4ZGR B;  4EKX B;  1AVU A;  3WO2 A;  3OJV A;  3HSM A;  3N7K A;  2MLL B;  1PC8 B;  1JT7 A;  2Y9G A;  1BA7 A;  3HBW A;  3P6I A;  4X38 A;  1FWU A;  4HJJ A;  4P0J A;  1XHB A;  1ITB A;  2Q3N B;  1RZO B;  2J3P A;  3BRG C;  3NBN A;  2AFG A;  4GOV A;  3O49 A;  3BA7 A;  1CE7 B;  4Z9W B;  2D22 A;  1ABR B;  4EEE B;  4F34 A;  1ONK B;  4OWL A;  4QD2 C;  3RTJ B;  4I4S A;  2LIE A;  4KEK A;  2KI6 B;  4I4U A;  1JQZ A;  4KC3 A;  1KNM A;  3CRG A;  2MC2 A;  5BXR A;  5FNX A;  2KLL A;  3OJ2 A;  2M49 A;  1SR4 C;  3N7J A;  21BI A;  3HAL A;  3A22 A;  5DZU A;  1N4K A;  1YXW A;  2FGF A;  3FJK A;  3OJM A;  3FJJ A;  4IZE A;  4IYB A;  1FV3 A;  3HOM A;  4END A;  4KBB A;  2AQZ A;  3ZX7 A;  1Z4S A;  4I8M A;  3I29 B;  4J2X A;  4J23 B;  1V6V A;  3HMY A;  1BAS A;  4LO0 A;  1M2T B;  4LO3 C;  2NP0 A;  1IT0 A;  3O4C A;  2L5X A;  1JLX A;  5G00 A;  1IRP A;  2E4M C;  1TIE A;  3WA1 A;  3D7W B;  3O4D A;  4XFT A;  3PHZ A;  1ISX A;  1DQO A;  6I1B A;  41BI A;  3BAQ A;  4X3A A;  3JUT A;  3H6R B;  3PME A;  4QKR A;  3V0A A;  1XZZ A;  4D0Z A;  4H04 A;  2Y9W C;  1R8N A;  4DEN A;  1FN0 A;  4I4Y A;  1G82 A;  2X2S A;  5F90 A;  5EHA A;  4ZOT A;  1S0D A;  3IM6 A;  5F8W A;  5BXP A;  5I1B A;  3B9U A;  1PWA A;  3V79 C;  4EFP A;  3FJH A;  3AKH A;  3E8L C;  3AH4 A;  4ZA3 B;  4OEE A;  4R6U B;  7I1B A;  3CA3 A;  3S8J A;  3O4B A;  4I2S A;  1Z0H A;  4ZBV B;  3K1X A;  3W9T A;  1RG8 A;  3UD8 A;  1Q03 A;  4LO2 A;  1EPW A;  2K4A B;  1HWM B;  4P0K A;  5D63 A;  2RST A;  2FDB M;  5F8S A;  1Q04 A;  4HR6 C;  4GAI A;  2GO2 A;  1DLL A;  3AZW A;  8I1B A;  1M16 A;  2ZQN A;  4XKI A;  3UDA A;  3AH2 A;  3WMU A;  2WBC A;  1WBC A;  1S0L A;  1S0B A;  3BAG A;  5FZY A;  3JRR A;  4I4V A;  4JQ0 A;  1YYN A;  3A07 A;  4IY9 A;  4ISQ A;  2ZR1 B;  4GOY A;  2R9K B;  3NBC A;  4ZLB B;  3F62 B;  4IZX A;  3NBD A;  4GAF A;  2VLC A;  2QYI B;  1HWP B;  4Q9P A;  4I4Q A;  4I7I A;  2VSA A;  4G6J A;  2Q9X A;  2X2T A;  3CA5 A;  5EG6 C;  1BFC A;  2VU9 A;  5DSS B;  4XFS A;  5BP5 C;  4MZG B;  3WIN C;  5HPZ A;  1ISV A;  3N7M A;  5EC5 A;  3MAL A;  4ZKT B;  3O4O A;  5BQU C;  1SZ6 B;  1TWE A;  3VSF A;  4USP A;  4J2Y A;  2Y9F A;  4LO1 A;  3AKI A;  3P6J A;  3VSZ A;  1I1B A;  1JLY A;  9ILB A;  4P0L A;  3PG0 A;  4H9W A;  3FJE A;  4QD2 B;  2I1B A;  3ILA A;  2P23 A;  4ZFY B;  3NBE A;  4L4H A;  1T4Q A;  3EF2 A;  1TP0 A;  1AVA C;  2F8X C;  4HA2 A;  5BVP I;  2HWA A;  1YF8 B;  3IM5 A;  3VWC A;  4QBV A;  1S0E A;  4I37 A;  1G9A A;  4ION A;  5BXS A;  3FJ9 A;  5JLV A;  3H6R A;  2NZ9 A;  3UJ0 A;  2D7I A;  3TC2 A;  4KEI A;  3RMX A;  2KH2 A;  5B2H A;  1S0G A;  2HW9 A;  1AFC A;  1PZZ A;  4OEF A;  3BAU A;  4G1R A;  1NUN A;  3LTQ A;  2YUG A;  3N0K A;  4FVV A;  4LO8 B;  4OWJ A;  1G9C A;  1FV2 A;  2NM1 A;  4X39 A;  3VUO A;  3BRF A;  1TOO A;  1HKN A;  1II4 A;  1MD6 A;  5FNW A;  1V6W A;  2QN4 A;  4JAW A;  4I3N A;  3AJ5 A;  3O44 A;  1FWV A;  1HIB A;  1YTO A;  1W3F A;  1FGA A;  4J2S A;  4II0 A;  1JTC A;  2NYY A;  4LO0 C;  3WMV A;  2FFV A;  4QBC A;  4FGF A;  3VT0 A;  2HWM A;  3RTI B;  4G9M A;  4GP0 A;  3LLP A;  4KEJ A;  1FQ9 A;  4WBC A;  1HWN B;  3N7L A;  2NTD A;  3BA4 A;  4QKS A;  4LO7 C;  2VXR A;  4IHZ A;  2XOA A;  3FJ8 A;  4JP0 A;  4L4I A;  2D23 A;  4I4P A;  3CA4 A;  2WRY A;  2IHO A;  1FMZ A;  4EFR A;  5E24 E;  3V0B B;  1FMM S;  3BAH A;  1ILR 1;  2UUS A;  1CVS A;  3F1R A;  1K5U A;  3FFZ A;  1HCD A;  3FJC A;  31BI A;  3A23 A;  1I1E A;  1K5V A;  3OGF A;  1DZD A;  4JPZ A;  4OUJ A;  3S8K A;  1WD4 A;  3FUO A;  3VEQ A;  3HN1 A;  2VUA A;  1DIW A;  1TTU A;  3BAO A;  4QC4 A;  1YBI A;  4LO2 C;  3KMV A;  1IOB A;  1ISZ A;  1AVX B;  1V6U A;  4Q91 A;  2MIB A;  3I2A A;  4PC4 A;  4G6M A;  3AZV A;  2DRE A;  1DZC A;  4JKX B;  2K43 A;  2AXM A;  1TFM B;  3UD7 A;  3FJF A;  3CRH A;  4X37 A;  1T9F A;  4USO A;  4I1B A;  3SNV A;  2GZB A;  3AH1 A;  3ZC8 A;  5JMC A;  1DJS B;  5D61 A;  3FJD A;  1JT4 A;  4JRA A;  1EYL A;  1Q1U A;  3Q7Y A;  3PUB A;  1EVT A;  2VSE A;  3Q7W A;  3QYD A;  4TLP A;  3ZXG A;  1L2H A;  4I96 A;  1G9B A;  5DVH A;  3A21 A;  3CA0 A;  3BRD A;  1SR4 A;  2NVH A;  4P6A A;  3H6Q A;  3WO4 A;  3AKF A;  1WBA A;  1IRA X;  2DRY A;  1RY7 A;  1BFG A;  1Z2V A;  2Y9X E;  3H6S E;  3VT2 A;  2D7R A;  5GAQ A;  4I0Y A;  3ZXD A;  3CQA A;  2RG9 B;  1G9D A;  1GGP B;  1QQL A;  4DCK C;  2F2F A;  3UD9 A;  4LO3 A;  2D44 A;  2LIQ A;  3FUQ A;  4I4O A;  3UJ4 A;  3FJA A;  3OBT A;  3I2X A;  1DFC A;  1DFQ A;  1WD3 A;  2BEB A;  2E4M A;  4I4R A;  3RMY A;  1JY0 A;  4LO1 C;  4GP3 A;  2D43 A;  1EV2 A;  4G9N A;  4A7Y A;  3RSJ A;  1F31 A;  4ISR A;  1QXM A;  1AF9 A;  3T8S A;  4OWK A;  1IIL A;  1VCL A;  1JT3 A;  1S0C A;  4I1E A;  1UPS A;  3BX1 C;  5DUY A;  4Z8S B;  2F2F C;  1PUU B;  1ISY A;  3BA5 A;  1E0O A;  1DQG A;  3CAH A;  2DRZ A;  4OW4 A;  3BB2 A;  4JKQ A;  4UY4 A;  3O3Q A;  4IQP A;  4MZH A;  3Q7X A;  2K8R A;  4D8H A;  2FFU A;  1BAR A;  3CA1 A;  3O4A A;  2VXT I;  3FJB A;  3V0B A;  2ERM A;  3IM7 A;  2KI4 A;  3CU1 B;  3AJ6 A;  4MZF B;  2P39 A;  2KKI A;  3WO3 A;  4EFQ A;  2NS2 A;  1BLD A;  3P53 A;  3OGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...