2FFUA

Crystal structure of human ppgalnact-2 complexed with udp and ea2
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
494
structure length
494
Chain Sequence
b'KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 2
publication title Dynamic Association between the Catalytic and Lectin Domains of Human UDP-GalNAc:Polypeptide {alpha}-N-Acetylgalactosaminyltransferase-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 171
structure length 494
sequence length 494
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ffuA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2ffuA01
3SXBA 5HPZA 4L41C 1MP3A 2MC2A 1LZ0A 2K4AB 3VWCA 2UUSA 1BLDA 3NGWA 5C8RA 3I0GA 4FRMA 1IOBA 2O1FA 2M49A 4FREA 1JYLA 3BA7A 2JCOA 2YESA 4LO2A 4GBPA 5C1HA 4EEOA 4KBBA 5B2HA 3OGFA 1V84A 4EFRA 31BIA 1ZDGA 1XYFA 2RJ7A 3PKPA 4ZOTA 1WBCA 2VU9A 4CJ8A 3OJMA 1QQLA 4ZBVB 3ZC9A 1WT1A 2W0WA 4LO7C 4EEAA 5BP5C 3OH1A 2YQCA 3FJBA 1G1LA 3I0DA 4J2SA 4LO1C 2AXMA 3P6JA 1VZUA 4KRVA 5FV9A 4ISRA 1W3AA 1VGTA 3CU1B 3RTIB 4XKIA 1FR8A 2P23A 2YQSA 3V0BA 3DUVA 4JKQA 5E24E 2D22A 5DZUA 2MZBA 5CMFX 2D7IA 1QGSA 1S0DA 1PWAA 3ST8A 3HN1A 1G95A 1FWVA 1H4EA 3EF2A 5FNXA 3OH3A 4FCUA 3IM7A 5C4DA 2L5XA 2BEAA 3BTAA 1ZJOA 3FOQA 1NUNA 5BP5A 4USPA 4I1EA 1FRWA 1NMMB 2ICYA 3OH4A 3FGMA 4LO1A 3KIAA 4NANA 1UPSA 2VD4A 4C2SA 1TWEA 3K1XA 1R81A 2ZU7A 3F62B 5CQLX 1ILR1 3FWWA 4CJBA 5EIYA 5FZYA 1O7OA 2UX8A 5DDVA 1PZTA 2WGZA 1AVAC 1I1EA 4NAIA 4GOVA 1BFFA 1ZI5A 1ABRB 2BFHA 1A8DA 1DFQA 3V79C 4I37A 4QO3A 4HO3A 3AZWA 1ISWA 1JY0A 3ZX7A 1INIA 1NHEB 1ZCUA 1QQKA 3NBDA 3WO2A 4IZXA 5IDTA 4OW4A 1JT4A 1Q04A 4I4VA 1XHBA 1K5UA 1II4A 1OMZA 4Y7TA 1DQGA 3U0YA 4JKXB 1G97A 3H6QA 5IDSA 4LO3A 2E4MC 1H5SC 4LW6A 4HCQA 3C9ZA 2OEGA 5C47A 2K8RA 5CMHA 2RITA 2HW9A 1ZDFA 2VXRA 1TVYA 2WVMA 3Q7YA 1V82A 5CQPA 3V0LA 3VT0A 5C38A 2Y6PA 5J49A 1ISZA 4I8MA 2RJ5A 5C1GA 3SX5A 4L4HA 4ZLBB 1ON6A 1MP4A 2O1GA 1TZFA 5JLVA 5FUHA 4M2AA 4LO0C 3BA5A 4OEEA 4AYJA 1ZJ0A 3Q80A 3FJ8A 5CQOA 3V8YA 1IRAX 3Q4SA 4L4IA 3VEQA 1H7LA 3CRHA 5BOWA 4Y6NA 4JISA 4IRQA 1FV2A 1H5SA 2E4MA 1FOAA 1HM0A 3V0PA 5EC5A 2P72A 1EV2A 1HCDA 3PMEA 3JTJA 3PKQA 1HJJA 1Z4SA 5BQUC 2DRZA 3PHZA 3F1CA 3ZC8A 3BAHA 2AAIB 4QKRA 4P6AA 3BB2A 3ZXGA 1YF8B 1JTCA 5FZUA 4LO0A 2FYCB 1FV3A 3GUEA 1FWUA 3R4SA 3BAGA 1IJTA 1FN0A 4Z9WB 3F1YA 2D0JA 2J3PA 1TW5A 3I0HA 1H5RA 1LZIA 3IOHA 4H9WA 3O4DA 4NALA 4ZA3B 1NKHB 3BRKX 1YP3A 5F8WA 1VCLA 3I29B 1M2TB 1VICA 2RJ4A 4WBCA 5FYEA 1WT3A 3OGZA 5BQUA 2CU2A 4J18A 5C4CA 2Y9GA 4KEJA 4KPZA 5AJNA 3SX3A 5BXPA 1YP4A 7I1BA 1OMXA 1FGGA 4KC2A 3A21A 3F1RA 1BFGA 3T8SA 4HO5A 3FJKA 1VGZA 2ET2A 3IIRA 4Q9PA 3ZXDA 1Z0HA 1OQLB 1PC8B 2VSAA 2F8XC 1H7FA 1R8OA 4QKSA 1XZ6A 4KNRA 5FU8A 4EEMA 4MYBA 4B2XA 2O1HA 4I4XA 3SXEA 1ZIZA 4HJJA 2D7RA 3DJ4A 3FJFA 4I4OA 4AN6A 1ZI1A 4A7KA 4KXOA 3O4AA 4ZFWB 2MLLB 4OUJA 2Y4MA 4R7PA 3T7NA 5FTSA 2AM4A 2HZ9A 4KQLA 1V6XA 3MALA 5BXRA 3CRIA 3SXGA 1NQIB 1TFMB 1DQOA 1NZKA 1G2VA 1IILA 1R8NA 2RJ0A 1ZCVA 4KT7A 2KH2A 2Y4KA 4XFUA 3CA6A 3QR5A 3JUKA 1JLYA 2KI6B 1R80A 3PG0A 1IT0A 1OQMB 2WVLA 2KI4A 2VS5A 2XWLA 4B42A 3V0BB 4HOCA 3O4CA 1JLXA 3I0FA 3AJ6A 1R82A 1AFCA 4I1BA 1WSZA 2X5ZA 2RSTA 21BIA 2Y9FA 3SX8A 4FGFA 2XMHA 2I7BA 2OI5A 3UJ0A 3NBCA 2IWTB 4B4BA 2BEBA 5D63A 1VH3A 2NM1A 1KWSA 3FJCA 3V0MA 3AKFA 2QH5A 5CMGX 4ENDA 3HMYA 4G9NA 1FGXA 1GX0A 4JD0A 2APCA 4EB2B 1YXWA 4Q9GA 8I1BA 3JRRA 1TW1A 1Z90A 4IZEA 2GGQA 4EE3A 1TOOA 2NYYA 1MP5A 1N4KA 4I7IA 1AVUA 2Z86A 1LL0A 3N0KA 3O44A 1G0RA 1WD4A 2KKIA 4YS8A 3U2WA 4QD2B 2GZBA 1R7YA 1ZI4A 4XFTA 2Y4LA 4I0YA 3HBWA 2X65A 1GQ9A 4BMAA 3H6SE 3O49A 4GOYA 4PC4A 3CKQA 2I5KA 4F83A 1HCEA 4KNXA 4LW3A 5EJZA 2X60A 1ISYA 2ERMA 2HWAA 2WVKA 5C3BA 3OJ2A 1H5TA 3CU0A 4J2XA 4MNDA 1CVSA 2WAWA 4GAIA 4JQ0A 4ZKTB 3LW6A 5F8YA 2VSIA 5C49A 3VSZA 2XOAA 2VXTI 1V6UA 3N7JA 4GP0A 1BARA 4M4KA 3LTQA 2AECA 3R2WA 4EE4A 1VGWA 3CRGA 1WT2A 3I0EA 4JPZA 3O4OA 1ZCYA 1PUMB 3NJ5A 2FYBA 1M16A 3QVBA 2VLCA 1EVTA 4EFPA 4GAFA 4D11C 3CA4A 1G3LA 1VM8A 5DVHA 2VSHA 1JYKA 3IOJA 2VS4A 4P0JA 2WRYA 3MPPG 3H6RB 1VZXA 3K8EA 5C4EA 2BO6A 1SR4C 1LL3A 5C1LA 4I2SA 1H7GA 2DS0A 1Q03A 4X3AA 5FNWA 3RMYA 4DCKC 1G23A 1SZ6B 2WE9A 3FUOA 3CKJA 1GWWA 4Y64A 2Q9XA 4JRAA 3Q7WA 2VXMA 1FXOA 2VUAA 1W3GA 3NBEA 5DUYA 1ZJ2A 2AE7A 2Y9XE 4HG6A 3T7OA 3V0QA 5DDTA 2GO2A 3N7MA 2F2FC 4Y7FA 3I0JA 2Z48A 4HO0A 3BRGC 2X2TA 2V0LA 5FU0A 4B3UA 2DREA 1HWOB 3AJ5A 1H7HA 2BO4A 2VFZA 2WEEA 4NAKA 4I4QA 1QG8A 5CQMX 1SR4A 4HA2A 1BASA 3O4BA 1JV3A 1LL2A 4I4SA 4XFSA 4P02A 3POLA 4TLPA 3P6IA 2V0KA 1TIEA 1YROB 2AM3A 4EFQA 2D1ZA 1H7QA 3LLPA 1DZDA 2QN4A 2JCJA 3V0NA 4B4MA 2RJ9A 3A22A 1J0SA 2JCLA 1QWJA 3CGXA 2OEFA 3PNNA 1VH1A 4HO4A 3POKA 2FGFA 2F2FA 2P6WA 3N9WA 4LO8B 5GAQA 4K6RA 4IQPA 4FQWA 4QALA 3RSBA 3TZTA 3AKIA 2I1BA 3BAVA 9ILBA 4F34A 4DENA 3VUOA 3ZLLA 1S0BA 1G9AA 1PZYB 2D23A 1FR9A 3E26A 1FMMS 2NVHA 4FRPA 4G9MA 3JUJA 4IRPA 2AM5A 4D48A 4X39A 3WMVA 1XZZA 4D8HA 3S8KA 3FJAA 3FJ9A 4DEPA 2FO1A 1O0RA 1BLAA 2I5EA 2RIXA 2V0JA 4Y9XA 2Y9WC 4USOA 4FRAA 5F8SA 1MD6A 1TWMA 4I96A 4ZFYB 2NP0A 1EZIA 2ZU9A 5I1FA 2KLLA 3D8VA 1RZOB 2AFGA 4JAWA 5L6SA 1JT7A 1WVCA 2NZ9A 2AGDA 2BO7A 1FWYA 1FMZA 5CMJA 4P0LA 1FO8A 1S0FA 2YC5A 1FO9A 3V0AB 4XWIA 3SNVA 1HM9A 3V0OA 1IIMA 4FRQA 3CQAA 3V8ZA 5HS2A 1O23B 3I2AA 4G6MA 2X2SA 3CA0A 1T4QA 3BAUA 3FUQA 4QC4A 4QBVA 3K8DA 3CA3A 4OWKA 3WINC 3CAHA 4KC3A 3IAGC 1PUUB 3OBRA 3WO4A 4EKXB 4FRDA 2E3DA 4ARWA 4X37A 1GA8A 1ZHJA 1RMLA 3S8JA 2XWNA 3FJDA 2V0IA 2X5SA 5G00A 3WA1A 1DZCA 1H7EA 3HL3A 3ZGFA 4A7ZA 2LIEA 2D43A 3Q7XA 4QD2C 1HIBA 5CMIA 3UD8A 5C3AA 2JCKA 3T7MA 3AKGA 3KMVA 4P0KA 1AVXB 4YOLA 1H7TA 5IFYA 3SXAA 1KNMA 3OBTA 3CA5A 2AH9A 5I1BA 2RIZA 2R9KB 5DSSB 4FVVA 2ICXA 1JV1A 3USRA 1FGAA 1O7QA 3TQDA 4ASJA 3O5WB 5FZZA 3WINA 4ISQA 2DPWA 3ZGGA 4DE7A 4KC4A 1W3FA 2GGOA 4Y7VA 4Q91A 1E5KA 1LVWA 2QYIB 1D0HA 1DLLA 4KEKA 2Q4JA 2RIYA 4G6JA 3U2VA 1YBIA 4KC1A 1TTUA 2FYDB 2D20A 1JVDA 1NF5B 4I4YA 3SXCA 1QXMA 3A23A 5D61A 2A8WA 2E8BA 3UD9A 4M2BA 3AH2A 4DECA 4Y6UA 1ZCTA 4AN7B 2P73A 2Z49A 5EJ1A 5JMCA 2Z87A 2RQ9A 2LIQA 4EE5A 4FRLA 2PGYA 1EYLA 4Z8SB 3FJHA 1R7VA 1HWMB 2Y4JA 3RTJB 1Q1UA 1HM8A 4IY9A 1W57A 2PGVA 2D24A 3FJEA 4CJMA 1HV9A 2A8UA 2AESA 4EEGA 4R6UB 4AC3A 5C4FA 2BO8A 4I4UA 5BVPI 3OJVA 2ZU8A 1GQCA 1WD3A 4JP0A 1FG5N 1ZJPA 3CKVA 4X38A 3O3QA 6I1BA 1HKNA 1S0LA 2ZR1B 1QGQA 2AQZA 1S4PA 4ZDQA 3O3PA 1V83A 1SS9A 2NTDA 4CVHA 4J2YA 1R7UA 1I52A 3SPTA 1VZTA 2ZQNA 3CKNA 1V6WA 3P53A 2FY7A 1W77A 3V91A 4LO7B 4HO2A 1G9RA 1WBAA 3H6RA 3WMUA 1IINA 2D44A 4LO3C 3DK5A 1JQZA 3OGGA 1G82A 1H5TB 3AZVA 1HJLA 1GX4A 1RY7A 1S4OA 3U2TA 1GGPB 2PX7A 4Y62A 1INJA 1FQ9A 2YQJA 1E0OA 2FFVA 3D7WB 3OC9A 1ON8A 4FRHA 3BA4A 1TP0A 1P63A 5BXCA 1ZI3A 3VSFA 4P00A 3U0XA 1H5SD 5D62A 2RG9B 1JT5A 41BIA 2W0VA 2DRYA 1WT0A 1HWPB 2YUGA 5C3DA 4G87A 3BAQA 3FFZA 3V90A 2QGIA 4D11A 4ECMA 3B9UA 2WBCA 3FJJA 3D98A 4J23B 3BADA 3HSMA 3USQA 3I0CA 3SX7A 3FJIA 1HWNB 4CJCA 4G3QA 3RSJA 3BCVA 4UEGA 3N7KA 1VGUA 2VXLA 4G3SA 4FROA 3D5NA 4IY8A 2FFUA 1LZJA 3W9TA 3ZF8A 4DDZA 1I1BA 4OWJA 4IONA 1MC3A 3RMXA 1XG6A 3OKRA 4EVWA 5FTVA 3CA1A 3E8LC 1H4CA 3QYDA 3I0IX 3OAMA 4FRBA 1BFBA 4M28A 1JT3A 1YTOA 3A07A 4II0A 1G9DA 4B4GA 4AAWA 3OH0A 2RJ8A 3ZLKA 4D0TA 4QBCA 1H5SB 3AH4A 4HO8A 4Y7UA 2IHOA 4I6IA 4B5BA 1DFCA 2RJ6A 4D0ZA 5JQQA 1S0GA 2HWMA 4KPXA 1Z2VA 2Y7AA 3IM5A 1W55A 1BA7A 1PZZA 4KEIA 3TC2A 3IM6A 2OI6A 3BAOA 2OI7A 5AJPA 1F31A 2NXVA 4ZFUB 1ZJ1A 1AF9A 3IOIA 4Y63A 4H04A 1IRPA 3I0LA 5C36A 4FCEA 2RJ1A 1BFCA 1DJSB 1EPWA 3PUBA 1H4DA 1R7TA 3EE5A 3R3IA 1MC9A 4A7YA 4Y7GA 3U2XA 1AVWB 2VSEA 1H3MA 1H5RB 4J2KA 1V6VA 4I3NA 1L2HA 3UDAA 3N7LA 2MIBA 3HOMA 3VT2A 2QKXA 3Q7UA 4B2WA 4OEFA 1ISVA 3V0AA 3RMWA 3WO3A 1S4NA 2VS3A 3BRDA 5L6VA 3R4UA 1R7XA 1CE7B 3UD7A 1JVGA 4OEGA 3BX1C 3SXDA 1EYRA 1K4VA 2K43A 1NWGB 1VPAA 3AH1A 4I4RA 4HO6A 1S0EA 2YCMA 5F90A 1ISXA 2ESUA 1RG8A 4HR6C 1G8OA 4HO9A 1YYNA 3UJ4A 2P39A 4IYBA 3ILAA 3JUTA 4I4PA 3I2XA 5EG6C 3AKHA 5BXTA 1DIWA 4OWLA 4G1RA 3E25A 3OH2A 5C4BA 1YP2A 1G9CA 3BRFA 2YC3A 2PA4A 2XWMA 4GP3A 5BXSA 4G3PA 1FXJA 1IHKA 2XMEA 4EEEB 3CKOA 1FZWA 4BQHA 4LO2C 3I0KA 2V0HA 1AXMA 4ZGRB 3RMVA 2ZQOA 1ONKB 2FYAA 1S0CA 4ASYA 5C48A 2FDBM 2Q3NB 4AYLA 5CQNX 4E1KA 1ITBA 4IHZA 5EHAA 1LZ7A 1G93A 2YQHA 3U2UA 5AJOA 1K5VA 3NBNA 3VT1A 1ZJ3A 1GWVA 1T9FA 3HALA 1G9BA
chains in the Genus database with same CATH superfamily
3SXBA 5HPZA 4L41C 1MP3A 2MC2A 1LZ0A 2K4AB 3VWCA 2UUSA 1BLDA 3NGWA 5C8RA 3I0GA 4FRMA 1IOBA 2O1FA 2M49A 4FREA 1JYLA 3BA7A 2JCOA 2YESA 4LO2A 4GBPA 5C1HA 4EEOA 4KBBA 5B2HA 3OGFA 1V84A 4EFRA 31BIA 1ZDGA 1XYFA 2RJ7A 3PKPA 4ZOTA 1WBCA 2VU9A 4CJ8A 3OJMA 1QQLA 4ZBVB 3ZC9A 1WT1A 2W0WA 4LO7C 4EEAA 5BP5C 3OH1A 2YQCA 3FJBA 1G1LA 3I0DA 4J2SA 4LO1C 2AXMA 3P6JA 1VZUA 4KRVA 5FV9A 4ISRA 1W3AA 1VGTA 3CU1B 3RTIB 4XKIA 1FR8A 2P23A 2YQSA 3V0BA 3DUVA 4JKQA 5E24E 2D22A 5DZUA 2MZBA 5CMFX 2D7IA 1QGSA 1S0DA 1PWAA 3ST8A 3HN1A 1G95A 1FWVA 1H4EA 4FIXA 4MIXA 3EF2A 5FNXA 3OH3A 4FCUA 3IM7A 5C4DA 2L5XA 2BEAA 3BTAA 1ZJOA 3FOQA 1NUNA 4O6MA 5BP5A 4USPA 4I1EA 1FRWA 1NMMB 2ICYA 3OH4A 3FGMA 4LO1A 3KIAA 4FIYA 1UPSA 2VD4A 4NANA 4C2SA 1TWEA 3K1XA 1R81A 2ZU7A 3F62B 5CQLX 1ILR1 3FWWA 4CJBA 5EIYA 5FZYA 1O7OA 2UX8A 5DDVA 1PZTA 2WGZA 1AVAC 1I1EA 4NAIA 4GOVA 1BFFA 1ZI5A 1ABRB 2BFHA 1A8DA 1DFQA 3V79C 4I37A 4QO3A 4HO3A 3AZWA 1ISWA 1JY0A 3ZX7A 1INIA 1NHEB 1ZCUA 1QQKA 3NBDA 3WO2A 4IZXA 5IDTA 4OW4A 1JT4A 1Q04A 4I4VA 1XHBA 1K5UA 1II4A 1OMZA 4Y7TA 1DQGA 3U0YA 4JKXB 1G97A 3H6QA 5IDSA 4LO3A 2E4MC 1H5SC 4LW6A 4HCQA 3C9ZA 2OEGA 5C47A 2K8RA 5CMHA 2RITA 2HW9A 1ZDFA 2VXRA 1TVYA 2WVMA 3Q7YA 1V82A 5CQPA 3V0LA 3VT0A 5C38A 2Y6PA 5J49A 1ISZA 4I8MA 2RJ5A 5C1GA 3SX5A 4L4HA 4ZLBB 1ON6A 1MP4A 2O1GA 1TZFA 5JLVA 5FUHA 4M2AA 4LO0C 3BA5A 4OEEA 4AYJA 1ZJ0A 3Q80A 3FJ8A 5CQOA 5D91A 3V8YA 1IRAX 3Q4SA 4L4IA 3VEQA 1H7LA 3CRHA 5BOWA 4Y6NA 4JISA 4IRQA 2NS2A 1FV2A 1H5SA 2E4MA 1FOAA 1HM0A 3V0PA 5EC5A 2P72A 1EV2A 1HCDA 3PMEA 3JTJA 3PKQA 1HJJA 1Z4SA 5BQUC 2DRZA 3PHZA 3F1CA 3ZC8A 3BAHA 2AAIB 4QKRA 4P6AA 3BB2A 3ZXGA 1YF8B 1JTCA 5FZUA 4LO0A 2FYCB 1FV3A 3GUEA 1FWUA 3R4SA 3BAGA 1IJTA 1FN0A 4Z9WB 3F1YA 2D0JA 2J3PA 1TW5A 3I0HA 1H5RA 1LZIA 3IOHA 4H9WA 3O4DA 4NALA 4ZA3B 1NKHB 3BRKX 1YP3A 5F8WA 1VCLA 3I29B 1M2TB 1VICA 2RJ4A 4WBCA 5FYEA 1WT3A 3OGZA 5BQUA 2CU2A 4J18A 5C4CA 2Y9GA 4KEJA 4KPZA 5AJNA 3SX3A 5BXPA 1YP4A 7I1BA 1OMXA 1FGGA 4KC2A 3A21A 3F1RA 1BFGA 3T8SA 4HO5A 3FJKA 1VGZA 2ET2A 3IIRA 4Q9PA 3ZXDA 1Z0HA 1OQLB 1PC8B 2VSAA 2F8XC 1H7FA 1R8OA 4QKSA 1XZ6A 4KNRA 5FU8A 4EEMA 4MYBA 4B2XA 2O1HA 4I4XA 3SXEA 1ZIZA 4HJJA 2D7RA 3DJ4A 3FJFA 4I4OA 4AN6A 1ZI1A 4A7KA 4KXOA 3O4AA 4ZFWB 2MLLB 4OUJA 2Y4MA 4R7PA 3T7NA 5FTSA 2AM4A 2HZ9A 4KQLA 1V6XA 3MALA 5BXRA 3CRIA 3SXGA 1NQIB 1TFMB 1DQOA 1NZKA 1G2VA 1IILA 1R8NA 2RJ0A 1ZCVA 4KT7A 2KH2A 2Y4KA 4XFUA 3CA6A 3QR5A 3JUKA 1JLYA 2KI6B 1R80A 3PG0A 1IT0A 1OQMB 2WVLA 2KI4A 2C0NA 2VS5A 2XWLA 4B42A 3V0BB 4HOCA 3O4CA 1JLXA 3I0FA 3AJ6A 1R82A 1AFCA 4I1BA 1WSZA 2X5ZA 2RSTA 21BIA 2Y9FA 3SX8A 4FGFA 2XMHA 2I7BA 2OI5A 3UJ0A 4H75A 3NBCA 2IWTB 4B4BA 2BEBA 5D63A 1VH3A 2NM1A 1KWSA 3FJCA 3V0MA 3AKFA 2QH5A 5CMGX 4ENDA 3HMYA 4G9NA 1FGXA 1GX0A 4JD0A 2APCA 4EB2B 1YXWA 4Q9GA 8I1BA 3JRRA 1TW1A 1Z90A 4IZEA 2GGQA 4EE3A 1TOOA 2NYYA 1MP5A 1N4KA 4I7IA 1AVUA 2Z86A 1LL0A 3N0KA 3O44A 1G0RA 1WD4A 2KKIA 4YS8A 3U2WA 4QD2B 2GZBA 1R7YA 1ZI4A 4XFTA 2Y4LA 4I0YA 3HBWA 2X65A 1GQ9A 4BMAA 3H6SE 3O49A 4GOYA 4PC4A 3CKQA 2I5KA 4F83A 1HCEA 4KNXA 4LW3A 5EJZA 2X60A 1ISYA 2ERMA 2HWAA 2WVKA 5C3BA 3OJ2A 1H5TA 3CU0A 4J2XA 4MNDA 1CVSA 2WAWA 4GAIA 4JQ0A 4O6NA 4ZKTB 3LW6A 5F8YA 2VSIA 5C49A 3VSZA 2XOAA 2VXTI 1V6UA 3N7JA 4GP0A 1BARA 4M4KA 3LTQA 2AECA 3R2WA 4Q7CA 4EE4A 1VGWA 3CRGA 1WT2A 3I0EA 4JPZA 3O4OA 1ZCYA 1PUMB 3NJ5A 2FYBA 1M16A 3QVBA 2VLCA 1EVTA 4EFPA 4GAFA 4D11C 3CA4A 1G3LA 1VM8A 5DVHA 2VSHA 1JYKA 3IOJA 2VS4A 4P0JA 2WRYA 3MPPG 3H6RB 1VZXA 3K8EA 5C4EA 2BO6A 1SR4C 1LL3A 5C1LA 4I2SA 1H7GA 2DS0A 1Q03A 4X3AA 5FNWA 3RMYA 4DCKC 1G23A 1SZ6B 2WE9A 3FUOA 3CKJA 1GWWA 4Y64A 2Q9XA 4JRAA 3Q7WA 2VXMA 1FXOA 2VUAA 1W3GA 3NBEA 5DUYA 1ZJ2A 2AE7A 2Y9XE 4HG6A 3T7OA 3V0QA 5DDTA 2GO2A 3N7MA 2F2FC 4Y7FA 3I0JA 2Z48A 4HO0A 3BRGC 2X2TA 2V0LA 5FU0A 4B3UA 2DREA 1HWOB 3AJ5A 1H7HA 2BO4A 2VFZA 2WEEA 4NAKA 4I4QA 1QG8A 5CQMX 1SR4A 4HA2A 1BASA 3O4BA 1JV3A 1LL2A 4I4SA 4XFSA 4P02A 3POLA 4TLPA 3P6IA 2V0KA 1TIEA 1YROB 2AM3A 4EFQA 2D1ZA 1H7QA 3LLPA 1DZDA 2QN4A 2JCJA 3V0NA 4B4MA 2RJ9A 3A22A 1J0SA 2JCLA 1QWJA 3CGXA 2OEFA 3PNNA 1VH1A 4HO4A 3POKA 2FGFA 2F2FA 2P6WA 3N9WA 4LO8B 5GAQA 4K6RA 4IQPA 4FQWA 4QALA 3RSBA 3TZTA 3AKIA 2I1BA 3BAVA 9ILBA 4F34A 4DENA 3VUOA 3ZLLA 1S0BA 1G9AA 1PZYB 2D23A 1FR9A 3E26A 1FMMS 2NVHA 4FRPA 4G9MA 3JUJA 4IRPA 2AM5A 5D92A 4D48A 4MZGB 4X39A 3WMVA 1XZZA 4D8HA 3S8KA 3FJAA 3FJ9A 4DEPA 2FO1A 1O0RA 1BLAA 2I5EA 2RIXA 2V0JA 4Y9XA 2Y9WC 4USOA 4FRAA 5F8SA 1MD6A 1TWMA 4I96A 4ZFYB 2NP0A 1EZIA 2ZU9A 4UY4A 2KLLA 5I1FA 3D8VA 1RZOB 2AFGA 4JAWA 5L6SA 1JT7A 1WVCA 2NZ9A 2AGDA 2BO7A 1FWYA 1FMZA 5CMJA 4P0LA 1FO8A 1S0FA 2YC5A 1FO9A 3V0AB 4XWIA 3SNVA 1HM9A 3V0OA 1IIMA 4FRQA 3CQAA 3V8ZA 5HS2A 1O23B 3I2AA 4G6MA 2X2SA 3CA0A 1T4QA 3BAUA 3FUQA 4QC4A 4QBVA 3K8DA 3CA3A 4OWKA 3WINC 3CAHA 4KC3A 3IAGC 1PUUB 3OBRA 3WO4A 4EKXB 4FRDA 2E3DA 4ARWA 4X37A 1GA8A 1ZHJA 1RMLA 3S8JA 2XWNA 3FJDA 2V0IA 2X5SA 4MZHA 5G00A 3WA1A 1DZCA 1H7EA 3HL3A 3ZGFA 4A7ZA 2LIEA 2D43A 3Q7XA 4QD2C 1HIBA 5CMIA 3UD8A 5C3AA 2JCKA 3T7MA 3AKGA 3KMVA 4P0KA 1AVXB 4YOLA 1H7TA 5IFYA 3SXAA 1KNMA 3OBTA 3CA5A 2AH9A 5I1BA 2RIZA 2R9KB 5DSSB 4FVVA 2ICXA 1JV1A 3USRA 1FGAA 1O7QA 3TQDA 4ASJA 3O5WB 5FZZA 3WINA 4ISQA 2DPWA 3ZGGA 4DE7A 4KC4A 1W3FA 2GGOA 4Y7VA 4Q91A 1E5KA 1LVWA 2QYIB 1D0HA 1DLLA 4KEKA 2Q4JA 2RIYA 4G6JA 3U2VA 1YBIA 4KC1A 1TTUA 2FYDB 2D20A 1JVDA 1NF5B 4I4YA 3SXCA 1QXMA 3A23A 5D61A 2A8WA 2E8BA 3UD9A 4M2BA 3AH2A 4DECA 4Y6UA 1ZCTA 4AN7B 2P73A 2Z49A 5EJ1A 5JMCA 2Z87A 2RQ9A 2VK9A 2LIQA 4EE5A 4FRLA 2PGYA 1EYLA 4Z8SB 3FJHA 1R7VA 1HWMB 2Y4JA 3RTJB 1Q1UA 1HM8A 4IY9A 1W57A 2PGVA 2D24A 3FJEA 4CJMA 1HV9A 2A8UA 2AESA 4EEGA 4R6UB 4AC3A 5C4FA 2BO8A 4I4UA 5BVPI 3OJVA 2ZU8A 1GQCA 1WD3A 4JP0A 1FG5N 1ZJPA 3CKVA 4X38A 3O3QA 6I1BA 1HKNA 1S0LA 2ZR1B 1QGQA 2AQZA 1S4PA 4ZDQA 3O3PA 1V83A 1SS9A 2NTDA 4CVHA 4J2YA 1R7UA 1I52A 3SPTA 1VZTA 2ZQNA 3CKNA 1V6WA 3P53A 2FY7A 1W77A 3V91A 4LO7B 4HO2A 1G9RA 1WBAA 3H6RA 3WMUA 1IINA 2D44A 4LO3C 3DK5A 1JQZA 3OGGA 1G82A 1H5TB 3AZVA 1HJLA 1GX4A 1RY7A 1S4OA 3U2TA 1GGPB 2PX7A 4Y62A 1INJA 1FQ9A 2YQJA 1E0OA 2FFVA 3D7WB 3OC9A 1ON8A 4FRHA 3BA4A 1TP0A 1P63A 5BXCA 1ZI3A 3VSFA 4P00A 3U0XA 1H5SD 5D62A 2RG9B 1JT5A 41BIA 2J0BA 2DRYA 2W0VA 1WT0A 4MZFB 1HWPB 2YUGA 5C3DA 4G87A 3BAQA 3FFZA 3V90A 2QGIA 4D11A 4ECMA 3B9UA 2WBCA 3FJJA 3D98A 4J23B 3BADA 3HSMA 3USQA 3I0CA 3SX7A 3FJIA 1HWNB 4CJCA 4G3QA 3RSJA 3BCVA 4UEGA 3N7KA 1VGUA 2VXLA 4G3SA 4FROA 3D5NA 4IY8A 2FFUA 1LZJA 3W9TA 3ZF8A 4DDZA 1I1BA 4OWJA 4IONA 1MC3A 3RMXA 1XG6A 3OKRA 4EVWA 5FTVA 3CA1A 3E8LC 1H4CA 3QYDA 3I0IX 3OAMA 4FRBA 1BFBA 4M28A 1JT3A 1YTOA 3A07A 4II0A 1G9DA 4B4GA 4AAWA 3OH0A 2RJ8A 3ZLKA 4D0TA 4QBCA 1H5SB 3AH4A 4HO8A 4Y7UA 2IHOA 4I6IA 4B5BA 1DFCA 2RJ6A 4D0ZA 5JQQA 1S0GA 2HWMA 4KPXA 1Z2VA 2Y7AA 3IM5A 1W55A 1BA7A 1PZZA 4KEIA 3TC2A 3IM6A 2OI6A 3BAOA 2OI7A 5AJPA 1F31A 2NXVA 4ZFUB 1ZJ1A 1AF9A 3IOIA 4Y63A 4H04A 1IRPA 3I0LA 5C36A 4FCEA 2RJ1A 1BFCA 1DJSB 1EPWA 3PUBA 1H4DA 1R7TA 3EE5A 3R3IA 1MC9A 4A7YA 4Y7GA 3U2XA 1AVWB 2VSEA 1H3MA 1H5RB 4J2KA 1V6VA 4I3NA 1L2HA 3UDAA 3N7LA 2MIBA 3HOMA 3VT2A 2QKXA 3Q7UA 4B2WA 4OEFA 1ISVA 3V0AA 3RMWA 3WO3A 1S4NA 2VS3A 3BRDA 5L6VA 3R4UA 1R7XA 1CE7B 3UD7A 1JVGA 4OEGA 3BX1C 3SXDA 1EYRA 1K4VA 2K43A 1NWGB 1VPAA 3AH1A 4I4RA 2J0AA 1S0EA 2YCMA 4HO6A 5F90A 1ISXA 2ESUA 1RG8A 4HR6C 1G8OA 4HO9A 1YYNA 3UJ4A 2P39A 4IYBA 3ILAA 3JUTA 4I4PA 3I2XA 5EG6C 3AKHA 5BXTA 1DIWA 4OWLA 4G1RA 3E25A 3OH2A 5C4BA 1YP2A 1G9CA 3BRFA 2YC3A 2PA4A 2XWMA 4GP3A 5BXSA 4G3PA 1FXJA 1IHKA 2XMEA 4EEEB 3CKOA 1FZWA 4BQHA 4LO2C 3I0KA 2V0HA 1AXMA 4ZGRB 3RMVA 2ZQOA 1ONKB 2FYAA 1S0CA 4ASYA 5C48A 2FDBM 2Q3NB 4AYLA 5CQNX 4E1KA 1ITBA 4IHZA 5EHAA 1LZ7A 1G93A 2YQHA 3U2UA 5AJOA 1K5VA 3NBNA 3VT1A 1ZJ3A 1GWVA 1T9FA 3HALA 1G9BA
chains in the Genus database with same CATH topology
3SXBA 5HPZA 4L41C 1MP3A 2MC2A 1LZ0A 2K4AB 3VWCA 2UUSA 1BLDA 3NGWA 5C8RA 3I0GA 4FRMA 1IOBA 2O1FA 2M49A 4FREA 1JYLA 3BA7A 2JCOA 2YESA 4LO2A 4GBPA 5C1HA 4EEOA 4KBBA 5B2HA 3OGFA 1V84A 4EFRA 31BIA 1ZDGA 1XYFA 2RJ7A 3PKPA 4ZOTA 1WBCA 2VU9A 4CJ8A 3OJMA 1QQLA 4ZBVB 3ZC9A 1WT1A 2W0WA 4LO7C 4EEAA 5BP5C 3OH1A 2YQCA 3FJBA 1G1LA 3I0DA 4J2SA 4LO1C 2AXMA 3P6JA 1VZUA 4KRVA 5FV9A 4ISRA 1W3AA 1VGTA 3CU1B 3RTIB 4XKIA 1FR8A 2P23A 2YQSA 3V0BA 3DUVA 4JKQA 5E24E 2D22A 5DZUA 2MZBA 5CMFX 2D7IA 1QGSA 1S0DA 1PWAA 3ST8A 3HN1A 1G95A 1FWVA 1H4EA 4FIXA 4MIXA 3EF2A 5FNXA 3OH3A 4FCUA 3IM7A 5C4DA 2L5XA 2BEAA 3BTAA 1ZJOA 3FOQA 1NUNA 4O6MA 5BP5A 4USPA 4I1EA 1FRWA 1NMMB 2ICYA 3OH4A 3FGMA 4LO1A 3KIAA 4FIYA 1UPSA 2VD4A 4NANA 4C2SA 1TWEA 3K1XA 1R81A 2ZU7A 3F62B 5CQLX 1ILR1 3FWWA 4CJBA 5EIYA 5FZYA 1O7OA 2UX8A 5DDVA 1PZTA 2WGZA 1AVAC 1I1EA 4NAIA 4GOVA 1BFFA 1ZI5A 1ABRB 2BFHA 1A8DA 1DFQA 3V79C 4I37A 4QO3A 4HO3A 3AZWA 1ISWA 1JY0A 3ZX7A 1INIA 1NHEB 1ZCUA 1QQKA 3NBDA 3WO2A 4IZXA 5IDTA 4OW4A 1JT4A 1Q04A 4I4VA 1XHBA 1K5UA 1II4A 1OMZA 4Y7TA 1DQGA 3U0YA 4JKXB 1G97A 3H6QA 5IDSA 4LO3A 2E4MC 1H5SC 4LW6A 4HCQA 3C9ZA 2OEGA 5C47A 2K8RA 5CMHA 2RITA 2HW9A 1ZDFA 2VXRA 1TVYA 2WVMA 3Q7YA 1V82A 5CQPA 3V0LA 3VT0A 5C38A 2Y6PA 5J49A 1ISZA 4I8MA 2RJ5A 5C1GA 3SX5A 4L4HA 4ZLBB 1ON6A 1MP4A 2O1GA 1TZFA 5JLVA 5FUHA 4M2AA 4LO0C 3BA5A 4OEEA 4AYJA 1ZJ0A 3Q80A 3FJ8A 5CQOA 5D91A 3V8YA 1IRAX 3Q4SA 4L4IA 3VEQA 1H7LA 3CRHA 5BOWA 4Y6NA 4JISA 4IRQA 2NS2A 1FV2A 1H5SA 2E4MA 1FOAA 1HM0A 3V0PA 5EC5A 2P72A 1EV2A 1HCDA 3PMEA 3JTJA 3PKQA 1HJJA 1Z4SA 5BQUC 2DRZA 3PHZA 3F1CA 3ZC8A 3BAHA 2AAIB 4QKRA 4P6AA 3BB2A 3ZXGA 1YF8B 1JTCA 5FZUA 4LO0A 2FYCB 1FV3A 3GUEA 1FWUA 3R4SA 3BAGA 1IJTA 1FN0A 4Z9WB 3F1YA 2D0JA 2J3PA 1TW5A 3I0HA 1H5RA 1LZIA 3IOHA 4H9WA 3O4DA 4NALA 4ZA3B 1NKHB 3BRKX 1YP3A 5F8WA 1VCLA 3I29B 1M2TB 1VICA 2RJ4A 4WBCA 5FYEA 1WT3A 3OGZA 5BQUA 2CU2A 4J18A 5C4CA 2Y9GA 4KEJA 4KPZA 5AJNA 3SX3A 5BXPA 1YP4A 7I1BA 1OMXA 1FGGA 4KC2A 3A21A 3F1RA 1BFGA 3T8SA 4HO5A 3FJKA 1VGZA 2ET2A 3IIRA 4Q9PA 3ZXDA 1Z0HA 1OQLB 1PC8B 2VSAA 2F8XC 1H7FA 1R8OA 4QKSA 1XZ6A 4KNRA 5FU8A 4EEMA 4MYBA 4B2XA 2O1HA 4I4XA 3SXEA 1ZIZA 4HJJA 2D7RA 3DJ4A 3FJFA 4I4OA 4AN6A 1ZI1A 4A7KA 4KXOA 3O4AA 4ZFWB 2MLLB 4OUJA 2Y4MA 4R7PA 3T7NA 5FTSA 2AM4A 2HZ9A 4KQLA 1V6XA 3MALA 5BXRA 3CRIA 3SXGA 1NQIB 1TFMB 1DQOA 1NZKA 1G2VA 1IILA 1R8NA 2RJ0A 1ZCVA 4KT7A 2KH2A 2Y4KA 4XFUA 3CA6A 3QR5A 3JUKA 1JLYA 2KI6B 1R80A 3PG0A 1IT0A 1OQMB 2WVLA 2KI4A 2C0NA 2VS5A 2XWLA 4B42A 3V0BB 4HOCA 3O4CA 1JLXA 3I0FA 3AJ6A 1R82A 1AFCA 4I1BA 1WSZA 2X5ZA 2RSTA 21BIA 2Y9FA 3SX8A 4FGFA 2XMHA 2I7BA 2OI5A 3UJ0A 4H75A 3NBCA 2IWTB 4B4BA 2BEBA 5D63A 1VH3A 2NM1A 1KWSA 3FJCA 3V0MA 3AKFA 2QH5A 5CMGX 4ENDA 3HMYA 4G9NA 1FGXA 1GX0A 4JD0A 2APCA 4EB2B 1YXWA 4Q9GA 8I1BA 3JRRA 1TW1A 1Z90A 4IZEA 2GGQA 4EE3A 1TOOA 2NYYA 1MP5A 1N4KA 4I7IA 1AVUA 2Z86A 1LL0A 3N0KA 3O44A 1G0RA 1WD4A 2KKIA 4YS8A 3U2WA 4QD2B 2GZBA 1R7YA 1ZI4A 4XFTA 2Y4LA 4I0YA 3HBWA 2X65A 1GQ9A 4BMAA 3H6SE 3O49A 4GOYA 4PC4A 3CKQA 2I5KA 4F83A 1HCEA 4KNXA 4LW3A 5EJZA 2X60A 1ISYA 2ERMA 2HWAA 2WVKA 5C3BA 3OJ2A 1H5TA 3CU0A 4J2XA 4MNDA 1CVSA 2WAWA 4GAIA 4JQ0A 4O6NA 4ZKTB 3LW6A 5F8YA 2VSIA 5C49A 3VSZA 2XOAA 2VXTI 1V6UA 3N7JA 4GP0A 1BARA 4M4KA 3LTQA 2AECA 3R2WA 4Q7CA 4EE4A 1VGWA 3CRGA 1WT2A 3I0EA 4JPZA 3O4OA 1ZCYA 1PUMB 3NJ5A 2FYBA 1M16A 3QVBA 2VLCA 1EVTA 4EFPA 4GAFA 4D11C 3CA4A 1G3LA 1VM8A 5DVHA 2VSHA 1JYKA 3IOJA 2VS4A 4P0JA 2WRYA 3MPPG 3H6RB 1VZXA 3K8EA 5C4EA 2BO6A 1SR4C 1LL3A 5C1LA 4I2SA 1H7GA 2DS0A 1Q03A 4X3AA 5FNWA 3RMYA 4DCKC 1G23A 1SZ6B 2WE9A 3FUOA 3CKJA 1GWWA 4Y64A 2Q9XA 4JRAA 3Q7WA 2VXMA 1FXOA 2VUAA 1W3GA 3NBEA 5DUYA 1ZJ2A 2AE7A 2Y9XE 4HG6A 3T7OA 3V0QA 5DDTA 2GO2A 3N7MA 2F2FC 4Y7FA 3I0JA 2Z48A 4HO0A 3BRGC 2X2TA 2V0LA 5FU0A 4B3UA 2DREA 1HWOB 3AJ5A 1H7HA 2BO4A 2VFZA 2WEEA 4NAKA 4I4QA 1QG8A 5CQMX 1SR4A 4HA2A 1BASA 3O4BA 1JV3A 1LL2A 4I4SA 4XFSA 4P02A 3POLA 4TLPA 3P6IA 2V0KA 1TIEA 1YROB 2AM3A 4EFQA 2D1ZA 1H7QA 3LLPA 1DZDA 2QN4A 2JCJA 3V0NA 4B4MA 2RJ9A 3A22A 1J0SA 2JCLA 1QWJA 3CGXA 2OEFA 3PNNA 1VH1A 4HO4A 3POKA 2FGFA 2F2FA 2P6WA 3N9WA 4LO8B 5GAQA 4K6RA 4IQPA 4FQWA 4QALA 3RSBA 3TZTA 3AKIA 2I1BA 3BAVA 9ILBA 4F34A 4DENA 3VUOA 3ZLLA 1S0BA 1G9AA 1PZYB 2D23A 1FR9A 3E26A 1FMMS 2NVHA 4FRPA 4G9MA 3JUJA 4IRPA 2AM5A 5D92A 4D48A 4MZGB 4X39A 3WMVA 1XZZA 4D8HA 3S8KA 3FJAA 3FJ9A 4DEPA 2FO1A 1O0RA 1BLAA 2I5EA 2RIXA 2V0JA 4Y9XA 2Y9WC 4USOA 4FRAA 5F8SA 1MD6A 1TWMA 4I96A 4ZFYB 2NP0A 1EZIA 2ZU9A 4UY4A 2KLLA 5I1FA 3D8VA 1RZOB 2AFGA 4JAWA 5L6SA 1JT7A 1WVCA 2NZ9A 2AGDA 2BO7A 1FWYA 1FMZA 5CMJA 4P0LA 1FO8A 1S0FA 2YC5A 1FO9A 3V0AB 4XWIA 3SNVA 1HM9A 3V0OA 1IIMA 4FRQA 3CQAA 3V8ZA 5HS2A 1O23B 3I2AA 4G6MA 2X2SA 3CA0A 1T4QA 3BAUA 3FUQA 4QC4A 4QBVA 3K8DA 3CA3A 4OWKA 3WINC 3CAHA 4KC3A 3IAGC 1PUUB 3OBRA 3WO4A 4EKXB 4FRDA 2E3DA 4ARWA 4X37A 1GA8A 1ZHJA 1RMLA 3S8JA 2XWNA 3FJDA 2V0IA 2X5SA 4MZHA 5G00A 3WA1A 1DZCA 1H7EA 3HL3A 3ZGFA 4A7ZA 2LIEA 2D43A 3Q7XA 4QD2C 1HIBA 5CMIA 3UD8A 5C3AA 2JCKA 3T7MA 3AKGA 3KMVA 4P0KA 1AVXB 4YOLA 1H7TA 5IFYA 3SXAA 1KNMA 3OBTA 3CA5A 2AH9A 5I1BA 2RIZA 2R9KB 5DSSB 4FVVA 2ICXA 1JV1A 3USRA 1FGAA 1O7QA 3TQDA 4ASJA 3O5WB 5FZZA 3WINA 4ISQA 2DPWA 3ZGGA 4DE7A 4KC4A 1W3FA 2GGOA 4Y7VA 4Q91A 1E5KA 1LVWA 2QYIB 1D0HA 1DLLA 4KEKA 2Q4JA 2RIYA 4G6JA 3U2VA 1YBIA 4KC1A 1TTUA 2FYDB 2D20A 1JVDA 1NF5B 4I4YA 3SXCA 1QXMA 3A23A 5D61A 2A8WA 2E8BA 3UD9A 4M2BA 3AH2A 4DECA 4Y6UA 1ZCTA 4AN7B 2P73A 2Z49A 5EJ1A 5JMCA 2Z87A 2RQ9A 2VK9A 2LIQA 4EE5A 4FRLA 2PGYA 1EYLA 4Z8SB 3FJHA 1R7VA 1HWMB 2Y4JA 3RTJB 1Q1UA 1HM8A 4IY9A 1W57A 2PGVA 2D24A 3FJEA 4CJMA 1HV9A 2A8UA 2AESA 4EEGA 4R6UB 4AC3A 5C4FA 2BO8A 4I4UA 5BVPI 3OJVA 2ZU8A 1GQCA 1WD3A 4JP0A 1FG5N 1ZJPA 3CKVA 4X38A 3O3QA 6I1BA 1HKNA 1S0LA 2ZR1B 1QGQA 2AQZA 1S4PA 4ZDQA 3O3PA 1V83A 1SS9A 2NTDA 4CVHA 4J2YA 1R7UA 1I52A 3SPTA 1VZTA 2ZQNA 3CKNA 1V6WA 3P53A 2FY7A 1W77A 3V91A 4LO7B 4HO2A 1G9RA 1WBAA 3H6RA 3WMUA 1IINA 2D44A 4LO3C 3DK5A 1JQZA 3OGGA 1G82A 1H5TB 3AZVA 1HJLA 1GX4A 1RY7A 1S4OA 3U2TA 1GGPB 2PX7A 4Y62A 1INJA 1FQ9A 2YQJA 1E0OA 2FFVA 3D7WB 3OC9A 1ON8A 4FRHA 3BA4A 1TP0A 1P63A 5BXCA 1ZI3A 3VSFA 4P00A 3U0XA 1H5SD 5D62A 2RG9B 1JT5A 41BIA 2J0BA 2DRYA 2W0VA 1WT0A 4MZFB 1HWPB 2YUGA 5C3DA 4G87A 3BAQA 3FFZA 3V90A 2QGIA 4D11A 4ECMA 3B9UA 2WBCA 3FJJA 3D98A 4J23B 3BADA 3HSMA 3USQA 3I0CA 3SX7A 3FJIA 1HWNB 4CJCA 4G3QA 3RSJA 3BCVA 4UEGA 3N7KA 1VGUA 2VXLA 4G3SA 4FROA 3D5NA 4IY8A 2FFUA 1LZJA 3W9TA 3ZF8A 4DDZA 1I1BA 4OWJA 4IONA 1MC3A 3RMXA 1XG6A 3OKRA 4EVWA 5FTVA 3CA1A 3E8LC 1H4CA 3QYDA 3I0IX 3OAMA 4FRBA 1BFBA 4M28A 1JT3A 1YTOA 3A07A 4II0A 1G9DA 4B4GA 4AAWA 3OH0A 2RJ8A 3ZLKA 4D0TA 4QBCA 1H5SB 3AH4A 4HO8A 4Y7UA 2IHOA 4I6IA 4B5BA 1DFCA 2RJ6A 4D0ZA 5JQQA 1S0GA 2HWMA 4KPXA 1Z2VA 2Y7AA 3IM5A 1W55A 1BA7A 1PZZA 4KEIA 3TC2A 3IM6A 2OI6A 3BAOA 2OI7A 5AJPA 1F31A 2NXVA 4ZFUB 1ZJ1A 1AF9A 3IOIA 4Y63A 4H04A 1IRPA 3I0LA 5C36A 4FCEA 2RJ1A 1BFCA 1DJSB 1EPWA 3PUBA 1H4DA 1R7TA 3EE5A 3R3IA 1MC9A 4A7YA 4Y7GA 3U2XA 1AVWB 2VSEA 1H3MA 1H5RB 4J2KA 1V6VA 4I3NA 1L2HA 3UDAA 3N7LA 2MIBA 3HOMA 3VT2A 2QKXA 3Q7UA 4B2WA 4OEFA 1ISVA 3V0AA 3RMWA 3WO3A 1S4NA 2VS3A 3BRDA 5L6VA 3R4UA 1R7XA 1CE7B 3UD7A 1JVGA 4OEGA 3BX1C 3SXDA 1EYRA 1K4VA 2K43A 1NWGB 1VPAA 3AH1A 4I4RA 2J0AA 1S0EA 2YCMA 4HO6A 5F90A 1ISXA 2ESUA 1RG8A 4HR6C 1G8OA 4HO9A 1YYNA 3UJ4A 2P39A 4IYBA 3ILAA 3JUTA 4I4PA 3I2XA 5EG6C 3AKHA 5BXTA 1DIWA 4OWLA 4G1RA 3E25A 3OH2A 5C4BA 1YP2A 1G9CA 3BRFA 2YC3A 2PA4A 2XWMA 4GP3A 5BXSA 4G3PA 1FXJA 1IHKA 2XMEA 4EEEB 3CKOA 1FZWA 4BQHA 4LO2C 3I0KA 2V0HA 1AXMA 4ZGRB 3RMVA 2ZQOA 1ONKB 2FYAA 1S0CA 4ASYA 5C48A 2FDBM 2Q3NB 4AYLA 5CQNX 4E1KA 1ITBA 4IHZA 5EHAA 1LZ7A 1G93A 2YQHA 3U2UA 5AJOA 1K5VA 3NBNA 3VT1A 1ZJ3A 1GWVA 1T9FA 3HALA 1G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXB A;  5HPZ A;  4L41 C;  1MP3 A;  2MC2 A;  1LZ0 A;  2K4A B;  3VWC A;  2UUS A;  1BLD A;  3NGW A;  5C8R A;  3I0G A;  4FRM A;  1IOB A;  2O1F A;  2M49 A;  4FRE A;  1JYL A;  3BA7 A;  2JCO A;  2YES A;  4LO2 A;  4GBP A;  5C1H A;  4EEO A;  4KBB A;  5B2H A;  3OGF A;  1V84 A;  4EFR A;  31BI A;  1ZDG A;  1XYF A;  2RJ7 A;  3PKP A;  4ZOT A;  1WBC A;  2VU9 A;  4CJ8 A;  3OJM A;  1QQL A;  4ZBV B;  3ZC9 A;  1WT1 A;  2W0W A;  4LO7 C;  4EEA A;  5BP5 C;  3OH1 A;  2YQC A;  3FJB A;  1G1L A;  3I0D A;  4J2S A;  4LO1 C;  2AXM A;  3P6J A;  1VZU A;  4KRV A;  5FV9 A;  4ISR A;  1W3A A;  1VGT A;  3CU1 B;  3RTI B;  4XKI A;  1FR8 A;  2P23 A;  2YQS A;  3V0B A;  3DUV A;  4JKQ A;  5E24 E;  2D22 A;  5DZU A;  2MZB A;  5CMF X;  2D7I A;  1QGS A;  1S0D A;  1PWA A;  3ST8 A;  3HN1 A;  1G95 A;  1FWV A;  1H4E A;  3EF2 A;  5FNX A;  3OH3 A;  4FCU A;  3IM7 A;  5C4D A;  2L5X A;  2BEA A;  3BTA A;  1ZJO A;  3FOQ A;  1NUN A;  5BP5 A;  4USP A;  4I1E A;  1FRW A;  1NMM B;  2ICY A;  3OH4 A;  3FGM A;  4LO1 A;  3KIA A;  4NAN A;  1UPS A;  2VD4 A;  4C2S A;  1TWE A;  3K1X A;  1R81 A;  2ZU7 A;  3F62 B;  5CQL X;  1ILR 1;  3FWW A;  4CJB A;  5EIY A;  5FZY A;  1O7O A;  2UX8 A;  5DDV A;  1PZT A;  2WGZ A;  1AVA C;  1I1E A;  4NAI A;  4GOV A;  1BFF A;  1ZI5 A;  1ABR B;  2BFH A;  1A8D A;  1DFQ A;  3V79 C;  4I37 A;  4QO3 A;  4HO3 A;  3AZW A;  1ISW A;  1JY0 A;  3ZX7 A;  1INI A;  1NHE B;  1ZCU A;  1QQK A;  3NBD A;  3WO2 A;  4IZX A;  5IDT A;  4OW4 A;  1JT4 A;  1Q04 A;  4I4V A;  1XHB A;  1K5U A;  1II4 A;  1OMZ A;  4Y7T A;  1DQG A;  3U0Y A;  4JKX B;  1G97 A;  3H6Q A;  5IDS A;  4LO3 A;  2E4M C;  1H5S C;  4LW6 A;  4HCQ A;  3C9Z A;  2OEG A;  5C47 A;  2K8R A;  5CMH A;  2RIT A;  2HW9 A;  1ZDF A;  2VXR A;  1TVY A;  2WVM A;  3Q7Y A;  1V82 A;  5CQP A;  3V0L A;  3VT0 A;  5C38 A;  2Y6P A;  5J49 A;  1ISZ A;  4I8M A;  2RJ5 A;  5C1G A;  3SX5 A;  4L4H A;  4ZLB B;  1ON6 A;  1MP4 A;  2O1G A;  1TZF A;  5JLV A;  5FUH A;  4M2A A;  4LO0 C;  3BA5 A;  4OEE A;  4AYJ A;  1ZJ0 A;  3Q80 A;  3FJ8 A;  5CQO A;  3V8Y A;  1IRA X;  3Q4S A;  4L4I A;  3VEQ A;  1H7L A;  3CRH A;  5BOW A;  4Y6N A;  4JIS A;  4IRQ A;  1FV2 A;  1H5S A;  2E4M A;  1FOA A;  1HM0 A;  3V0P A;  5EC5 A;  2P72 A;  1EV2 A;  1HCD A;  3PME A;  3JTJ A;  3PKQ A;  1HJJ A;  1Z4S A;  5BQU C;  2DRZ A;  3PHZ A;  3F1C A;  3ZC8 A;  3BAH A;  2AAI B;  4QKR A;  4P6A A;  3BB2 A;  3ZXG A;  1YF8 B;  1JTC A;  5FZU A;  4LO0 A;  2FYC B;  1FV3 A;  3GUE A;  1FWU A;  3R4S A;  3BAG A;  1IJT A;  1FN0 A;  4Z9W B;  3F1Y A;  2D0J A;  2J3P A;  1TW5 A;  3I0H A;  1H5R A;  1LZI A;  3IOH A;  4H9W A;  3O4D A;  4NAL A;  4ZA3 B;  1NKH B;  3BRK X;  1YP3 A;  5F8W A;  1VCL A;  3I29 B;  1M2T B;  1VIC A;  2RJ4 A;  4WBC A;  5FYE A;  1WT3 A;  3OGZ A;  5BQU A;  2CU2 A;  4J18 A;  5C4C A;  2Y9G A;  4KEJ A;  4KPZ A;  5AJN A;  3SX3 A;  5BXP A;  1YP4 A;  7I1B A;  1OMX A;  1FGG A;  4KC2 A;  3A21 A;  3F1R A;  1BFG A;  3T8S A;  4HO5 A;  3FJK A;  1VGZ A;  2ET2 A;  3IIR A;  4Q9P A;  3ZXD A;  1Z0H A;  1OQL B;  1PC8 B;  2VSA A;  2F8X C;  1H7F A;  1R8O A;  4QKS A;  1XZ6 A;  4KNR A;  5FU8 A;  4EEM A;  4MYB A;  4B2X A;  2O1H A;  4I4X A;  3SXE A;  1ZIZ A;  4HJJ A;  2D7R A;  3DJ4 A;  3FJF A;  4I4O A;  4AN6 A;  1ZI1 A;  4A7K A;  4KXO A;  3O4A A;  4ZFW B;  2MLL B;  4OUJ A;  2Y4M A;  4R7P A;  3T7N A;  5FTS A;  2AM4 A;  2HZ9 A;  4KQL A;  1V6X A;  3MAL A;  5BXR A;  3CRI A;  3SXG A;  1NQI B;  1TFM B;  1DQO A;  1NZK A;  1G2V A;  1IIL A;  1R8N A;  2RJ0 A;  1ZCV A;  4KT7 A;  2KH2 A;  2Y4K A;  4XFU A;  3CA6 A;  3QR5 A;  3JUK A;  1JLY A;  2KI6 B;  1R80 A;  3PG0 A;  1IT0 A;  1OQM B;  2WVL A;  2KI4 A;  2VS5 A;  2XWL A;  4B42 A;  3V0B B;  4HOC A;  3O4C A;  1JLX A;  3I0F A;  3AJ6 A;  1R82 A;  1AFC A;  4I1B A;  1WSZ A;  2X5Z A;  2RST A;  21BI A;  2Y9F A;  3SX8 A;  4FGF A;  2XMH A;  2I7B A;  2OI5 A;  3UJ0 A;  3NBC A;  2IWT B;  4B4B A;  2BEB A;  5D63 A;  1VH3 A;  2NM1 A;  1KWS A;  3FJC A;  3V0M A;  3AKF A;  2QH5 A;  5CMG X;  4END A;  3HMY A;  4G9N A;  1FGX A;  1GX0 A;  4JD0 A;  2APC A;  4EB2 B;  1YXW A;  4Q9G A;  8I1B A;  3JRR A;  1TW1 A;  1Z90 A;  4IZE A;  2GGQ A;  4EE3 A;  1TOO A;  2NYY A;  1MP5 A;  1N4K A;  4I7I A;  1AVU A;  2Z86 A;  1LL0 A;  3N0K A;  3O44 A;  1G0R A;  1WD4 A;  2KKI A;  4YS8 A;  3U2W A;  4QD2 B;  2GZB A;  1R7Y A;  1ZI4 A;  4XFT A;  2Y4L A;  4I0Y A;  3HBW A;  2X65 A;  1GQ9 A;  4BMA A;  3H6S E;  3O49 A;  4GOY A;  4PC4 A;  3CKQ A;  2I5K A;  4F83 A;  1HCE A;  4KNX A;  4LW3 A;  5EJZ A;  2X60 A;  1ISY A;  2ERM A;  2HWA A;  2WVK A;  5C3B A;  3OJ2 A;  1H5T A;  3CU0 A;  4J2X A;  4MND A;  1CVS A;  2WAW A;  4GAI A;  4JQ0 A;  4ZKT B;  3LW6 A;  5F8Y A;  2VSI A;  5C49 A;  3VSZ A;  2XOA A;  2VXT I;  1V6U A;  3N7J A;  4GP0 A;  1BAR A;  4M4K A;  3LTQ A;  2AEC A;  3R2W A;  4EE4 A;  1VGW A;  3CRG A;  1WT2 A;  3I0E A;  4JPZ A;  3O4O A;  1ZCY A;  1PUM B;  3NJ5 A;  2FYB A;  1M16 A;  3QVB A;  2VLC A;  1EVT A;  4EFP A;  4GAF A;  4D11 C;  3CA4 A;  1G3L A;  1VM8 A;  5DVH A;  2VSH A;  1JYK A;  3IOJ A;  2VS4 A;  4P0J A;  2WRY A;  3MPP G;  3H6R B;  1VZX A;  3K8E A;  5C4E A;  2BO6 A;  1SR4 C;  1LL3 A;  5C1L A;  4I2S A;  1H7G A;  2DS0 A;  1Q03 A;  4X3A A;  5FNW A;  3RMY A;  4DCK C;  1G23 A;  1SZ6 B;  2WE9 A;  3FUO A;  3CKJ A;  1GWW A;  4Y64 A;  2Q9X A;  4JRA A;  3Q7W A;  2VXM A;  1FXO A;  2VUA A;  1W3G A;  3NBE A;  5DUY A;  1ZJ2 A;  2AE7 A;  2Y9X E;  4HG6 A;  3T7O A;  3V0Q A;  5DDT A;  2GO2 A;  3N7M A;  2F2F C;  4Y7F A;  3I0J A;  2Z48 A;  4HO0 A;  3BRG C;  2X2T A;  2V0L A;  5FU0 A;  4B3U A;  2DRE A;  1HWO B;  3AJ5 A;  1H7H A;  2BO4 A;  2VFZ A;  2WEE A;  4NAK A;  4I4Q A;  1QG8 A;  5CQM X;  1SR4 A;  4HA2 A;  1BAS A;  3O4B A;  1JV3 A;  1LL2 A;  4I4S A;  4XFS A;  4P02 A;  3POL A;  4TLP A;  3P6I A;  2V0K A;  1TIE A;  1YRO B;  2AM3 A;  4EFQ A;  2D1Z A;  1H7Q A;  3LLP A;  1DZD A;  2QN4 A;  2JCJ A;  3V0N A;  4B4M A;  2RJ9 A;  3A22 A;  1J0S A;  2JCL A;  1QWJ A;  3CGX A;  2OEF A;  3PNN A;  1VH1 A;  4HO4 A;  3POK A;  2FGF A;  2F2F A;  2P6W A;  3N9W A;  4LO8 B;  5GAQ A;  4K6R A;  4IQP A;  4FQW A;  4QAL A;  3RSB A;  3TZT A;  3AKI A;  2I1B A;  3BAV A;  9ILB A;  4F34 A;  4DEN A;  3VUO A;  3ZLL A;  1S0B A;  1G9A A;  1PZY B;  2D23 A;  1FR9 A;  3E26 A;  1FMM S;  2NVH A;  4FRP A;  4G9M A;  3JUJ A;  4IRP A;  2AM5 A;  4D48 A;  4X39 A;  3WMV A;  1XZZ A;  4D8H A;  3S8K A;  3FJA A;  3FJ9 A;  4DEP A;  2FO1 A;  1O0R A;  1BLA A;  2I5E A;  2RIX A;  2V0J A;  4Y9X A;  2Y9W C;  4USO A;  4FRA A;  5F8S A;  1MD6 A;  1TWM A;  4I96 A;  4ZFY B;  2NP0 A;  1EZI A;  2ZU9 A;  5I1F A;  2KLL A;  3D8V A;  1RZO B;  2AFG A;  4JAW A;  5L6S A;  1JT7 A;  1WVC A;  2NZ9 A;  2AGD A;  2BO7 A;  1FWY A;  1FMZ A;  5CMJ A;  4P0L A;  1FO8 A;  1S0F A;  2YC5 A;  1FO9 A;  3V0A B;  4XWI A;  3SNV A;  1HM9 A;  3V0O A;  1IIM A;  4FRQ A;  3CQA A;  3V8Z A;  5HS2 A;  1O23 B;  3I2A A;  4G6M A;  2X2S A;  3CA0 A;  1T4Q A;  3BAU A;  3FUQ A;  4QC4 A;  4QBV A;  3K8D A;  3CA3 A;  4OWK A;  3WIN C;  3CAH A;  4KC3 A;  3IAG C;  1PUU B;  3OBR A;  3WO4 A;  4EKX B;  4FRD A;  2E3D A;  4ARW A;  4X37 A;  1GA8 A;  1ZHJ A;  1RML A;  3S8J A;  2XWN A;  3FJD A;  2V0I A;  2X5S A;  5G00 A;  3WA1 A;  1DZC A;  1H7E A;  3HL3 A;  3ZGF A;  4A7Z A;  2LIE A;  2D43 A;  3Q7X A;  4QD2 C;  1HIB A;  5CMI A;  3UD8 A;  5C3A A;  2JCK A;  3T7M A;  3AKG A;  3KMV A;  4P0K A;  1AVX B;  4YOL A;  1H7T A;  5IFY A;  3SXA A;  1KNM A;  3OBT A;  3CA5 A;  2AH9 A;  5I1B A;  2RIZ A;  2R9K B;  5DSS B;  4FVV A;  2ICX A;  1JV1 A;  3USR A;  1FGA A;  1O7Q A;  3TQD A;  4ASJ A;  3O5W B;  5FZZ A;  3WIN A;  4ISQ A;  2DPW A;  3ZGG A;  4DE7 A;  4KC4 A;  1W3F A;  2GGO A;  4Y7V A;  4Q91 A;  1E5K A;  1LVW A;  2QYI B;  1D0H A;  1DLL A;  4KEK A;  2Q4J A;  2RIY A;  4G6J A;  3U2V A;  1YBI A;  4KC1 A;  1TTU A;  2FYD B;  2D20 A;  1JVD A;  1NF5 B;  4I4Y A;  3SXC A;  1QXM A;  3A23 A;  5D61 A;  2A8W A;  2E8B A;  3UD9 A;  4M2B A;  3AH2 A;  4DEC A;  4Y6U A;  1ZCT A;  4AN7 B;  2P73 A;  2Z49 A;  5EJ1 A;  5JMC A;  2Z87 A;  2RQ9 A;  2LIQ A;  4EE5 A;  4FRL A;  2PGY A;  1EYL A;  4Z8S B;  3FJH A;  1R7V A;  1HWM B;  2Y4J A;  3RTJ B;  1Q1U A;  1HM8 A;  4IY9 A;  1W57 A;  2PGV A;  2D24 A;  3FJE A;  4CJM A;  1HV9 A;  2A8U A;  2AES A;  4EEG A;  4R6U B;  4AC3 A;  5C4F A;  2BO8 A;  4I4U A;  5BVP I;  3OJV A;  2ZU8 A;  1GQC A;  1WD3 A;  4JP0 A;  1FG5 N;  1ZJP A;  3CKV A;  4X38 A;  3O3Q A;  6I1B A;  1HKN A;  1S0L A;  2ZR1 B;  1QGQ A;  2AQZ A;  1S4P A;  4ZDQ A;  3O3P A;  1V83 A;  1SS9 A;  2NTD A;  4CVH A;  4J2Y A;  1R7U A;  1I52 A;  3SPT A;  1VZT A;  2ZQN A;  3CKN A;  1V6W A;  3P53 A;  2FY7 A;  1W77 A;  3V91 A;  4LO7 B;  4HO2 A;  1G9R A;  1WBA A;  3H6R A;  3WMU A;  1IIN A;  2D44 A;  4LO3 C;  3DK5 A;  1JQZ A;  3OGG A;  1G82 A;  1H5T B;  3AZV A;  1HJL A;  1GX4 A;  1RY7 A;  1S4O A;  3U2T A;  1GGP B;  2PX7 A;  4Y62 A;  1INJ A;  1FQ9 A;  2YQJ A;  1E0O A;  2FFV A;  3D7W B;  3OC9 A;  1ON8 A;  4FRH A;  3BA4 A;  1TP0 A;  1P63 A;  5BXC A;  1ZI3 A;  3VSF A;  4P00 A;  3U0X A;  1H5S D;  5D62 A;  2RG9 B;  1JT5 A;  41BI A;  2W0V A;  2DRY A;  1WT0 A;  1HWP B;  2YUG A;  5C3D A;  4G87 A;  3BAQ A;  3FFZ A;  3V90 A;  2QGI A;  4D11 A;  4ECM A;  3B9U A;  2WBC A;  3FJJ A;  3D98 A;  4J23 B;  3BAD A;  3HSM A;  3USQ A;  3I0C A;  3SX7 A;  3FJI A;  1HWN B;  4CJC A;  4G3Q A;  3RSJ A;  3BCV A;  4UEG A;  3N7K A;  1VGU A;  2VXL A;  4G3S A;  4FRO A;  3D5N A;  4IY8 A;  2FFU A;  1LZJ A;  3W9T A;  3ZF8 A;  4DDZ A;  1I1B A;  4OWJ A;  4ION A;  1MC3 A;  3RMX A;  1XG6 A;  3OKR A;  4EVW A;  5FTV A;  3CA1 A;  3E8L C;  1H4C A;  3QYD A;  3I0I X;  3OAM A;  4FRB A;  1BFB A;  4M28 A;  1JT3 A;  1YTO A;  3A07 A;  4II0 A;  1G9D A;  4B4G A;  4AAW A;  3OH0 A;  2RJ8 A;  3ZLK A;  4D0T A;  4QBC A;  1H5S B;  3AH4 A;  4HO8 A;  4Y7U A;  2IHO A;  4I6I A;  4B5B A;  1DFC A;  2RJ6 A;  4D0Z A;  5JQQ A;  1S0G A;  2HWM A;  4KPX A;  1Z2V A;  2Y7A A;  3IM5 A;  1W55 A;  1BA7 A;  1PZZ A;  4KEI A;  3TC2 A;  3IM6 A;  2OI6 A;  3BAO A;  2OI7 A;  5AJP A;  1F31 A;  2NXV A;  4ZFU B;  1ZJ1 A;  1AF9 A;  3IOI A;  4Y63 A;  4H04 A;  1IRP A;  3I0L A;  5C36 A;  4FCE A;  2RJ1 A;  1BFC A;  1DJS B;  1EPW A;  3PUB A;  1H4D A;  1R7T A;  3EE5 A;  3R3I A;  1MC9 A;  4A7Y A;  4Y7G A;  3U2X A;  1AVW B;  2VSE A;  1H3M A;  1H5R B;  4J2K A;  1V6V A;  4I3N A;  1L2H A;  3UDA A;  3N7L A;  2MIB A;  3HOM A;  3VT2 A;  2QKX A;  3Q7U A;  4B2W A;  4OEF A;  1ISV A;  3V0A A;  3RMW A;  3WO3 A;  1S4N A;  2VS3 A;  3BRD A;  5L6V A;  3R4U A;  1R7X A;  1CE7 B;  3UD7 A;  1JVG A;  4OEG A;  3BX1 C;  3SXD A;  1EYR A;  1K4V A;  2K43 A;  1NWG B;  1VPA A;  3AH1 A;  4I4R A;  4HO6 A;  1S0E A;  2YCM A;  5F90 A;  1ISX A;  2ESU A;  1RG8 A;  4HR6 C;  1G8O A;  4HO9 A;  1YYN A;  3UJ4 A;  2P39 A;  4IYB A;  3ILA A;  3JUT A;  4I4P A;  3I2X A;  5EG6 C;  3AKH A;  5BXT A;  1DIW A;  4OWL A;  4G1R A;  3E25 A;  3OH2 A;  5C4B A;  1YP2 A;  1G9C A;  3BRF A;  2YC3 A;  2PA4 A;  2XWM A;  4GP3 A;  5BXS A;  4G3P A;  1FXJ A;  1IHK A;  2XME A;  4EEE B;  3CKO A;  1FZW A;  4BQH A;  4LO2 C;  3I0K A;  2V0H A;  1AXM A;  4ZGR B;  3RMV A;  2ZQO A;  1ONK B;  2FYA A;  1S0C A;  4ASY A;  5C48 A;  2FDB M;  2Q3N B;  4AYL A;  5CQN X;  4E1K A;  1ITB A;  4IHZ A;  5EHA A;  1LZ7 A;  1G93 A;  2YQH A;  3U2U A;  5AJO A;  1K5V A;  3NBN A;  3VT1 A;  1ZJ3 A;  1GWV A;  1T9F A;  3HAL A;  1G9B A; 
#chains in the Genus database with same CATH topology
 3SXB A;  5HPZ A;  4L41 C;  1MP3 A;  2MC2 A;  1LZ0 A;  2K4A B;  3VWC A;  2UUS A;  1BLD A;  3NGW A;  5C8R A;  3I0G A;  4FRM A;  1IOB A;  2O1F A;  2M49 A;  4FRE A;  1JYL A;  3BA7 A;  2JCO A;  2YES A;  4LO2 A;  4GBP A;  5C1H A;  4EEO A;  4KBB A;  5B2H A;  3OGF A;  1V84 A;  4EFR A;  31BI A;  1ZDG A;  1XYF A;  2RJ7 A;  3PKP A;  4ZOT A;  1WBC A;  2VU9 A;  4CJ8 A;  3OJM A;  1QQL A;  4ZBV B;  3ZC9 A;  1WT1 A;  2W0W A;  4LO7 C;  4EEA A;  5BP5 C;  3OH1 A;  2YQC A;  3FJB A;  1G1L A;  3I0D A;  4J2S A;  4LO1 C;  2AXM A;  3P6J A;  1VZU A;  4KRV A;  5FV9 A;  4ISR A;  1W3A A;  1VGT A;  3CU1 B;  3RTI B;  4XKI A;  1FR8 A;  2P23 A;  2YQS A;  3V0B A;  3DUV A;  4JKQ A;  5E24 E;  2D22 A;  5DZU A;  2MZB A;  5CMF X;  2D7I A;  1QGS A;  1S0D A;  1PWA A;  3ST8 A;  3HN1 A;  1G95 A;  1FWV A;  1H4E A;  4FIX A;  4MIX A;  3EF2 A;  5FNX A;  3OH3 A;  4FCU A;  3IM7 A;  5C4D A;  2L5X A;  2BEA A;  3BTA A;  1ZJO A;  3FOQ A;  1NUN A;  4O6M A;  5BP5 A;  4USP A;  4I1E A;  1FRW A;  1NMM B;  2ICY A;  3OH4 A;  3FGM A;  4LO1 A;  3KIA A;  4FIY A;  1UPS A;  2VD4 A;  4NAN A;  4C2S A;  1TWE A;  3K1X A;  1R81 A;  2ZU7 A;  3F62 B;  5CQL X;  1ILR 1;  3FWW A;  4CJB A;  5EIY A;  5FZY A;  1O7O A;  2UX8 A;  5DDV A;  1PZT A;  2WGZ A;  1AVA C;  1I1E A;  4NAI A;  4GOV A;  1BFF A;  1ZI5 A;  1ABR B;  2BFH A;  1A8D A;  1DFQ A;  3V79 C;  4I37 A;  4QO3 A;  4HO3 A;  3AZW A;  1ISW A;  1JY0 A;  3ZX7 A;  1INI A;  1NHE B;  1ZCU A;  1QQK A;  3NBD A;  3WO2 A;  4IZX A;  5IDT A;  4OW4 A;  1JT4 A;  1Q04 A;  4I4V A;  1XHB A;  1K5U A;  1II4 A;  1OMZ A;  4Y7T A;  1DQG A;  3U0Y A;  4JKX B;  1G97 A;  3H6Q A;  5IDS A;  4LO3 A;  2E4M C;  1H5S C;  4LW6 A;  4HCQ A;  3C9Z A;  2OEG A;  5C47 A;  2K8R A;  5CMH A;  2RIT A;  2HW9 A;  1ZDF A;  2VXR A;  1TVY A;  2WVM A;  3Q7Y A;  1V82 A;  5CQP A;  3V0L A;  3VT0 A;  5C38 A;  2Y6P A;  5J49 A;  1ISZ A;  4I8M A;  2RJ5 A;  5C1G A;  3SX5 A;  4L4H A;  4ZLB B;  1ON6 A;  1MP4 A;  2O1G A;  1TZF A;  5JLV A;  5FUH A;  4M2A A;  4LO0 C;  3BA5 A;  4OEE A;  4AYJ A;  1ZJ0 A;  3Q80 A;  3FJ8 A;  5CQO A;  5D91 A;  3V8Y A;  1IRA X;  3Q4S A;  4L4I A;  3VEQ A;  1H7L A;  3CRH A;  5BOW A;  4Y6N A;  4JIS A;  4IRQ A;  2NS2 A;  1FV2 A;  1H5S A;  2E4M A;  1FOA A;  1HM0 A;  3V0P A;  5EC5 A;  2P72 A;  1EV2 A;  1HCD A;  3PME A;  3JTJ A;  3PKQ A;  1HJJ A;  1Z4S A;  5BQU C;  2DRZ A;  3PHZ A;  3F1C A;  3ZC8 A;  3BAH A;  2AAI B;  4QKR A;  4P6A A;  3BB2 A;  3ZXG A;  1YF8 B;  1JTC A;  5FZU A;  4LO0 A;  2FYC B;  1FV3 A;  3GUE A;  1FWU A;  3R4S A;  3BAG A;  1IJT A;  1FN0 A;  4Z9W B;  3F1Y A;  2D0J A;  2J3P A;  1TW5 A;  3I0H A;  1H5R A;  1LZI A;  3IOH A;  4H9W A;  3O4D A;  4NAL A;  4ZA3 B;  1NKH B;  3BRK X;  1YP3 A;  5F8W A;  1VCL A;  3I29 B;  1M2T B;  1VIC A;  2RJ4 A;  4WBC A;  5FYE A;  1WT3 A;  3OGZ A;  5BQU A;  2CU2 A;  4J18 A;  5C4C A;  2Y9G A;  4KEJ A;  4KPZ A;  5AJN A;  3SX3 A;  5BXP A;  1YP4 A;  7I1B A;  1OMX A;  1FGG A;  4KC2 A;  3A21 A;  3F1R A;  1BFG A;  3T8S A;  4HO5 A;  3FJK A;  1VGZ A;  2ET2 A;  3IIR A;  4Q9P A;  3ZXD A;  1Z0H A;  1OQL B;  1PC8 B;  2VSA A;  2F8X C;  1H7F A;  1R8O A;  4QKS A;  1XZ6 A;  4KNR A;  5FU8 A;  4EEM A;  4MYB A;  4B2X A;  2O1H A;  4I4X A;  3SXE A;  1ZIZ A;  4HJJ A;  2D7R A;  3DJ4 A;  3FJF A;  4I4O A;  4AN6 A;  1ZI1 A;  4A7K A;  4KXO A;  3O4A A;  4ZFW B;  2MLL B;  4OUJ A;  2Y4M A;  4R7P A;  3T7N A;  5FTS A;  2AM4 A;  2HZ9 A;  4KQL A;  1V6X A;  3MAL A;  5BXR A;  3CRI A;  3SXG A;  1NQI B;  1TFM B;  1DQO A;  1NZK A;  1G2V A;  1IIL A;  1R8N A;  2RJ0 A;  1ZCV A;  4KT7 A;  2KH2 A;  2Y4K A;  4XFU A;  3CA6 A;  3QR5 A;  3JUK A;  1JLY A;  2KI6 B;  1R80 A;  3PG0 A;  1IT0 A;  1OQM B;  2WVL A;  2KI4 A;  2C0N A;  2VS5 A;  2XWL A;  4B42 A;  3V0B B;  4HOC A;  3O4C A;  1JLX A;  3I0F A;  3AJ6 A;  1R82 A;  1AFC A;  4I1B A;  1WSZ A;  2X5Z A;  2RST A;  21BI A;  2Y9F A;  3SX8 A;  4FGF A;  2XMH A;  2I7B A;  2OI5 A;  3UJ0 A;  4H75 A;  3NBC A;  2IWT B;  4B4B A;  2BEB A;  5D63 A;  1VH3 A;  2NM1 A;  1KWS A;  3FJC A;  3V0M A;  3AKF A;  2QH5 A;  5CMG X;  4END A;  3HMY A;  4G9N A;  1FGX A;  1GX0 A;  4JD0 A;  2APC A;  4EB2 B;  1YXW A;  4Q9G A;  8I1B A;  3JRR A;  1TW1 A;  1Z90 A;  4IZE A;  2GGQ A;  4EE3 A;  1TOO A;  2NYY A;  1MP5 A;  1N4K A;  4I7I A;  1AVU A;  2Z86 A;  1LL0 A;  3N0K A;  3O44 A;  1G0R A;  1WD4 A;  2KKI A;  4YS8 A;  3U2W A;  4QD2 B;  2GZB A;  1R7Y A;  1ZI4 A;  4XFT A;  2Y4L A;  4I0Y A;  3HBW A;  2X65 A;  1GQ9 A;  4BMA A;  3H6S E;  3O49 A;  4GOY A;  4PC4 A;  3CKQ A;  2I5K A;  4F83 A;  1HCE A;  4KNX A;  4LW3 A;  5EJZ A;  2X60 A;  1ISY A;  2ERM A;  2HWA A;  2WVK A;  5C3B A;  3OJ2 A;  1H5T A;  3CU0 A;  4J2X A;  4MND A;  1CVS A;  2WAW A;  4GAI A;  4JQ0 A;  4O6N A;  4ZKT B;  3LW6 A;  5F8Y A;  2VSI A;  5C49 A;  3VSZ A;  2XOA A;  2VXT I;  1V6U A;  3N7J A;  4GP0 A;  1BAR A;  4M4K A;  3LTQ A;  2AEC A;  3R2W A;  4Q7C A;  4EE4 A;  1VGW A;  3CRG A;  1WT2 A;  3I0E A;  4JPZ A;  3O4O A;  1ZCY A;  1PUM B;  3NJ5 A;  2FYB A;  1M16 A;  3QVB A;  2VLC A;  1EVT A;  4EFP A;  4GAF A;  4D11 C;  3CA4 A;  1G3L A;  1VM8 A;  5DVH A;  2VSH A;  1JYK A;  3IOJ A;  2VS4 A;  4P0J A;  2WRY A;  3MPP G;  3H6R B;  1VZX A;  3K8E A;  5C4E A;  2BO6 A;  1SR4 C;  1LL3 A;  5C1L A;  4I2S A;  1H7G A;  2DS0 A;  1Q03 A;  4X3A A;  5FNW A;  3RMY A;  4DCK C;  1G23 A;  1SZ6 B;  2WE9 A;  3FUO A;  3CKJ A;  1GWW A;  4Y64 A;  2Q9X A;  4JRA A;  3Q7W A;  2VXM A;  1FXO A;  2VUA A;  1W3G A;  3NBE A;  5DUY A;  1ZJ2 A;  2AE7 A;  2Y9X E;  4HG6 A;  3T7O A;  3V0Q A;  5DDT A;  2GO2 A;  3N7M A;  2F2F C;  4Y7F A;  3I0J A;  2Z48 A;  4HO0 A;  3BRG C;  2X2T A;  2V0L A;  5FU0 A;  4B3U A;  2DRE A;  1HWO B;  3AJ5 A;  1H7H A;  2BO4 A;  2VFZ A;  2WEE A;  4NAK A;  4I4Q A;  1QG8 A;  5CQM X;  1SR4 A;  4HA2 A;  1BAS A;  3O4B A;  1JV3 A;  1LL2 A;  4I4S A;  4XFS A;  4P02 A;  3POL A;  4TLP A;  3P6I A;  2V0K A;  1TIE A;  1YRO B;  2AM3 A;  4EFQ A;  2D1Z A;  1H7Q A;  3LLP A;  1DZD A;  2QN4 A;  2JCJ A;  3V0N A;  4B4M A;  2RJ9 A;  3A22 A;  1J0S A;  2JCL A;  1QWJ A;  3CGX A;  2OEF A;  3PNN A;  1VH1 A;  4HO4 A;  3POK A;  2FGF A;  2F2F A;  2P6W A;  3N9W A;  4LO8 B;  5GAQ A;  4K6R A;  4IQP A;  4FQW A;  4QAL A;  3RSB A;  3TZT A;  3AKI A;  2I1B A;  3BAV A;  9ILB A;  4F34 A;  4DEN A;  3VUO A;  3ZLL A;  1S0B A;  1G9A A;  1PZY B;  2D23 A;  1FR9 A;  3E26 A;  1FMM S;  2NVH A;  4FRP A;  4G9M A;  3JUJ A;  4IRP A;  2AM5 A;  5D92 A;  4D48 A;  4MZG B;  4X39 A;  3WMV A;  1XZZ A;  4D8H A;  3S8K A;  3FJA A;  3FJ9 A;  4DEP A;  2FO1 A;  1O0R A;  1BLA A;  2I5E A;  2RIX A;  2V0J A;  4Y9X A;  2Y9W C;  4USO A;  4FRA A;  5F8S A;  1MD6 A;  1TWM A;  4I96 A;  4ZFY B;  2NP0 A;  1EZI A;  2ZU9 A;  4UY4 A;  2KLL A;  5I1F A;  3D8V A;  1RZO B;  2AFG A;  4JAW A;  5L6S A;  1JT7 A;  1WVC A;  2NZ9 A;  2AGD A;  2BO7 A;  1FWY A;  1FMZ A;  5CMJ A;  4P0L A;  1FO8 A;  1S0F A;  2YC5 A;  1FO9 A;  3V0A B;  4XWI A;  3SNV A;  1HM9 A;  3V0O A;  1IIM A;  4FRQ A;  3CQA A;  3V8Z A;  5HS2 A;  1O23 B;  3I2A A;  4G6M A;  2X2S A;  3CA0 A;  1T4Q A;  3BAU A;  3FUQ A;  4QC4 A;  4QBV A;  3K8D A;  3CA3 A;  4OWK A;  3WIN C;  3CAH A;  4KC3 A;  3IAG C;  1PUU B;  3OBR A;  3WO4 A;  4EKX B;  4FRD A;  2E3D A;  4ARW A;  4X37 A;  1GA8 A;  1ZHJ A;  1RML A;  3S8J A;  2XWN A;  3FJD A;  2V0I A;  2X5S A;  4MZH A;  5G00 A;  3WA1 A;  1DZC A;  1H7E A;  3HL3 A;  3ZGF A;  4A7Z A;  2LIE A;  2D43 A;  3Q7X A;  4QD2 C;  1HIB A;  5CMI A;  3UD8 A;  5C3A A;  2JCK A;  3T7M A;  3AKG A;  3KMV A;  4P0K A;  1AVX B;  4YOL A;  1H7T A;  5IFY A;  3SXA A;  1KNM A;  3OBT A;  3CA5 A;  2AH9 A;  5I1B A;  2RIZ A;  2R9K B;  5DSS B;  4FVV A;  2ICX A;  1JV1 A;  3USR A;  1FGA A;  1O7Q A;  3TQD A;  4ASJ A;  3O5W B;  5FZZ A;  3WIN A;  4ISQ A;  2DPW A;  3ZGG A;  4DE7 A;  4KC4 A;  1W3F A;  2GGO A;  4Y7V A;  4Q91 A;  1E5K A;  1LVW A;  2QYI B;  1D0H A;  1DLL A;  4KEK A;  2Q4J A;  2RIY A;  4G6J A;  3U2V A;  1YBI A;  4KC1 A;  1TTU A;  2FYD B;  2D20 A;  1JVD A;  1NF5 B;  4I4Y A;  3SXC A;  1QXM A;  3A23 A;  5D61 A;  2A8W A;  2E8B A;  3UD9 A;  4M2B A;  3AH2 A;  4DEC A;  4Y6U A;  1ZCT A;  4AN7 B;  2P73 A;  2Z49 A;  5EJ1 A;  5JMC A;  2Z87 A;  2RQ9 A;  2VK9 A;  2LIQ A;  4EE5 A;  4FRL A;  2PGY A;  1EYL A;  4Z8S B;  3FJH A;  1R7V A;  1HWM B;  2Y4J A;  3RTJ B;  1Q1U A;  1HM8 A;  4IY9 A;  1W57 A;  2PGV A;  2D24 A;  3FJE A;  4CJM A;  1HV9 A;  2A8U A;  2AES A;  4EEG A;  4R6U B;  4AC3 A;  5C4F A;  2BO8 A;  4I4U A;  5BVP I;  3OJV A;  2ZU8 A;  1GQC A;  1WD3 A;  4JP0 A;  1FG5 N;  1ZJP A;  3CKV A;  4X38 A;  3O3Q A;  6I1B A;  1HKN A;  1S0L A;  2ZR1 B;  1QGQ A;  2AQZ A;  1S4P A;  4ZDQ A;  3O3P A;  1V83 A;  1SS9 A;  2NTD A;  4CVH A;  4J2Y A;  1R7U A;  1I52 A;  3SPT A;  1VZT A;  2ZQN A;  3CKN A;  1V6W A;  3P53 A;  2FY7 A;  1W77 A;  3V91 A;  4LO7 B;  4HO2 A;  1G9R A;  1WBA A;  3H6R A;  3WMU A;  1IIN A;  2D44 A;  4LO3 C;  3DK5 A;  1JQZ A;  3OGG A;  1G82 A;  1H5T B;  3AZV A;  1HJL A;  1GX4 A;  1RY7 A;  1S4O A;  3U2T A;  1GGP B;  2PX7 A;  4Y62 A;  1INJ A;  1FQ9 A;  2YQJ A;  1E0O A;  2FFV A;  3D7W B;  3OC9 A;  1ON8 A;  4FRH A;  3BA4 A;  1TP0 A;  1P63 A;  5BXC A;  1ZI3 A;  3VSF A;  4P00 A;  3U0X A;  1H5S D;  5D62 A;  2RG9 B;  1JT5 A;  41BI A;  2J0B A;  2DRY A;  2W0V A;  1WT0 A;  4MZF B;  1HWP B;  2YUG A;  5C3D A;  4G87 A;  3BAQ A;  3FFZ A;  3V90 A;  2QGI A;  4D11 A;  4ECM A;  3B9U A;  2WBC A;  3FJJ A;  3D98 A;  4J23 B;  3BAD A;  3HSM A;  3USQ A;  3I0C A;  3SX7 A;  3FJI A;  1HWN B;  4CJC A;  4G3Q A;  3RSJ A;  3BCV A;  4UEG A;  3N7K A;  1VGU A;  2VXL A;  4G3S A;  4FRO A;  3D5N A;  4IY8 A;  2FFU A;  1LZJ A;  3W9T A;  3ZF8 A;  4DDZ A;  1I1B A;  4OWJ A;  4ION A;  1MC3 A;  3RMX A;  1XG6 A;  3OKR A;  4EVW A;  5FTV A;  3CA1 A;  3E8L C;  1H4C A;  3QYD A;  3I0I X;  3OAM A;  4FRB A;  1BFB A;  4M28 A;  1JT3 A;  1YTO A;  3A07 A;  4II0 A;  1G9D A;  4B4G A;  4AAW A;  3OH0 A;  2RJ8 A;  3ZLK A;  4D0T A;  4QBC A;  1H5S B;  3AH4 A;  4HO8 A;  4Y7U A;  2IHO A;  4I6I A;  4B5B A;  1DFC A;  2RJ6 A;  4D0Z A;  5JQQ A;  1S0G A;  2HWM A;  4KPX A;  1Z2V A;  2Y7A A;  3IM5 A;  1W55 A;  1BA7 A;  1PZZ A;  4KEI A;  3TC2 A;  3IM6 A;  2OI6 A;  3BAO A;  2OI7 A;  5AJP A;  1F31 A;  2NXV A;  4ZFU B;  1ZJ1 A;  1AF9 A;  3IOI A;  4Y63 A;  4H04 A;  1IRP A;  3I0L A;  5C36 A;  4FCE A;  2RJ1 A;  1BFC A;  1DJS B;  1EPW A;  3PUB A;  1H4D A;  1R7T A;  3EE5 A;  3R3I A;  1MC9 A;  4A7Y A;  4Y7G A;  3U2X A;  1AVW B;  2VSE A;  1H3M A;  1H5R B;  4J2K A;  1V6V A;  4I3N A;  1L2H A;  3UDA A;  3N7L A;  2MIB A;  3HOM A;  3VT2 A;  2QKX A;  3Q7U A;  4B2W A;  4OEF A;  1ISV A;  3V0A A;  3RMW A;  3WO3 A;  1S4N A;  2VS3 A;  3BRD A;  5L6V A;  3R4U A;  1R7X A;  1CE7 B;  3UD7 A;  1JVG A;  4OEG A;  3BX1 C;  3SXD A;  1EYR A;  1K4V A;  2K43 A;  1NWG B;  1VPA A;  3AH1 A;  4I4R A;  2J0A A;  1S0E A;  2YCM A;  4HO6 A;  5F90 A;  1ISX A;  2ESU A;  1RG8 A;  4HR6 C;  1G8O A;  4HO9 A;  1YYN A;  3UJ4 A;  2P39 A;  4IYB A;  3ILA A;  3JUT A;  4I4P A;  3I2X A;  5EG6 C;  3AKH A;  5BXT A;  1DIW A;  4OWL A;  4G1R A;  3E25 A;  3OH2 A;  5C4B A;  1YP2 A;  1G9C A;  3BRF A;  2YC3 A;  2PA4 A;  2XWM A;  4GP3 A;  5BXS A;  4G3P A;  1FXJ A;  1IHK A;  2XME A;  4EEE B;  3CKO A;  1FZW A;  4BQH A;  4LO2 C;  3I0K A;  2V0H A;  1AXM A;  4ZGR B;  3RMV A;  2ZQO A;  1ONK B;  2FYA A;  1S0C A;  4ASY A;  5C48 A;  2FDB M;  2Q3N B;  4AYL A;  5CQN X;  4E1K A;  1ITB A;  4IHZ A;  5EHA A;  1LZ7 A;  1G93 A;  2YQH A;  3U2U A;  5AJO A;  1K5V A;  3NBN A;  3VT1 A;  1ZJ3 A;  1GWV A;  1T9F A;  3HAL A;  1G9B A; 
#chains in the Genus database with same CATH homology
 3SXB A;  5HPZ A;  4L41 C;  1MP3 A;  2MC2 A;  1LZ0 A;  2K4A B;  3VWC A;  2UUS A;  1BLD A;  3NGW A;  5C8R A;  3I0G A;  4FRM A;  1IOB A;  2O1F A;  2M49 A;  4FRE A;  1JYL A;  3BA7 A;  2JCO A;  2YES A;  4LO2 A;  4GBP A;  5C1H A;  4EEO A;  4KBB A;  5B2H A;  3OGF A;  1V84 A;  4EFR A;  31BI A;  1ZDG A;  1XYF A;  2RJ7 A;  3PKP A;  4ZOT A;  1WBC A;  2VU9 A;  4CJ8 A;  3OJM A;  1QQL A;  4ZBV B;  3ZC9 A;  1WT1 A;  2W0W A;  4LO7 C;  4EEA A;  5BP5 C;  3OH1 A;  2YQC A;  3FJB A;  1G1L A;  3I0D A;  4J2S A;  4LO1 C;  2AXM A;  3P6J A;  1VZU A;  4KRV A;  5FV9 A;  4ISR A;  1W3A A;  1VGT A;  3CU1 B;  3RTI B;  4XKI A;  1FR8 A;  2P23 A;  2YQS A;  3V0B A;  3DUV A;  4JKQ A;  5E24 E;  2D22 A;  5DZU A;  2MZB A;  5CMF X;  2D7I A;  1QGS A;  1S0D A;  1PWA A;  3ST8 A;  3HN1 A;  1G95 A;  1FWV A;  1H4E A;  4FIX A;  4MIX A;  3EF2 A;  5FNX A;  3OH3 A;  4FCU A;  3IM7 A;  5C4D A;  2L5X A;  2BEA A;  3BTA A;  1ZJO A;  3FOQ A;  1NUN A;  4O6M A;  5BP5 A;  4USP A;  4I1E A;  1FRW A;  1NMM B;  2ICY A;  3OH4 A;  3FGM A;  4LO1 A;  3KIA A;  4FIY A;  1UPS A;  2VD4 A;  4NAN A;  4C2S A;  1TWE A;  3K1X A;  1R81 A;  2ZU7 A;  3F62 B;  5CQL X;  1ILR 1;  3FWW A;  4CJB A;  5EIY A;  5FZY A;  1O7O A;  2UX8 A;  5DDV A;  1PZT A;  2WGZ A;  1AVA C;  1I1E A;  4NAI A;  4GOV A;  1BFF A;  1ZI5 A;  1ABR B;  2BFH A;  1A8D A;  1DFQ A;  3V79 C;  4I37 A;  4QO3 A;  4HO3 A;  3AZW A;  1ISW A;  1JY0 A;  3ZX7 A;  1INI A;  1NHE B;  1ZCU A;  1QQK A;  3NBD A;  3WO2 A;  4IZX A;  5IDT A;  4OW4 A;  1JT4 A;  1Q04 A;  4I4V A;  1XHB A;  1K5U A;  1II4 A;  1OMZ A;  4Y7T A;  1DQG A;  3U0Y A;  4JKX B;  1G97 A;  3H6Q A;  5IDS A;  4LO3 A;  2E4M C;  1H5S C;  4LW6 A;  4HCQ A;  3C9Z A;  2OEG A;  5C47 A;  2K8R A;  5CMH A;  2RIT A;  2HW9 A;  1ZDF A;  2VXR A;  1TVY A;  2WVM A;  3Q7Y A;  1V82 A;  5CQP A;  3V0L A;  3VT0 A;  5C38 A;  2Y6P A;  5J49 A;  1ISZ A;  4I8M A;  2RJ5 A;  5C1G A;  3SX5 A;  4L4H A;  4ZLB B;  1ON6 A;  1MP4 A;  2O1G A;  1TZF A;  5JLV A;  5FUH A;  4M2A A;  4LO0 C;  3BA5 A;  4OEE A;  4AYJ A;  1ZJ0 A;  3Q80 A;  3FJ8 A;  5CQO A;  5D91 A;  3V8Y A;  1IRA X;  3Q4S A;  4L4I A;  3VEQ A;  1H7L A;  3CRH A;  5BOW A;  4Y6N A;  4JIS A;  4IRQ A;  2NS2 A;  1FV2 A;  1H5S A;  2E4M A;  1FOA A;  1HM0 A;  3V0P A;  5EC5 A;  2P72 A;  1EV2 A;  1HCD A;  3PME A;  3JTJ A;  3PKQ A;  1HJJ A;  1Z4S A;  5BQU C;  2DRZ A;  3PHZ A;  3F1C A;  3ZC8 A;  3BAH A;  2AAI B;  4QKR A;  4P6A A;  3BB2 A;  3ZXG A;  1YF8 B;  1JTC A;  5FZU A;  4LO0 A;  2FYC B;  1FV3 A;  3GUE A;  1FWU A;  3R4S A;  3BAG A;  1IJT A;  1FN0 A;  4Z9W B;  3F1Y A;  2D0J A;  2J3P A;  1TW5 A;  3I0H A;  1H5R A;  1LZI A;  3IOH A;  4H9W A;  3O4D A;  4NAL A;  4ZA3 B;  1NKH B;  3BRK X;  1YP3 A;  5F8W A;  1VCL A;  3I29 B;  1M2T B;  1VIC A;  2RJ4 A;  4WBC A;  5FYE A;  1WT3 A;  3OGZ A;  5BQU A;  2CU2 A;  4J18 A;  5C4C A;  2Y9G A;  4KEJ A;  4KPZ A;  5AJN A;  3SX3 A;  5BXP A;  1YP4 A;  7I1B A;  1OMX A;  1FGG A;  4KC2 A;  3A21 A;  3F1R A;  1BFG A;  3T8S A;  4HO5 A;  3FJK A;  1VGZ A;  2ET2 A;  3IIR A;  4Q9P A;  3ZXD A;  1Z0H A;  1OQL B;  1PC8 B;  2VSA A;  2F8X C;  1H7F A;  1R8O A;  4QKS A;  1XZ6 A;  4KNR A;  5FU8 A;  4EEM A;  4MYB A;  4B2X A;  2O1H A;  4I4X A;  3SXE A;  1ZIZ A;  4HJJ A;  2D7R A;  3DJ4 A;  3FJF A;  4I4O A;  4AN6 A;  1ZI1 A;  4A7K A;  4KXO A;  3O4A A;  4ZFW B;  2MLL B;  4OUJ A;  2Y4M A;  4R7P A;  3T7N A;  5FTS A;  2AM4 A;  2HZ9 A;  4KQL A;  1V6X A;  3MAL A;  5BXR A;  3CRI A;  3SXG A;  1NQI B;  1TFM B;  1DQO A;  1NZK A;  1G2V A;  1IIL A;  1R8N A;  2RJ0 A;  1ZCV A;  4KT7 A;  2KH2 A;  2Y4K A;  4XFU A;  3CA6 A;  3QR5 A;  3JUK A;  1JLY A;  2KI6 B;  1R80 A;  3PG0 A;  1IT0 A;  1OQM B;  2WVL A;  2KI4 A;  2C0N A;  2VS5 A;  2XWL A;  4B42 A;  3V0B B;  4HOC A;  3O4C A;  1JLX A;  3I0F A;  3AJ6 A;  1R82 A;  1AFC A;  4I1B A;  1WSZ A;  2X5Z A;  2RST A;  21BI A;  2Y9F A;  3SX8 A;  4FGF A;  2XMH A;  2I7B A;  2OI5 A;  3UJ0 A;  4H75 A;  3NBC A;  2IWT B;  4B4B A;  2BEB A;  5D63 A;  1VH3 A;  2NM1 A;  1KWS A;  3FJC A;  3V0M A;  3AKF A;  2QH5 A;  5CMG X;  4END A;  3HMY A;  4G9N A;  1FGX A;  1GX0 A;  4JD0 A;  2APC A;  4EB2 B;  1YXW A;  4Q9G A;  8I1B A;  3JRR A;  1TW1 A;  1Z90 A;  4IZE A;  2GGQ A;  4EE3 A;  1TOO A;  2NYY A;  1MP5 A;  1N4K A;  4I7I A;  1AVU A;  2Z86 A;  1LL0 A;  3N0K A;  3O44 A;  1G0R A;  1WD4 A;  2KKI A;  4YS8 A;  3U2W A;  4QD2 B;  2GZB A;  1R7Y A;  1ZI4 A;  4XFT A;  2Y4L A;  4I0Y A;  3HBW A;  2X65 A;  1GQ9 A;  4BMA A;  3H6S E;  3O49 A;  4GOY A;  4PC4 A;  3CKQ A;  2I5K A;  4F83 A;  1HCE A;  4KNX A;  4LW3 A;  5EJZ A;  2X60 A;  1ISY A;  2ERM A;  2HWA A;  2WVK A;  5C3B A;  3OJ2 A;  1H5T A;  3CU0 A;  4J2X A;  4MND A;  1CVS A;  2WAW A;  4GAI A;  4JQ0 A;  4O6N A;  4ZKT B;  3LW6 A;  5F8Y A;  2VSI A;  5C49 A;  3VSZ A;  2XOA A;  2VXT I;  1V6U A;  3N7J A;  4GP0 A;  1BAR A;  4M4K A;  3LTQ A;  2AEC A;  3R2W A;  4Q7C A;  4EE4 A;  1VGW A;  3CRG A;  1WT2 A;  3I0E A;  4JPZ A;  3O4O A;  1ZCY A;  1PUM B;  3NJ5 A;  2FYB A;  1M16 A;  3QVB A;  2VLC A;  1EVT A;  4EFP A;  4GAF A;  4D11 C;  3CA4 A;  1G3L A;  1VM8 A;  5DVH A;  2VSH A;  1JYK A;  3IOJ A;  2VS4 A;  4P0J A;  2WRY A;  3MPP G;  3H6R B;  1VZX A;  3K8E A;  5C4E A;  2BO6 A;  1SR4 C;  1LL3 A;  5C1L A;  4I2S A;  1H7G A;  2DS0 A;  1Q03 A;  4X3A A;  5FNW A;  3RMY A;  4DCK C;  1G23 A;  1SZ6 B;  2WE9 A;  3FUO A;  3CKJ A;  1GWW A;  4Y64 A;  2Q9X A;  4JRA A;  3Q7W A;  2VXM A;  1FXO A;  2VUA A;  1W3G A;  3NBE A;  5DUY A;  1ZJ2 A;  2AE7 A;  2Y9X E;  4HG6 A;  3T7O A;  3V0Q A;  5DDT A;  2GO2 A;  3N7M A;  2F2F C;  4Y7F A;  3I0J A;  2Z48 A;  4HO0 A;  3BRG C;  2X2T A;  2V0L A;  5FU0 A;  4B3U A;  2DRE A;  1HWO B;  3AJ5 A;  1H7H A;  2BO4 A;  2VFZ A;  2WEE A;  4NAK A;  4I4Q A;  1QG8 A;  5CQM X;  1SR4 A;  4HA2 A;  1BAS A;  3O4B A;  1JV3 A;  1LL2 A;  4I4S A;  4XFS A;  4P02 A;  3POL A;  4TLP A;  3P6I A;  2V0K A;  1TIE A;  1YRO B;  2AM3 A;  4EFQ A;  2D1Z A;  1H7Q A;  3LLP A;  1DZD A;  2QN4 A;  2JCJ A;  3V0N A;  4B4M A;  2RJ9 A;  3A22 A;  1J0S A;  2JCL A;  1QWJ A;  3CGX A;  2OEF A;  3PNN A;  1VH1 A;  4HO4 A;  3POK A;  2FGF A;  2F2F A;  2P6W A;  3N9W A;  4LO8 B;  5GAQ A;  4K6R A;  4IQP A;  4FQW A;  4QAL A;  3RSB A;  3TZT A;  3AKI A;  2I1B A;  3BAV A;  9ILB A;  4F34 A;  4DEN A;  3VUO A;  3ZLL A;  1S0B A;  1G9A A;  1PZY B;  2D23 A;  1FR9 A;  3E26 A;  1FMM S;  2NVH A;  4FRP A;  4G9M A;  3JUJ A;  4IRP A;  2AM5 A;  5D92 A;  4D48 A;  4MZG B;  4X39 A;  3WMV A;  1XZZ A;  4D8H A;  3S8K A;  3FJA A;  3FJ9 A;  4DEP A;  2FO1 A;  1O0R A;  1BLA A;  2I5E A;  2RIX A;  2V0J A;  4Y9X A;  2Y9W C;  4USO A;  4FRA A;  5F8S A;  1MD6 A;  1TWM A;  4I96 A;  4ZFY B;  2NP0 A;  1EZI A;  2ZU9 A;  4UY4 A;  2KLL A;  5I1F A;  3D8V A;  1RZO B;  2AFG A;  4JAW A;  5L6S A;  1JT7 A;  1WVC A;  2NZ9 A;  2AGD A;  2BO7 A;  1FWY A;  1FMZ A;  5CMJ A;  4P0L A;  1FO8 A;  1S0F A;  2YC5 A;  1FO9 A;  3V0A B;  4XWI A;  3SNV A;  1HM9 A;  3V0O A;  1IIM A;  4FRQ A;  3CQA A;  3V8Z A;  5HS2 A;  1O23 B;  3I2A A;  4G6M A;  2X2S A;  3CA0 A;  1T4Q A;  3BAU A;  3FUQ A;  4QC4 A;  4QBV A;  3K8D A;  3CA3 A;  4OWK A;  3WIN C;  3CAH A;  4KC3 A;  3IAG C;  1PUU B;  3OBR A;  3WO4 A;  4EKX B;  4FRD A;  2E3D A;  4ARW A;  4X37 A;  1GA8 A;  1ZHJ A;  1RML A;  3S8J A;  2XWN A;  3FJD A;  2V0I A;  2X5S A;  4MZH A;  5G00 A;  3WA1 A;  1DZC A;  1H7E A;  3HL3 A;  3ZGF A;  4A7Z A;  2LIE A;  2D43 A;  3Q7X A;  4QD2 C;  1HIB A;  5CMI A;  3UD8 A;  5C3A A;  2JCK A;  3T7M A;  3AKG A;  3KMV A;  4P0K A;  1AVX B;  4YOL A;  1H7T A;  5IFY A;  3SXA A;  1KNM A;  3OBT A;  3CA5 A;  2AH9 A;  5I1B A;  2RIZ A;  2R9K B;  5DSS B;  4FVV A;  2ICX A;  1JV1 A;  3USR A;  1FGA A;  1O7Q A;  3TQD A;  4ASJ A;  3O5W B;  5FZZ A;  3WIN A;  4ISQ A;  2DPW A;  3ZGG A;  4DE7 A;  4KC4 A;  1W3F A;  2GGO A;  4Y7V A;  4Q91 A;  1E5K A;  1LVW A;  2QYI B;  1D0H A;  1DLL A;  4KEK A;  2Q4J A;  2RIY A;  4G6J A;  3U2V A;  1YBI A;  4KC1 A;  1TTU A;  2FYD B;  2D20 A;  1JVD A;  1NF5 B;  4I4Y A;  3SXC A;  1QXM A;  3A23 A;  5D61 A;  2A8W A;  2E8B A;  3UD9 A;  4M2B A;  3AH2 A;  4DEC A;  4Y6U A;  1ZCT A;  4AN7 B;  2P73 A;  2Z49 A;  5EJ1 A;  5JMC A;  2Z87 A;  2RQ9 A;  2VK9 A;  2LIQ A;  4EE5 A;  4FRL A;  2PGY A;  1EYL A;  4Z8S B;  3FJH A;  1R7V A;  1HWM B;  2Y4J A;  3RTJ B;  1Q1U A;  1HM8 A;  4IY9 A;  1W57 A;  2PGV A;  2D24 A;  3FJE A;  4CJM A;  1HV9 A;  2A8U A;  2AES A;  4EEG A;  4R6U B;  4AC3 A;  5C4F A;  2BO8 A;  4I4U A;  5BVP I;  3OJV A;  2ZU8 A;  1GQC A;  1WD3 A;  4JP0 A;  1FG5 N;  1ZJP A;  3CKV A;  4X38 A;  3O3Q A;  6I1B A;  1HKN A;  1S0L A;  2ZR1 B;  1QGQ A;  2AQZ A;  1S4P A;  4ZDQ A;  3O3P A;  1V83 A;  1SS9 A;  2NTD A;  4CVH A;  4J2Y A;  1R7U A;  1I52 A;  3SPT A;  1VZT A;  2ZQN A;  3CKN A;  1V6W A;  3P53 A;  2FY7 A;  1W77 A;  3V91 A;  4LO7 B;  4HO2 A;  1G9R A;  1WBA A;  3H6R A;  3WMU A;  1IIN A;  2D44 A;  4LO3 C;  3DK5 A;  1JQZ A;  3OGG A;  1G82 A;  1H5T B;  3AZV A;  1HJL A;  1GX4 A;  1RY7 A;  1S4O A;  3U2T A;  1GGP B;  2PX7 A;  4Y62 A;  1INJ A;  1FQ9 A;  2YQJ A;  1E0O A;  2FFV A;  3D7W B;  3OC9 A;  1ON8 A;  4FRH A;  3BA4 A;  1TP0 A;  1P63 A;  5BXC A;  1ZI3 A;  3VSF A;  4P00 A;  3U0X A;  1H5S D;  5D62 A;  2RG9 B;  1JT5 A;  41BI A;  2J0B A;  2DRY A;  2W0V A;  1WT0 A;  4MZF B;  1HWP B;  2YUG A;  5C3D A;  4G87 A;  3BAQ A;  3FFZ A;  3V90 A;  2QGI A;  4D11 A;  4ECM A;  3B9U A;  2WBC A;  3FJJ A;  3D98 A;  4J23 B;  3BAD A;  3HSM A;  3USQ A;  3I0C A;  3SX7 A;  3FJI A;  1HWN B;  4CJC A;  4G3Q A;  3RSJ A;  3BCV A;  4UEG A;  3N7K A;  1VGU A;  2VXL A;  4G3S A;  4FRO A;  3D5N A;  4IY8 A;  2FFU A;  1LZJ A;  3W9T A;  3ZF8 A;  4DDZ A;  1I1B A;  4OWJ A;  4ION A;  1MC3 A;  3RMX A;  1XG6 A;  3OKR A;  4EVW A;  5FTV A;  3CA1 A;  3E8L C;  1H4C A;  3QYD A;  3I0I X;  3OAM A;  4FRB A;  1BFB A;  4M28 A;  1JT3 A;  1YTO A;  3A07 A;  4II0 A;  1G9D A;  4B4G A;  4AAW A;  3OH0 A;  2RJ8 A;  3ZLK A;  4D0T A;  4QBC A;  1H5S B;  3AH4 A;  4HO8 A;  4Y7U A;  2IHO A;  4I6I A;  4B5B A;  1DFC A;  2RJ6 A;  4D0Z A;  5JQQ A;  1S0G A;  2HWM A;  4KPX A;  1Z2V A;  2Y7A A;  3IM5 A;  1W55 A;  1BA7 A;  1PZZ A;  4KEI A;  3TC2 A;  3IM6 A;  2OI6 A;  3BAO A;  2OI7 A;  5AJP A;  1F31 A;  2NXV A;  4ZFU B;  1ZJ1 A;  1AF9 A;  3IOI A;  4Y63 A;  4H04 A;  1IRP A;  3I0L A;  5C36 A;  4FCE A;  2RJ1 A;  1BFC A;  1DJS B;  1EPW A;  3PUB A;  1H4D A;  1R7T A;  3EE5 A;  3R3I A;  1MC9 A;  4A7Y A;  4Y7G A;  3U2X A;  1AVW B;  2VSE A;  1H3M A;  1H5R B;  4J2K A;  1V6V A;  4I3N A;  1L2H A;  3UDA A;  3N7L A;  2MIB A;  3HOM A;  3VT2 A;  2QKX A;  3Q7U A;  4B2W A;  4OEF A;  1ISV A;  3V0A A;  3RMW A;  3WO3 A;  1S4N A;  2VS3 A;  3BRD A;  5L6V A;  3R4U A;  1R7X A;  1CE7 B;  3UD7 A;  1JVG A;  4OEG A;  3BX1 C;  3SXD A;  1EYR A;  1K4V A;  2K43 A;  1NWG B;  1VPA A;  3AH1 A;  4I4R A;  2J0A A;  1S0E A;  2YCM A;  4HO6 A;  5F90 A;  1ISX A;  2ESU A;  1RG8 A;  4HR6 C;  1G8O A;  4HO9 A;  1YYN A;  3UJ4 A;  2P39 A;  4IYB A;  3ILA A;  3JUT A;  4I4P A;  3I2X A;  5EG6 C;  3AKH A;  5BXT A;  1DIW A;  4OWL A;  4G1R A;  3E25 A;  3OH2 A;  5C4B A;  1YP2 A;  1G9C A;  3BRF A;  2YC3 A;  2PA4 A;  2XWM A;  4GP3 A;  5BXS A;  4G3P A;  1FXJ A;  1IHK A;  2XME A;  4EEE B;  3CKO A;  1FZW A;  4BQH A;  4LO2 C;  3I0K A;  2V0H A;  1AXM A;  4ZGR B;  3RMV A;  2ZQO A;  1ONK B;  2FYA A;  1S0C A;  4ASY A;  5C48 A;  2FDB M;  2Q3N B;  4AYL A;  5CQN X;  4E1K A;  1ITB A;  4IHZ A;  5EHA A;  1LZ7 A;  1G93 A;  2YQH A;  3U2U A;  5AJO A;  1K5V A;  3NBN A;  3VT1 A;  1ZJ3 A;  1GWV A;  1T9F A;  3HAL A;  1G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...