4EFPA

Bombyx mori lipoprotein 7 isolated from its natural source at 1.33 a resolution
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
235
structure length
234
Chain Sequence
VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of Bombyx mori lipoprotein 7: crystallographic determination of the identity of the protein and its potential role in detoxification.
pubmed doi rcsb
molecule keywords 30kDa protein
molecule tags Unknown function
total genus 77
structure length 234
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4efpA02
4X3AA 1BA7A 2IHOA 1YYNA 4EEEB 4IY8A 2BFHA 4I4UA 4J2XA 2D22A 4EB2B 1RY7A 4I96A 3RMXA 3P6JA 3E8LC 3BRFA 3UJ0A 3RSJA 1QQLA 3H6RB 4ISQA 2Z49A 5BQUA 4I4QA 3VEQA 4Z8SB 4J2SA 4X38A 4LO1C 2YUGA 3WA1A 2P23A 1ITBA 1PZZA 4KEJA 3HN1A 4EFPA 1JQZA 3AKHA 2UUSA 3V0AB 4I4YA 5BP5C 5F8YA 1BLAA 4XFUA 4A7ZA 1XYFA 4LO0C 3UD7A 4QBCA 2D24A 1M2TB 4IZEA 5DSSB 3N7LA 3O49A 2VSAA 2DREA 3FJFA 2VXRA 4IYBA 3VT0A 1N4KA 4JKXB 4ENDA 4G1RA 4PC4A 2VXTI 2NZ9A 3PMEA 1G9AA 4KBBA 3O4AA 3ZXGA 5JLVA 3B9UA 1Q04A 3MALA 4ZGRB 2NP0A 3N7KA 4H9WA 4L4IA 9ILBA 2F2FA 1W3AA 1I1BA 4JKQA 5D62A 1FMMS 5BXRA 5JMCA 2K8RA 2X2TA 1F31A 1CVSA 1EV2A 1S0GA 1PC8B 3C9ZA 1R8NA 4GAIA 1HWMB 4LO3A 5F8SA 4I2SA 4I7IA 3T8SA 3CRHA 4ZFUB 2HZ9A 3Q7YA 1QQKA 4QO3A 1M16A 4QBVA 1JT5A 3VWCA 5HPZA 1AVWB 1HCEA 5BVPI 4D8HA 1TOOA 5D63A 5FZYA 3TC2A 3ZC8A 1FV2A 4OUJA 1PUMB 1Z2VA 3UD9A 4IZXA 4X39A 2K4AB 3AKIA 3BA4A 3AJ6A 3P53A 3BB2A 1JT4A 2ZQNA 4P0JA 31BIA 4JAWA 1QXMA 1IT0A 4F34A 4GP0A 3FJKA 3O44A 4I1BA 8I1BA 4IONA 1HCDA 3BTAA 1HWOB 3O3QA 2Y9GA 3AJ5A 1BLDA 3VSZA 1TFMB 4QKRA 1W3FA 1FWUA 4LO1A 3FJHA 2LIQA 3BAUA 4YOLA 1OQLB 4AN6A 3CA1A 4QALA 3NJ5A 2D7RA 3AKGA 3AKFA 1DFCA 2NM1A 1AFCA 1K5UA 1ABRB 5BP5A 3CA6A 1T9FA 2D7IA 3F62B 4LO0A 2Y9WC 2HWAA 1II4A 2AFGA 4I4OA 1FWVA 3FJCA 3CA3A 1ISWA 21BIA 1SZ6B 1ISZA 1AVUA 1TIEA 5F8WA 4ZLBB 2WRYA 4DCKC 1TTUA 4OEFA 1D0HA 4G9NA 1XHBA 5BXTA 5G00A 1YTOA 3BAHA 3FUQA 3S8JA 4ZKTB 2NYYA 3VSFA 3HALA 3O4BA 1S0FA 2E4MC 1KNMA 3WINC 3R4SA 4QD2C 3NBCA 4OEEA 4P0KA 1ILR1 1R8OA 3CRGA 3BRDA 3AH1A 3IIRA 4XFTA 1FGAA 4GP3A 2Z48A 3WO2A 3RTIB 4LO2C 1BFBA 1HWNB 4A7YA 1TWEA 1V6WA 4HR6C 3IAGC 1P63A 5D61A 3V0BA 1G9DA 1CE7B 1NUNA 4I37A 1DFQA 3BAOA 5I1BA 2KKIA 1DQOA 2RG9B 3IM7A 2I1BA 1EYLA 2J3PA 2L5XA 1S0CA 3FJ8A 2DRZA 1IJTA 3BX1C 1EPWA 1G82A 1BFGA 3UDAA 3WO4A 3BA5A 5BQUC 4LO8B 4FGFA 1WBCA 3CQAA 3O4OA 4JPZA 1T4QA 3LLPA 2D44A 4P0LA 1ISYA 3VT2A 1SR4A 3OJVA 2VU9A 3V79C 3RTJB 1G9BA 3WMVA 3D7WB 2FFUA 2KI4A 3FJEA 2MC2A 3I2AA 2ERMA 1JLXA 3VUOA 1I1EA 4OW4A 3ZX7A 3NBEA 3FJIA 1DZDA 1WD4A 4ZA3B 1DIWA 4L4HA 3FFZA 1S0DA 4OWKA 2X2SA 4AN7B 1JLYA 3V0BB 1BASA 3IM6A 5FZZA 1G9CA 4F83A 4CJMA 1TP0A 3AH4A 4GOVA 1RMLA 1RZOB 2IWTB 4J2KA 1MC9A 2NVHA 1Q1UA 4JRAA 2RQ9A 3OJMA 3O4DA 3F1RA 4EKXB 3MPPG 4FVVA 5E24E 1L2HA 4J23B 4H04A 1J0SA 2F2FC 3IM5A 4XFSA 3WINA 3BA7A 4KEKA 2Q9XA 2QN4A 2AQZA 1YBIA 2R9KB 4G6JA 3BADA 4P6AA 3JRRA 4I1EA 1IOBA 3AZWA 4I4VA 2F8XC 4X37A 1FV3A 4LO2A 4I6IA 4TLPA 4R6UB 3POKA 3UJ4A 2VUAA 4I4XA 3FJ9A 4ZFYB 4ZFWB 1Z4SA 3N7JA 3OGFA 2BEAA 3ILAA 2BEBA 4J2YA 4EFQA 3FJBA 3Q7XA 3CA4A 4G6MA 1V6VA 1HKNA 3FJJA 3NBNA 4LO7B 1WBAA 5B2HA 1DQGA 1AF9A 4ZOTA 3O5WB 4XKIA 4I0YA 1WD3A 4WBCA 2MIBA 2KI6B 2M49A 3OBRA 4HA2A 2AXMA 1FN0A 2HW9A 3QYDA 1HWPB 3CU1B 4DEPA 1S0EA 1MD6A 4JQ0A 3PG0A 4I8MA 5DUYA 1PWAA 1RG8A 4I4RA 1FMZA 4OWLA 2ZR1B 2WBCA 3FUOA 2HWMA 4EFRA 1V6XA 2FGFA 1BARA 1ISXA 3A21A 3HOMA 3WO3A 3OBTA 1HIBA 1VCLA 3AZVA 5DZUA 1DJSB 4QD2B 1YXWA 1IRAX 3PUBA 1IHKA 5F90A 3VT1A 1IRPA 4Q91A 4USPA 3OGGA 4I4PA 3BAQA 2DRYA 1AVXB 1YF8B 1JT7A 4QC4A 3R4UA 4HJJA 2AAIB 5GAQA 6I1BA 4G9MA 3O4CA 3H6QA 4OWJA 1AXMA 1JTCA 4GOYA 4GAFA 1UPSA 3PHZA 7I1BA 4KEIA 3SNVA 3WMUA 5FNWA 4D0TA 3FJAA 2QYIB 4I4SA 5FNXA 1W3GA 3BRGC 3BAVA 2Y9XE 5EG6C 1JT3A 2ZQOA 3CA0A 1K5VA 4KC3A 5BOWA 2D43A 3I2XA 1ISVA 3A22A 2FO1A 2ET2A 2Y9FA 3LTQA 3Q7WA 5DVHA 3N7MA 4I3NA 5EHAA 2VLCA 3A07A 3K1XA 1XZZA 1ONKB 2KLLA 1S0BA 2GZBA 4Z9WB 2NTDA 41BIA 4D0ZA 1IILA 4II0A 2D23A 3BAGA 1TWMA 4Q9PA 1V6UA 3W9TA 3CAHA 5EC5A 4ISRA 3CRIA 1S0LA 3H6RA 2D20A 1BFCA 3FGMA 1PUUB 1Z0HA 3JUTA 1E0OA 2MLLB 4IHZA 1FQ9A 1NZKA 3FJDA 4IY9A 2LIEA 1A8DA 2E4MA 3P6IA 3AH2A 2KH2A 1GGPB 2Q3NB 3S8KA 3ZC9A 4DENA 2ESUA 2GO2A 3CA5A 2D1ZA 3N0KA 3KMVA 4USOA 3V0AA 3A23A 4JP0A 3NBDA 5FZUA 4QKSA 4LO3C 1JY0A 1EVTA 4A7KA 4Q9GA 1XG6A 4ZBVB 3EF2A 3HMYA 2FDBM 1Q03A 2P39A 3I29B 5BXPA 3H6SE 4OEGA 1DZCA 2K43A 4IQPA 3HBWA 1DLLA 3HSMA 5BXSA 3OJ2A 3QR5A 1SR4C 2XOAA 3ZXDA 1AVAC 2RSTA 2VSEA 2FFVA 1BFFA 2DS0A 3RMYA 4LO7C 3UD8A
chains in the Genus database with same CATH superfamily
4X3AA 1BA7A 2IHOA 1YYNA 4EEEB 4IY8A 2BFHA 4I4UA 4J2XA 2D22A 4EB2B 1RY7A 4I96A 3RMXA 3P6JA 3E8LC 3BRFA 3UJ0A 3RSJA 1QQLA 3H6RB 4ISQA 2Z49A 5BQUA 4I4QA 3VEQA 4Z8SB 4J2SA 4X38A 4LO1C 2YUGA 3WA1A 2P23A 1ITBA 1PZZA 4KEJA 3HN1A 4EFPA 1JQZA 3AKHA 2UUSA 3V0AB 4I4YA 5BP5C 5F8YA 1BLAA 4XFUA 4A7ZA 1XYFA 4LO0C 3UD7A 4QBCA 2D24A 1M2TB 4IZEA 5DSSB 3N7LA 3O49A 2VSAA 2DREA 4H75A 3FJFA 2VXRA 4IYBA 3VT0A 1N4KA 4JKXB 4ENDA 4G1RA 4PC4A 2VXTI 2NZ9A 3PMEA 1G9AA 4KBBA 3O4AA 3ZXGA 5JLVA 3B9UA 1Q04A 3MALA 4ZGRB 2NP0A 3N7KA 4H9WA 4L4IA 9ILBA 2F2FA 1W3AA 1I1BA 4JKQA 5D62A 1FMMS 5BXRA 5JMCA 2K8RA 2X2TA 1F31A 1CVSA 1EV2A 1S0GA 1PC8B 3C9ZA 1R8NA 4GAIA 1HWMB 4LO3A 5F8SA 4I2SA 4I7IA 3T8SA 3CRHA 4ZFUB 2HZ9A 3Q7YA 1QQKA 4QO3A 1M16A 4QBVA 1JT5A 3VWCA 5HPZA 1AVWB 1HCEA 5BVPI 4D8HA 1TOOA 5D63A 5FZYA 3TC2A 3ZC8A 1FV2A 4OUJA 1PUMB 1Z2VA 2NS2A 3UD9A 4IZXA 4X39A 2K4AB 3AKIA 3BA4A 3AJ6A 3P53A 3BB2A 1JT4A 2ZQNA 4P0JA 31BIA 4JAWA 1QXMA 1IT0A 4F34A 4GP0A 3FJKA 3O44A 4I1BA 8I1BA 4IONA 1HCDA 3BTAA 1HWOB 3O3QA 2Y9GA 3AJ5A 1BLDA 3VSZA 1TFMB 4QKRA 1W3FA 1FWUA 4LO1A 3FJHA 2LIQA 3BAUA 4YOLA 1OQLB 4AN6A 3CA1A 4QALA 3NJ5A 2D7RA 3AKGA 3AKFA 1DFCA 2NM1A 1AFCA 1K5UA 1ABRB 5BP5A 3CA6A 1T9FA 2D7IA 3F62B 4LO0A 2Y9WC 2HWAA 1II4A 2AFGA 4I4OA 1FWVA 3FJCA 3CA3A 1ISWA 21BIA 1SZ6B 1ISZA 1AVUA 1TIEA 5F8WA 4ZLBB 2WRYA 4DCKC 1TTUA 4OEFA 1D0HA 4G9NA 1XHBA 5BXTA 5G00A 1YTOA 3BAHA 4MZHA 3FUQA 3S8JA 4ZKTB 2NYYA 3VSFA 3HALA 3O4BA 1S0FA 2E4MC 1KNMA 3WINC 3R4SA 4QD2C 3NBCA 4OEEA 4P0KA 1ILR1 1R8OA 3CRGA 3BRDA 3AH1A 3IIRA 4XFTA 1FGAA 4GP3A 2Z48A 3WO2A 3RTIB 4LO2C 1BFBA 1HWNB 4A7YA 1TWEA 4MZGB 1V6WA 4HR6C 3IAGC 1P63A 5D61A 3V0BA 1G9DA 1CE7B 1NUNA 4I37A 1DFQA 3BAOA 4UY4A 5I1BA 2KKIA 1DQOA 2RG9B 3IM7A 2I1BA 1EYLA 2J3PA 2L5XA 1S0CA 3FJ8A 4MZFB 2DRZA 1IJTA 3BX1C 1EPWA 1G82A 1BFGA 3UDAA 3WO4A 3BA5A 5BQUC 4LO8B 4FGFA 1WBCA 3CQAA 3O4OA 4JPZA 1T4QA 3LLPA 2D44A 4P0LA 1ISYA 3VT2A 1SR4A 3OJVA 2VU9A 3V79C 3RTJB 1G9BA 3WMVA 3D7WB 2FFUA 2KI4A 3FJEA 2MC2A 3I2AA 2ERMA 1JLXA 3VUOA 1I1EA 4OW4A 3ZX7A 3NBEA 3FJIA 1DZDA 1WD4A 4ZA3B 1DIWA 4L4HA 3FFZA 1S0DA 4OWKA 2X2SA 4AN7B 1JLYA 3V0BB 1BASA 3IM6A 5FZZA 1G9CA 4F83A 4CJMA 1TP0A 3AH4A 4GOVA 1RMLA 1RZOB 2IWTB 4J2KA 1MC9A 2NVHA 1Q1UA 4JRAA 2RQ9A 3OJMA 3O4DA 3F1RA 4EKXB 3MPPG 4FVVA 5E24E 1L2HA 4J23B 4H04A 1J0SA 2F2FC 3IM5A 4XFSA 3WINA 3BA7A 4KEKA 2Q9XA 2QN4A 2AQZA 1YBIA 2R9KB 4G6JA 3BADA 4P6AA 3JRRA 4I1EA 1IOBA 3AZWA 4I4VA 2F8XC 4X37A 1FV3A 4LO2A 4I6IA 4TLPA 4R6UB 3POKA 3UJ4A 2VUAA 4I4XA 3FJ9A 4ZFYB 4ZFWB 1Z4SA 3N7JA 3OGFA 2BEAA 3ILAA 2BEBA 4J2YA 4EFQA 3FJBA 3Q7XA 3CA4A 4G6MA 1V6VA 1HKNA 3FJJA 3NBNA 4LO7B 1WBAA 5B2HA 1DQGA 1AF9A 4ZOTA 3O5WB 4XKIA 4I0YA 1WD3A 4WBCA 2MIBA 2KI6B 2M49A 3OBRA 4HA2A 2AXMA 1FN0A 2HW9A 3QYDA 1HWPB 3CU1B 4DEPA 1S0EA 1MD6A 4JQ0A 3PG0A 4I8MA 5DUYA 1PWAA 1RG8A 4I4RA 1FMZA 4OWLA 2ZR1B 2WBCA 3FUOA 2HWMA 4EFRA 1V6XA 2FGFA 1BARA 1ISXA 3A21A 3HOMA 3WO3A 3OBTA 1HIBA 1VCLA 3AZVA 5DZUA 1DJSB 4QD2B 1YXWA 1IRAX 3PUBA 1IHKA 5F90A 3VT1A 1IRPA 4Q91A 4USPA 3OGGA 4I4PA 3BAQA 2DRYA 1AVXB 1YF8B 1JT7A 4QC4A 3R4UA 4HJJA 2AAIB 5GAQA 6I1BA 4G9MA 3O4CA 3H6QA 4OWJA 1AXMA 1JTCA 4GOYA 4GAFA 1UPSA 3PHZA 7I1BA 4KEIA 3SNVA 3WMUA 5FNWA 4D0TA 3FJAA 2QYIB 4I4SA 5FNXA 1W3GA 3BRGC 3BAVA 2Y9XE 5EG6C 1JT3A 2ZQOA 3CA0A 1K5VA 4KC3A 5BOWA 2D43A 3I2XA 1ISVA 3A22A 2FO1A 2ET2A 2Y9FA 3LTQA 3Q7WA 5DVHA 3N7MA 4I3NA 5EHAA 2VLCA 3A07A 3K1XA 1XZZA 1ONKB 2KLLA 1S0BA 2GZBA 4Z9WB 2NTDA 41BIA 4D0ZA 1IILA 4II0A 2D23A 3BAGA 1TWMA 4Q9PA 1V6UA 3W9TA 3CAHA 5EC5A 4ISRA 3CRIA 1S0LA 3H6RA 2D20A 1BFCA 3FGMA 1PUUB 1Z0HA 3JUTA 1E0OA 2MLLB 4IHZA 1FQ9A 1NZKA 3FJDA 4IY9A 2LIEA 1A8DA 2E4MA 3P6IA 3AH2A 2KH2A 1GGPB 2Q3NB 3S8KA 3ZC9A 4DENA 2ESUA 2GO2A 3CA5A 2D1ZA 3N0KA 3KMVA 4USOA 3V0AA 3A23A 4JP0A 3NBDA 5FZUA 4QKSA 4LO3C 1JY0A 1EVTA 4A7KA 4Q9GA 1XG6A 4ZBVB 3EF2A 3HMYA 2FDBM 1Q03A 2P39A 3I29B 5BXPA 3H6SE 4OEGA 1DZCA 2K43A 4IQPA 3HBWA 1DLLA 3HSMA 5BXSA 3OJ2A 3QR5A 1SR4C 2XOAA 3ZXDA 1AVAC 2RSTA 2VSEA 2FFVA 1BFFA 2DS0A 3RMYA 4LO7C 3UD8A
chains in the Genus database with same CATH topology
4X3AA 1BA7A 2IHOA 1YYNA 4EEEB 4IY8A 2BFHA 4I4UA 4J2XA 2D22A 4EB2B 1RY7A 4I96A 3RMXA 3P6JA 3E8LC 3BRFA 3UJ0A 3RSJA 1QQLA 3H6RB 4ISQA 2Z49A 5BQUA 4I4QA 3VEQA 4Z8SB 4J2SA 4X38A 4LO1C 2YUGA 3WA1A 2P23A 1ITBA 1PZZA 4KEJA 3HN1A 4EFPA 1JQZA 3AKHA 2UUSA 3V0AB 4I4YA 5BP5C 5F8YA 1BLAA 4XFUA 4A7ZA 1XYFA 4LO0C 3UD7A 4QBCA 2D24A 1M2TB 4IZEA 5DSSB 3N7LA 3O49A 2VSAA 2DREA 4H75A 3FJFA 2VXRA 4IYBA 3VT0A 1N4KA 4JKXB 4ENDA 4G1RA 4PC4A 2VXTI 2NZ9A 3PMEA 1G9AA 4KBBA 3O4AA 3ZXGA 5JLVA 3B9UA 1Q04A 3MALA 4ZGRB 2NP0A 3N7KA 4H9WA 4L4IA 9ILBA 2F2FA 1W3AA 1I1BA 4JKQA 5D62A 1FMMS 5BXRA 5JMCA 2K8RA 2X2TA 1F31A 1CVSA 1EV2A 1S0GA 1PC8B 3C9ZA 1R8NA 4GAIA 1HWMB 4LO3A 5F8SA 4I2SA 4I7IA 3T8SA 3CRHA 4ZFUB 2HZ9A 3Q7YA 1QQKA 4QO3A 1M16A 4QBVA 1JT5A 3VWCA 5HPZA 1AVWB 1HCEA 5BVPI 4D8HA 1TOOA 5D63A 5FZYA 3TC2A 3ZC8A 1FV2A 4OUJA 1PUMB 1Z2VA 2NS2A 3UD9A 4IZXA 4X39A 2K4AB 3AKIA 3BA4A 3AJ6A 3P53A 3BB2A 1JT4A 2ZQNA 4P0JA 31BIA 4JAWA 1QXMA 1IT0A 4F34A 4GP0A 3FJKA 3O44A 4I1BA 8I1BA 4IONA 1HCDA 3BTAA 1HWOB 3O3QA 2Y9GA 3AJ5A 1BLDA 3VSZA 1TFMB 4QKRA 1W3FA 1FWUA 4LO1A 3FJHA 2LIQA 3BAUA 4YOLA 1OQLB 4AN6A 3CA1A 4QALA 3NJ5A 2D7RA 3AKGA 3AKFA 1DFCA 2NM1A 1AFCA 1K5UA 1ABRB 5BP5A 3CA6A 1T9FA 2D7IA 3F62B 4LO0A 2Y9WC 2HWAA 1II4A 2AFGA 4I4OA 1FWVA 3FJCA 3CA3A 1ISWA 21BIA 1SZ6B 1ISZA 1AVUA 1TIEA 5F8WA 4ZLBB 2WRYA 4DCKC 1TTUA 4OEFA 1D0HA 4G9NA 1XHBA 5BXTA 5G00A 1YTOA 3BAHA 4MZHA 3FUQA 3S8JA 4ZKTB 2NYYA 3VSFA 3HALA 3O4BA 1S0FA 2E4MC 1KNMA 3WINC 3R4SA 4QD2C 3NBCA 4OEEA 4P0KA 1ILR1 1R8OA 3CRGA 3BRDA 3AH1A 3IIRA 4XFTA 1FGAA 4GP3A 2Z48A 3WO2A 3RTIB 4LO2C 1BFBA 1HWNB 4A7YA 1TWEA 4MZGB 1V6WA 4HR6C 3IAGC 1P63A 5D61A 3V0BA 1G9DA 1CE7B 1NUNA 4I37A 1DFQA 3BAOA 4UY4A 5I1BA 2KKIA 1DQOA 2RG9B 3IM7A 2I1BA 1EYLA 2J3PA 2L5XA 1S0CA 3FJ8A 4MZFB 2DRZA 1IJTA 3BX1C 1EPWA 1G82A 1BFGA 3UDAA 3WO4A 3BA5A 5BQUC 4LO8B 4FGFA 1WBCA 3CQAA 3O4OA 4JPZA 1T4QA 3LLPA 2D44A 4P0LA 1ISYA 3VT2A 1SR4A 3OJVA 2VU9A 3V79C 3RTJB 1G9BA 3WMVA 3D7WB 2FFUA 2KI4A 3FJEA 2MC2A 3I2AA 2ERMA 1JLXA 3VUOA 1I1EA 4OW4A 3ZX7A 3NBEA 3FJIA 1DZDA 1WD4A 4ZA3B 1DIWA 4L4HA 3FFZA 1S0DA 4OWKA 2X2SA 4AN7B 1JLYA 3V0BB 1BASA 3IM6A 5FZZA 1G9CA 4F83A 4CJMA 1TP0A 3AH4A 4GOVA 1RMLA 1RZOB 2IWTB 4J2KA 1MC9A 2NVHA 1Q1UA 4JRAA 2RQ9A 3OJMA 3O4DA 3F1RA 4EKXB 3MPPG 4FVVA 5E24E 1L2HA 4J23B 4H04A 1J0SA 2F2FC 3IM5A 4XFSA 3WINA 3BA7A 4KEKA 2Q9XA 2QN4A 2AQZA 1YBIA 2R9KB 4G6JA 3BADA 4P6AA 3JRRA 4I1EA 1IOBA 3AZWA 4I4VA 2F8XC 4X37A 1FV3A 4LO2A 4I6IA 4TLPA 4R6UB 3POKA 3UJ4A 2VUAA 4I4XA 3FJ9A 4ZFYB 4ZFWB 1Z4SA 3N7JA 3OGFA 2BEAA 3ILAA 2BEBA 4J2YA 4EFQA 3FJBA 3Q7XA 3CA4A 4G6MA 1V6VA 1HKNA 3FJJA 3NBNA 4LO7B 1WBAA 5B2HA 1DQGA 1AF9A 4ZOTA 3O5WB 4XKIA 4I0YA 1WD3A 4WBCA 2MIBA 2KI6B 2M49A 3OBRA 4HA2A 2AXMA 1FN0A 2HW9A 3QYDA 1HWPB 3CU1B 4DEPA 1S0EA 1MD6A 4JQ0A 3PG0A 4I8MA 5DUYA 1PWAA 1RG8A 4I4RA 1FMZA 4OWLA 2ZR1B 2WBCA 3FUOA 2HWMA 4EFRA 1V6XA 2FGFA 1BARA 1ISXA 3A21A 3HOMA 3WO3A 3OBTA 1HIBA 1VCLA 3AZVA 5DZUA 1DJSB 4QD2B 1YXWA 1IRAX 3PUBA 1IHKA 5F90A 3VT1A 1IRPA 4Q91A 4USPA 3OGGA 4I4PA 3BAQA 2DRYA 1AVXB 1YF8B 1JT7A 4QC4A 3R4UA 4HJJA 2AAIB 5GAQA 6I1BA 4G9MA 3O4CA 3H6QA 4OWJA 1AXMA 1JTCA 4GOYA 4GAFA 1UPSA 3PHZA 7I1BA 4KEIA 3SNVA 3WMUA 5FNWA 4D0TA 3FJAA 2QYIB 4I4SA 5FNXA 1W3GA 3BRGC 3BAVA 2Y9XE 5EG6C 1JT3A 2ZQOA 3CA0A 1K5VA 4KC3A 5BOWA 2D43A 3I2XA 1ISVA 3A22A 2FO1A 2ET2A 2Y9FA 3LTQA 3Q7WA 5DVHA 3N7MA 4I3NA 5EHAA 2VLCA 3A07A 3K1XA 1XZZA 1ONKB 2KLLA 1S0BA 2GZBA 4Z9WB 2NTDA 41BIA 4D0ZA 1IILA 4II0A 2D23A 3BAGA 1TWMA 4Q9PA 1V6UA 3W9TA 3CAHA 5EC5A 4ISRA 3CRIA 1S0LA 3H6RA 2D20A 1BFCA 3FGMA 1PUUB 1Z0HA 3JUTA 1E0OA 2MLLB 4IHZA 1FQ9A 1NZKA 3FJDA 4IY9A 2LIEA 1A8DA 2E4MA 3P6IA 3AH2A 2KH2A 1GGPB 2Q3NB 3S8KA 3ZC9A 4DENA 2ESUA 2GO2A 3CA5A 2D1ZA 3N0KA 3KMVA 4USOA 3V0AA 3A23A 4JP0A 3NBDA 5FZUA 4QKSA 4LO3C 1JY0A 1EVTA 4A7KA 4Q9GA 1XG6A 4ZBVB 3EF2A 3HMYA 2FDBM 1Q03A 2P39A 3I29B 5BXPA 3H6SE 4OEGA 1DZCA 2K43A 4IQPA 3HBWA 1DLLA 3HSMA 5BXSA 3OJ2A 3QR5A 1SR4C 2XOAA 3ZXDA 1AVAC 2RSTA 2VSEA 2FFVA 1BFFA 2DS0A 3RMYA 4LO7C 3UD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X3A A;  1BA7 A;  2IHO A;  1YYN A;  4EEE B;  4IY8 A;  2BFH A;  4I4U A;  4J2X A;  2D22 A;  4EB2 B;  1RY7 A;  4I96 A;  3RMX A;  3P6J A;  3E8L C;  3BRF A;  3UJ0 A;  3RSJ A;  1QQL A;  3H6R B;  4ISQ A;  2Z49 A;  5BQU A;  4I4Q A;  3VEQ A;  4Z8S B;  4J2S A;  4X38 A;  4LO1 C;  2YUG A;  3WA1 A;  2P23 A;  1ITB A;  1PZZ A;  4KEJ A;  3HN1 A;  4EFP A;  1JQZ A;  3AKH A;  2UUS A;  3V0A B;  4I4Y A;  5BP5 C;  5F8Y A;  1BLA A;  4XFU A;  4A7Z A;  1XYF A;  4LO0 C;  3UD7 A;  4QBC A;  2D24 A;  1M2T B;  4IZE A;  5DSS B;  3N7L A;  3O49 A;  2VSA A;  2DRE A;  3FJF A;  2VXR A;  4IYB A;  3VT0 A;  1N4K A;  4JKX B;  4END A;  4G1R A;  4PC4 A;  2VXT I;  2NZ9 A;  3PME A;  1G9A A;  4KBB A;  3O4A A;  3ZXG A;  5JLV A;  3B9U A;  1Q04 A;  3MAL A;  4ZGR B;  2NP0 A;  3N7K A;  4H9W A;  4L4I A;  9ILB A;  2F2F A;  1W3A A;  1I1B A;  4JKQ A;  5D62 A;  1FMM S;  5BXR A;  5JMC A;  2K8R A;  2X2T A;  1F31 A;  1CVS A;  1EV2 A;  1S0G A;  1PC8 B;  3C9Z A;  1R8N A;  4GAI A;  1HWM B;  4LO3 A;  5F8S A;  4I2S A;  4I7I A;  3T8S A;  3CRH A;  4ZFU B;  2HZ9 A;  3Q7Y A;  1QQK A;  4QO3 A;  1M16 A;  4QBV A;  1JT5 A;  3VWC A;  5HPZ A;  1AVW B;  1HCE A;  5BVP I;  4D8H A;  1TOO A;  5D63 A;  5FZY A;  3TC2 A;  3ZC8 A;  1FV2 A;  4OUJ A;  1PUM B;  1Z2V A;  3UD9 A;  4IZX A;  4X39 A;  2K4A B;  3AKI A;  3BA4 A;  3AJ6 A;  3P53 A;  3BB2 A;  1JT4 A;  2ZQN A;  4P0J A;  31BI A;  4JAW A;  1QXM A;  1IT0 A;  4F34 A;  4GP0 A;  3FJK A;  3O44 A;  4I1B A;  8I1B A;  4ION A;  1HCD A;  3BTA A;  1HWO B;  3O3Q A;  2Y9G A;  3AJ5 A;  1BLD A;  3VSZ A;  1TFM B;  4QKR A;  1W3F A;  1FWU A;  4LO1 A;  3FJH A;  2LIQ A;  3BAU A;  4YOL A;  1OQL B;  4AN6 A;  3CA1 A;  4QAL A;  3NJ5 A;  2D7R A;  3AKG A;  3AKF A;  1DFC A;  2NM1 A;  1AFC A;  1K5U A;  1ABR B;  5BP5 A;  3CA6 A;  1T9F A;  2D7I A;  3F62 B;  4LO0 A;  2Y9W C;  2HWA A;  1II4 A;  2AFG A;  4I4O A;  1FWV A;  3FJC A;  3CA3 A;  1ISW A;  21BI A;  1SZ6 B;  1ISZ A;  1AVU A;  1TIE A;  5F8W A;  4ZLB B;  2WRY A;  4DCK C;  1TTU A;  4OEF A;  1D0H A;  4G9N A;  1XHB A;  5BXT A;  5G00 A;  1YTO A;  3BAH A;  3FUQ A;  3S8J A;  4ZKT B;  2NYY A;  3VSF A;  3HAL A;  3O4B A;  1S0F A;  2E4M C;  1KNM A;  3WIN C;  3R4S A;  4QD2 C;  3NBC A;  4OEE A;  4P0K A;  1ILR 1;  1R8O A;  3CRG A;  3BRD A;  3AH1 A;  3IIR A;  4XFT A;  1FGA A;  4GP3 A;  2Z48 A;  3WO2 A;  3RTI B;  4LO2 C;  1BFB A;  1HWN B;  4A7Y A;  1TWE A;  1V6W A;  4HR6 C;  3IAG C;  1P63 A;  5D61 A;  3V0B A;  1G9D A;  1CE7 B;  1NUN A;  4I37 A;  1DFQ A;  3BAO A;  5I1B A;  2KKI A;  1DQO A;  2RG9 B;  3IM7 A;  2I1B A;  1EYL A;  2J3P A;  2L5X A;  1S0C A;  3FJ8 A;  2DRZ A;  1IJT A;  3BX1 C;  1EPW A;  1G82 A;  1BFG A;  3UDA A;  3WO4 A;  3BA5 A;  5BQU C;  4LO8 B;  4FGF A;  1WBC A;  3CQA A;  3O4O A;  4JPZ A;  1T4Q A;  3LLP A;  2D44 A;  4P0L A;  1ISY A;  3VT2 A;  1SR4 A;  3OJV A;  2VU9 A;  3V79 C;  3RTJ B;  1G9B A;  3WMV A;  3D7W B;  2FFU A;  2KI4 A;  3FJE A;  2MC2 A;  3I2A A;  2ERM A;  1JLX A;  3VUO A;  1I1E A;  4OW4 A;  3ZX7 A;  3NBE A;  3FJI A;  1DZD A;  1WD4 A;  4ZA3 B;  1DIW A;  4L4H A;  3FFZ A;  1S0D A;  4OWK A;  2X2S A;  4AN7 B;  1JLY A;  3V0B B;  1BAS A;  3IM6 A;  5FZZ A;  1G9C A;  4F83 A;  4CJM A;  1TP0 A;  3AH4 A;  4GOV A;  1RML A;  1RZO B;  2IWT B;  4J2K A;  1MC9 A;  2NVH A;  1Q1U A;  4JRA A;  2RQ9 A;  3OJM A;  3O4D A;  3F1R A;  4EKX B;  3MPP G;  4FVV A;  5E24 E;  1L2H A;  4J23 B;  4H04 A;  1J0S A;  2F2F C;  3IM5 A;  4XFS A;  3WIN A;  3BA7 A;  4KEK A;  2Q9X A;  2QN4 A;  2AQZ A;  1YBI A;  2R9K B;  4G6J A;  3BAD A;  4P6A A;  3JRR A;  4I1E A;  1IOB A;  3AZW A;  4I4V A;  2F8X C;  4X37 A;  1FV3 A;  4LO2 A;  4I6I A;  4TLP A;  4R6U B;  3POK A;  3UJ4 A;  2VUA A;  4I4X A;  3FJ9 A;  4ZFY B;  4ZFW B;  1Z4S A;  3N7J A;  3OGF A;  2BEA A;  3ILA A;  2BEB A;  4J2Y A;  4EFQ A;  3FJB A;  3Q7X A;  3CA4 A;  4G6M A;  1V6V A;  1HKN A;  3FJJ A;  3NBN A;  4LO7 B;  1WBA A;  5B2H A;  1DQG A;  1AF9 A;  4ZOT A;  3O5W B;  4XKI A;  4I0Y A;  1WD3 A;  4WBC A;  2MIB A;  2KI6 B;  2M49 A;  3OBR A;  4HA2 A;  2AXM A;  1FN0 A;  2HW9 A;  3QYD A;  1HWP B;  3CU1 B;  4DEP A;  1S0E A;  1MD6 A;  4JQ0 A;  3PG0 A;  4I8M A;  5DUY A;  1PWA A;  1RG8 A;  4I4R A;  1FMZ A;  4OWL A;  2ZR1 B;  2WBC A;  3FUO A;  2HWM A;  4EFR A;  1V6X A;  2FGF A;  1BAR A;  1ISX A;  3A21 A;  3HOM A;  3WO3 A;  3OBT A;  1HIB A;  1VCL A;  3AZV A;  5DZU A;  1DJS B;  4QD2 B;  1YXW A;  1IRA X;  3PUB A;  1IHK A;  5F90 A;  3VT1 A;  1IRP A;  4Q91 A;  4USP A;  3OGG A;  4I4P A;  3BAQ A;  2DRY A;  1AVX B;  1YF8 B;  1JT7 A;  4QC4 A;  3R4U A;  4HJJ A;  2AAI B;  5GAQ A;  6I1B A;  4G9M A;  3O4C A;  3H6Q A;  4OWJ A;  1AXM A;  1JTC A;  4GOY A;  4GAF A;  1UPS A;  3PHZ A;  7I1B A;  4KEI A;  3SNV A;  3WMU A;  5FNW A;  4D0T A;  3FJA A;  2QYI B;  4I4S A;  5FNX A;  1W3G A;  3BRG C;  3BAV A;  2Y9X E;  5EG6 C;  1JT3 A;  2ZQO A;  3CA0 A;  1K5V A;  4KC3 A;  5BOW A;  2D43 A;  3I2X A;  1ISV A;  3A22 A;  2FO1 A;  2ET2 A;  2Y9F A;  3LTQ A;  3Q7W A;  5DVH A;  3N7M A;  4I3N A;  5EHA A;  2VLC A;  3A07 A;  3K1X A;  1XZZ A;  1ONK B;  2KLL A;  1S0B A;  2GZB A;  4Z9W B;  2NTD A;  41BI A;  4D0Z A;  1IIL A;  4II0 A;  2D23 A;  3BAG A;  1TWM A;  4Q9P A;  1V6U A;  3W9T A;  3CAH A;  5EC5 A;  4ISR A;  3CRI A;  1S0L A;  3H6R A;  2D20 A;  1BFC A;  3FGM A;  1PUU B;  1Z0H A;  3JUT A;  1E0O A;  2MLL B;  4IHZ A;  1FQ9 A;  1NZK A;  3FJD A;  4IY9 A;  2LIE A;  1A8D A;  2E4M A;  3P6I A;  3AH2 A;  2KH2 A;  1GGP B;  2Q3N B;  3S8K A;  3ZC9 A;  4DEN A;  2ESU A;  2GO2 A;  3CA5 A;  2D1Z A;  3N0K A;  3KMV A;  4USO A;  3V0A A;  3A23 A;  4JP0 A;  3NBD A;  5FZU A;  4QKS A;  4LO3 C;  1JY0 A;  1EVT A;  4A7K A;  4Q9G A;  1XG6 A;  4ZBV B;  3EF2 A;  3HMY A;  2FDB M;  1Q03 A;  2P39 A;  3I29 B;  5BXP A;  3H6S E;  4OEG A;  1DZC A;  2K43 A;  4IQP A;  3HBW A;  1DLL A;  3HSM A;  5BXS A;  3OJ2 A;  3QR5 A;  1SR4 C;  2XOA A;  3ZXD A;  1AVA C;  2RST A;  2VSE A;  2FFV A;  1BFF A;  2DS0 A;  3RMY A;  4LO7 C;  3UD8 A; 
#chains in the Genus database with same CATH topology
 4X3A A;  1BA7 A;  2IHO A;  1YYN A;  4EEE B;  4IY8 A;  2BFH A;  4I4U A;  4J2X A;  2D22 A;  4EB2 B;  1RY7 A;  4I96 A;  3RMX A;  3P6J A;  3E8L C;  3BRF A;  3UJ0 A;  3RSJ A;  1QQL A;  3H6R B;  4ISQ A;  2Z49 A;  5BQU A;  4I4Q A;  3VEQ A;  4Z8S B;  4J2S A;  4X38 A;  4LO1 C;  2YUG A;  3WA1 A;  2P23 A;  1ITB A;  1PZZ A;  4KEJ A;  3HN1 A;  4EFP A;  1JQZ A;  3AKH A;  2UUS A;  3V0A B;  4I4Y A;  5BP5 C;  5F8Y A;  1BLA A;  4XFU A;  4A7Z A;  1XYF A;  4LO0 C;  3UD7 A;  4QBC A;  2D24 A;  1M2T B;  4IZE A;  5DSS B;  3N7L A;  3O49 A;  2VSA A;  2DRE A;  4H75 A;  3FJF A;  2VXR A;  4IYB A;  3VT0 A;  1N4K A;  4JKX B;  4END A;  4G1R A;  4PC4 A;  2VXT I;  2NZ9 A;  3PME A;  1G9A A;  4KBB A;  3O4A A;  3ZXG A;  5JLV A;  3B9U A;  1Q04 A;  3MAL A;  4ZGR B;  2NP0 A;  3N7K A;  4H9W A;  4L4I A;  9ILB A;  2F2F A;  1W3A A;  1I1B A;  4JKQ A;  5D62 A;  1FMM S;  5BXR A;  5JMC A;  2K8R A;  2X2T A;  1F31 A;  1CVS A;  1EV2 A;  1S0G A;  1PC8 B;  3C9Z A;  1R8N A;  4GAI A;  1HWM B;  4LO3 A;  5F8S A;  4I2S A;  4I7I A;  3T8S A;  3CRH A;  4ZFU B;  2HZ9 A;  3Q7Y A;  1QQK A;  4QO3 A;  1M16 A;  4QBV A;  1JT5 A;  3VWC A;  5HPZ A;  1AVW B;  1HCE A;  5BVP I;  4D8H A;  1TOO A;  5D63 A;  5FZY A;  3TC2 A;  3ZC8 A;  1FV2 A;  4OUJ A;  1PUM B;  1Z2V A;  2NS2 A;  3UD9 A;  4IZX A;  4X39 A;  2K4A B;  3AKI A;  3BA4 A;  3AJ6 A;  3P53 A;  3BB2 A;  1JT4 A;  2ZQN A;  4P0J A;  31BI A;  4JAW A;  1QXM A;  1IT0 A;  4F34 A;  4GP0 A;  3FJK A;  3O44 A;  4I1B A;  8I1B A;  4ION A;  1HCD A;  3BTA A;  1HWO B;  3O3Q A;  2Y9G A;  3AJ5 A;  1BLD A;  3VSZ A;  1TFM B;  4QKR A;  1W3F A;  1FWU A;  4LO1 A;  3FJH A;  2LIQ A;  3BAU A;  4YOL A;  1OQL B;  4AN6 A;  3CA1 A;  4QAL A;  3NJ5 A;  2D7R A;  3AKG A;  3AKF A;  1DFC A;  2NM1 A;  1AFC A;  1K5U A;  1ABR B;  5BP5 A;  3CA6 A;  1T9F A;  2D7I A;  3F62 B;  4LO0 A;  2Y9W C;  2HWA A;  1II4 A;  2AFG A;  4I4O A;  1FWV A;  3FJC A;  3CA3 A;  1ISW A;  21BI A;  1SZ6 B;  1ISZ A;  1AVU A;  1TIE A;  5F8W A;  4ZLB B;  2WRY A;  4DCK C;  1TTU A;  4OEF A;  1D0H A;  4G9N A;  1XHB A;  5BXT A;  5G00 A;  1YTO A;  3BAH A;  4MZH A;  3FUQ A;  3S8J A;  4ZKT B;  2NYY A;  3VSF A;  3HAL A;  3O4B A;  1S0F A;  2E4M C;  1KNM A;  3WIN C;  3R4S A;  4QD2 C;  3NBC A;  4OEE A;  4P0K A;  1ILR 1;  1R8O A;  3CRG A;  3BRD A;  3AH1 A;  3IIR A;  4XFT A;  1FGA A;  4GP3 A;  2Z48 A;  3WO2 A;  3RTI B;  4LO2 C;  1BFB A;  1HWN B;  4A7Y A;  1TWE A;  4MZG B;  1V6W A;  4HR6 C;  3IAG C;  1P63 A;  5D61 A;  3V0B A;  1G9D A;  1CE7 B;  1NUN A;  4I37 A;  1DFQ A;  3BAO A;  4UY4 A;  5I1B A;  2KKI A;  1DQO A;  2RG9 B;  3IM7 A;  2I1B A;  1EYL A;  2J3P A;  2L5X A;  1S0C A;  3FJ8 A;  4MZF B;  2DRZ A;  1IJT A;  3BX1 C;  1EPW A;  1G82 A;  1BFG A;  3UDA A;  3WO4 A;  3BA5 A;  5BQU C;  4LO8 B;  4FGF A;  1WBC A;  3CQA A;  3O4O A;  4JPZ A;  1T4Q A;  3LLP A;  2D44 A;  4P0L A;  1ISY A;  3VT2 A;  1SR4 A;  3OJV A;  2VU9 A;  3V79 C;  3RTJ B;  1G9B A;  3WMV A;  3D7W B;  2FFU A;  2KI4 A;  3FJE A;  2MC2 A;  3I2A A;  2ERM A;  1JLX A;  3VUO A;  1I1E A;  4OW4 A;  3ZX7 A;  3NBE A;  3FJI A;  1DZD A;  1WD4 A;  4ZA3 B;  1DIW A;  4L4H A;  3FFZ A;  1S0D A;  4OWK A;  2X2S A;  4AN7 B;  1JLY A;  3V0B B;  1BAS A;  3IM6 A;  5FZZ A;  1G9C A;  4F83 A;  4CJM A;  1TP0 A;  3AH4 A;  4GOV A;  1RML A;  1RZO B;  2IWT B;  4J2K A;  1MC9 A;  2NVH A;  1Q1U A;  4JRA A;  2RQ9 A;  3OJM A;  3O4D A;  3F1R A;  4EKX B;  3MPP G;  4FVV A;  5E24 E;  1L2H A;  4J23 B;  4H04 A;  1J0S A;  2F2F C;  3IM5 A;  4XFS A;  3WIN A;  3BA7 A;  4KEK A;  2Q9X A;  2QN4 A;  2AQZ A;  1YBI A;  2R9K B;  4G6J A;  3BAD A;  4P6A A;  3JRR A;  4I1E A;  1IOB A;  3AZW A;  4I4V A;  2F8X C;  4X37 A;  1FV3 A;  4LO2 A;  4I6I A;  4TLP A;  4R6U B;  3POK A;  3UJ4 A;  2VUA A;  4I4X A;  3FJ9 A;  4ZFY B;  4ZFW B;  1Z4S A;  3N7J A;  3OGF A;  2BEA A;  3ILA A;  2BEB A;  4J2Y A;  4EFQ A;  3FJB A;  3Q7X A;  3CA4 A;  4G6M A;  1V6V A;  1HKN A;  3FJJ A;  3NBN A;  4LO7 B;  1WBA A;  5B2H A;  1DQG A;  1AF9 A;  4ZOT A;  3O5W B;  4XKI A;  4I0Y A;  1WD3 A;  4WBC A;  2MIB A;  2KI6 B;  2M49 A;  3OBR A;  4HA2 A;  2AXM A;  1FN0 A;  2HW9 A;  3QYD A;  1HWP B;  3CU1 B;  4DEP A;  1S0E A;  1MD6 A;  4JQ0 A;  3PG0 A;  4I8M A;  5DUY A;  1PWA A;  1RG8 A;  4I4R A;  1FMZ A;  4OWL A;  2ZR1 B;  2WBC A;  3FUO A;  2HWM A;  4EFR A;  1V6X A;  2FGF A;  1BAR A;  1ISX A;  3A21 A;  3HOM A;  3WO3 A;  3OBT A;  1HIB A;  1VCL A;  3AZV A;  5DZU A;  1DJS B;  4QD2 B;  1YXW A;  1IRA X;  3PUB A;  1IHK A;  5F90 A;  3VT1 A;  1IRP A;  4Q91 A;  4USP A;  3OGG A;  4I4P A;  3BAQ A;  2DRY A;  1AVX B;  1YF8 B;  1JT7 A;  4QC4 A;  3R4U A;  4HJJ A;  2AAI B;  5GAQ A;  6I1B A;  4G9M A;  3O4C A;  3H6Q A;  4OWJ A;  1AXM A;  1JTC A;  4GOY A;  4GAF A;  1UPS A;  3PHZ A;  7I1B A;  4KEI A;  3SNV A;  3WMU A;  5FNW A;  4D0T A;  3FJA A;  2QYI B;  4I4S A;  5FNX A;  1W3G A;  3BRG C;  3BAV A;  2Y9X E;  5EG6 C;  1JT3 A;  2ZQO A;  3CA0 A;  1K5V A;  4KC3 A;  5BOW A;  2D43 A;  3I2X A;  1ISV A;  3A22 A;  2FO1 A;  2ET2 A;  2Y9F A;  3LTQ A;  3Q7W A;  5DVH A;  3N7M A;  4I3N A;  5EHA A;  2VLC A;  3A07 A;  3K1X A;  1XZZ A;  1ONK B;  2KLL A;  1S0B A;  2GZB A;  4Z9W B;  2NTD A;  41BI A;  4D0Z A;  1IIL A;  4II0 A;  2D23 A;  3BAG A;  1TWM A;  4Q9P A;  1V6U A;  3W9T A;  3CAH A;  5EC5 A;  4ISR A;  3CRI A;  1S0L A;  3H6R A;  2D20 A;  1BFC A;  3FGM A;  1PUU B;  1Z0H A;  3JUT A;  1E0O A;  2MLL B;  4IHZ A;  1FQ9 A;  1NZK A;  3FJD A;  4IY9 A;  2LIE A;  1A8D A;  2E4M A;  3P6I A;  3AH2 A;  2KH2 A;  1GGP B;  2Q3N B;  3S8K A;  3ZC9 A;  4DEN A;  2ESU A;  2GO2 A;  3CA5 A;  2D1Z A;  3N0K A;  3KMV A;  4USO A;  3V0A A;  3A23 A;  4JP0 A;  3NBD A;  5FZU A;  4QKS A;  4LO3 C;  1JY0 A;  1EVT A;  4A7K A;  4Q9G A;  1XG6 A;  4ZBV B;  3EF2 A;  3HMY A;  2FDB M;  1Q03 A;  2P39 A;  3I29 B;  5BXP A;  3H6S E;  4OEG A;  1DZC A;  2K43 A;  4IQP A;  3HBW A;  1DLL A;  3HSM A;  5BXS A;  3OJ2 A;  3QR5 A;  1SR4 C;  2XOA A;  3ZXD A;  1AVA C;  2RST A;  2VSE A;  2FFV A;  1BFF A;  2DS0 A;  3RMY A;  4LO7 C;  3UD8 A; 
#chains in the Genus database with same CATH homology
 4X3A A;  1BA7 A;  2IHO A;  1YYN A;  4EEE B;  4IY8 A;  2BFH A;  4I4U A;  4J2X A;  2D22 A;  4EB2 B;  1RY7 A;  4I96 A;  3RMX A;  3P6J A;  3E8L C;  3BRF A;  3UJ0 A;  3RSJ A;  1QQL A;  3H6R B;  4ISQ A;  2Z49 A;  5BQU A;  4I4Q A;  3VEQ A;  4Z8S B;  4J2S A;  4X38 A;  4LO1 C;  2YUG A;  3WA1 A;  2P23 A;  1ITB A;  1PZZ A;  4KEJ A;  3HN1 A;  4EFP A;  1JQZ A;  3AKH A;  2UUS A;  3V0A B;  4I4Y A;  5BP5 C;  5F8Y A;  1BLA A;  4XFU A;  4A7Z A;  1XYF A;  4LO0 C;  3UD7 A;  4QBC A;  2D24 A;  1M2T B;  4IZE A;  5DSS B;  3N7L A;  3O49 A;  2VSA A;  2DRE A;  4H75 A;  3FJF A;  2VXR A;  4IYB A;  3VT0 A;  1N4K A;  4JKX B;  4END A;  4G1R A;  4PC4 A;  2VXT I;  2NZ9 A;  3PME A;  1G9A A;  4KBB A;  3O4A A;  3ZXG A;  5JLV A;  3B9U A;  1Q04 A;  3MAL A;  4ZGR B;  2NP0 A;  3N7K A;  4H9W A;  4L4I A;  9ILB A;  2F2F A;  1W3A A;  1I1B A;  4JKQ A;  5D62 A;  1FMM S;  5BXR A;  5JMC A;  2K8R A;  2X2T A;  1F31 A;  1CVS A;  1EV2 A;  1S0G A;  1PC8 B;  3C9Z A;  1R8N A;  4GAI A;  1HWM B;  4LO3 A;  5F8S A;  4I2S A;  4I7I A;  3T8S A;  3CRH A;  4ZFU B;  2HZ9 A;  3Q7Y A;  1QQK A;  4QO3 A;  1M16 A;  4QBV A;  1JT5 A;  3VWC A;  5HPZ A;  1AVW B;  1HCE A;  5BVP I;  4D8H A;  1TOO A;  5D63 A;  5FZY A;  3TC2 A;  3ZC8 A;  1FV2 A;  4OUJ A;  1PUM B;  1Z2V A;  2NS2 A;  3UD9 A;  4IZX A;  4X39 A;  2K4A B;  3AKI A;  3BA4 A;  3AJ6 A;  3P53 A;  3BB2 A;  1JT4 A;  2ZQN A;  4P0J A;  31BI A;  4JAW A;  1QXM A;  1IT0 A;  4F34 A;  4GP0 A;  3FJK A;  3O44 A;  4I1B A;  8I1B A;  4ION A;  1HCD A;  3BTA A;  1HWO B;  3O3Q A;  2Y9G A;  3AJ5 A;  1BLD A;  3VSZ A;  1TFM B;  4QKR A;  1W3F A;  1FWU A;  4LO1 A;  3FJH A;  2LIQ A;  3BAU A;  4YOL A;  1OQL B;  4AN6 A;  3CA1 A;  4QAL A;  3NJ5 A;  2D7R A;  3AKG A;  3AKF A;  1DFC A;  2NM1 A;  1AFC A;  1K5U A;  1ABR B;  5BP5 A;  3CA6 A;  1T9F A;  2D7I A;  3F62 B;  4LO0 A;  2Y9W C;  2HWA A;  1II4 A;  2AFG A;  4I4O A;  1FWV A;  3FJC A;  3CA3 A;  1ISW A;  21BI A;  1SZ6 B;  1ISZ A;  1AVU A;  1TIE A;  5F8W A;  4ZLB B;  2WRY A;  4DCK C;  1TTU A;  4OEF A;  1D0H A;  4G9N A;  1XHB A;  5BXT A;  5G00 A;  1YTO A;  3BAH A;  4MZH A;  3FUQ A;  3S8J A;  4ZKT B;  2NYY A;  3VSF A;  3HAL A;  3O4B A;  1S0F A;  2E4M C;  1KNM A;  3WIN C;  3R4S A;  4QD2 C;  3NBC A;  4OEE A;  4P0K A;  1ILR 1;  1R8O A;  3CRG A;  3BRD A;  3AH1 A;  3IIR A;  4XFT A;  1FGA A;  4GP3 A;  2Z48 A;  3WO2 A;  3RTI B;  4LO2 C;  1BFB A;  1HWN B;  4A7Y A;  1TWE A;  4MZG B;  1V6W A;  4HR6 C;  3IAG C;  1P63 A;  5D61 A;  3V0B A;  1G9D A;  1CE7 B;  1NUN A;  4I37 A;  1DFQ A;  3BAO A;  4UY4 A;  5I1B A;  2KKI A;  1DQO A;  2RG9 B;  3IM7 A;  2I1B A;  1EYL A;  2J3P A;  2L5X A;  1S0C A;  3FJ8 A;  4MZF B;  2DRZ A;  1IJT A;  3BX1 C;  1EPW A;  1G82 A;  1BFG A;  3UDA A;  3WO4 A;  3BA5 A;  5BQU C;  4LO8 B;  4FGF A;  1WBC A;  3CQA A;  3O4O A;  4JPZ A;  1T4Q A;  3LLP A;  2D44 A;  4P0L A;  1ISY A;  3VT2 A;  1SR4 A;  3OJV A;  2VU9 A;  3V79 C;  3RTJ B;  1G9B A;  3WMV A;  3D7W B;  2FFU A;  2KI4 A;  3FJE A;  2MC2 A;  3I2A A;  2ERM A;  1JLX A;  3VUO A;  1I1E A;  4OW4 A;  3ZX7 A;  3NBE A;  3FJI A;  1DZD A;  1WD4 A;  4ZA3 B;  1DIW A;  4L4H A;  3FFZ A;  1S0D A;  4OWK A;  2X2S A;  4AN7 B;  1JLY A;  3V0B B;  1BAS A;  3IM6 A;  5FZZ A;  1G9C A;  4F83 A;  4CJM A;  1TP0 A;  3AH4 A;  4GOV A;  1RML A;  1RZO B;  2IWT B;  4J2K A;  1MC9 A;  2NVH A;  1Q1U A;  4JRA A;  2RQ9 A;  3OJM A;  3O4D A;  3F1R A;  4EKX B;  3MPP G;  4FVV A;  5E24 E;  1L2H A;  4J23 B;  4H04 A;  1J0S A;  2F2F C;  3IM5 A;  4XFS A;  3WIN A;  3BA7 A;  4KEK A;  2Q9X A;  2QN4 A;  2AQZ A;  1YBI A;  2R9K B;  4G6J A;  3BAD A;  4P6A A;  3JRR A;  4I1E A;  1IOB A;  3AZW A;  4I4V A;  2F8X C;  4X37 A;  1FV3 A;  4LO2 A;  4I6I A;  4TLP A;  4R6U B;  3POK A;  3UJ4 A;  2VUA A;  4I4X A;  3FJ9 A;  4ZFY B;  4ZFW B;  1Z4S A;  3N7J A;  3OGF A;  2BEA A;  3ILA A;  2BEB A;  4J2Y A;  4EFQ A;  3FJB A;  3Q7X A;  3CA4 A;  4G6M A;  1V6V A;  1HKN A;  3FJJ A;  3NBN A;  4LO7 B;  1WBA A;  5B2H A;  1DQG A;  1AF9 A;  4ZOT A;  3O5W B;  4XKI A;  4I0Y A;  1WD3 A;  4WBC A;  2MIB A;  2KI6 B;  2M49 A;  3OBR A;  4HA2 A;  2AXM A;  1FN0 A;  2HW9 A;  3QYD A;  1HWP B;  3CU1 B;  4DEP A;  1S0E A;  1MD6 A;  4JQ0 A;  3PG0 A;  4I8M A;  5DUY A;  1PWA A;  1RG8 A;  4I4R A;  1FMZ A;  4OWL A;  2ZR1 B;  2WBC A;  3FUO A;  2HWM A;  4EFR A;  1V6X A;  2FGF A;  1BAR A;  1ISX A;  3A21 A;  3HOM A;  3WO3 A;  3OBT A;  1HIB A;  1VCL A;  3AZV A;  5DZU A;  1DJS B;  4QD2 B;  1YXW A;  1IRA X;  3PUB A;  1IHK A;  5F90 A;  3VT1 A;  1IRP A;  4Q91 A;  4USP A;  3OGG A;  4I4P A;  3BAQ A;  2DRY A;  1AVX B;  1YF8 B;  1JT7 A;  4QC4 A;  3R4U A;  4HJJ A;  2AAI B;  5GAQ A;  6I1B A;  4G9M A;  3O4C A;  3H6Q A;  4OWJ A;  1AXM A;  1JTC A;  4GOY A;  4GAF A;  1UPS A;  3PHZ A;  7I1B A;  4KEI A;  3SNV A;  3WMU A;  5FNW A;  4D0T A;  3FJA A;  2QYI B;  4I4S A;  5FNX A;  1W3G A;  3BRG C;  3BAV A;  2Y9X E;  5EG6 C;  1JT3 A;  2ZQO A;  3CA0 A;  1K5V A;  4KC3 A;  5BOW A;  2D43 A;  3I2X A;  1ISV A;  3A22 A;  2FO1 A;  2ET2 A;  2Y9F A;  3LTQ A;  3Q7W A;  5DVH A;  3N7M A;  4I3N A;  5EHA A;  2VLC A;  3A07 A;  3K1X A;  1XZZ A;  1ONK B;  2KLL A;  1S0B A;  2GZB A;  4Z9W B;  2NTD A;  41BI A;  4D0Z A;  1IIL A;  4II0 A;  2D23 A;  3BAG A;  1TWM A;  4Q9P A;  1V6U A;  3W9T A;  3CAH A;  5EC5 A;  4ISR A;  3CRI A;  1S0L A;  3H6R A;  2D20 A;  1BFC A;  3FGM A;  1PUU B;  1Z0H A;  3JUT A;  1E0O A;  2MLL B;  4IHZ A;  1FQ9 A;  1NZK A;  3FJD A;  4IY9 A;  2LIE A;  1A8D A;  2E4M A;  3P6I A;  3AH2 A;  2KH2 A;  1GGP B;  2Q3N B;  3S8K A;  3ZC9 A;  4DEN A;  2ESU A;  2GO2 A;  3CA5 A;  2D1Z A;  3N0K A;  3KMV A;  4USO A;  3V0A A;  3A23 A;  4JP0 A;  3NBD A;  5FZU A;  4QKS A;  4LO3 C;  1JY0 A;  1EVT A;  4A7K A;  4Q9G A;  1XG6 A;  4ZBV B;  3EF2 A;  3HMY A;  2FDB M;  1Q03 A;  2P39 A;  3I29 B;  5BXP A;  3H6S E;  4OEG A;  1DZC A;  2K43 A;  4IQP A;  3HBW A;  1DLL A;  3HSM A;  5BXS A;  3OJ2 A;  3QR5 A;  1SR4 C;  2XOA A;  3ZXD A;  1AVA C;  2RST A;  2VSE A;  2FFV A;  1BFF A;  2DS0 A;  3RMY A;  4LO7 C;  3UD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...