2FFUA

Crystal structure of human ppgalnact-2 complexed with udp and ea2
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
494
structure length
494
Chain Sequence
KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 2
publication title Dynamic Association between the Catalytic and Lectin Domains of Human UDP-GalNAc:Polypeptide {alpha}-N-Acetylgalactosaminyltransferase-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 171
structure length 494
sequence length 494
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ffuA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2ffuA01
2GGOA 4EFRA 4CJCA 4ISRA 4KEKA 3HL3A 2KKIA 1ZI3A 1I1BA 2GGQA 2BFHA 4QC4A 4B4GA 1PZYB 1VGUA 1SZ6B 4Y7FA 2YCMA 2RJ8A 1FOAA 1H4EA 4USPA 1IHKA 2D7RA 1AXMA 4LO0A 2K43A 3CA4A 3O4BA 1G2VA 1H7EA 1ZJ2A 2I5EA 3PKPA 3ZC9A 1WT1A 2E3DA 3PHZA 2V0JA 1XZZA 3V0MA 4X39A 1JVDA 3UJ4A 5AJOA 1ABRB 1JTCA 5FUHA 4ASJA 4Q91A 1J0SA 3VT2A 3R3IA 3N0KA 3DK5A 3U0XA 5G00A 1HCDA 1H7HA 1OMXA 2OI7A 2X5SA 1ZDGA 3OH2A 3SX7A 3OC9A 4FREA 4CJ8A 3OGZA 3MPPG 3D5NA 3I0EA 4Y6NA 4HO3A 2Z48A 4LW6A 4OWKA 2E4MC 4Y7TA 3R4SA 1T9FA 3BB2A 3FOQA 4BQHA 1G9AA 1FWYA 3ILAA 2HWMA 3ZLLA 3ZXGA 1FR9A 3CRHA 4A7YA 2AECA 3N7LA 3I0JA 2WBCA 3I0IX 4Z8SB 4FROA 3T7OA 4F34A 1FO9A 3TQDA 4I4YA 2Q4JA 3IOJA 3P53A 2JCLA 2NVHA 5CMJA 3U2UA 1R7UA 3V0LA 1ILR1 4KC4A 5CQNX 3TZTA 5C3AA 1PUMB 3TC2A 1O23B 3BCVA 3R2WA 3BA4A 1S0DA 4FRQA 4P00A 5AJPA 1TW1A 4B4BA 3V90A 3O4DA 1GQ9A 4ZLBB 5BXTA 1ZI5A 2NYYA 1HCEA 3IOIA 3F62B 4EEGA 2AXMA 4EEMA 2QKXA 4B2WA 5C4BA 3VUOA 1FR8A 1G9DA 2JCKA 3V0NA 1FWUA 2LIEA 1H7FA 1ZJ3A 3D7WB 3ZF8A 2D1ZA 3VSFA 3PNNA 2FO1A 1H5SD 4H9WA 2R9KB 2Y7AA 2HZ9A 3WINC 1DZDA 4HO8A 4GAIA 1JLYA 1E5KA 2YC5A 1BFBA 2VXTI 1YROB 2RJ0A 1AVAC 1VM8A 2V0KA 4LO3C 1H5TA 2XWMA 3IOHA 3JTJA 3ZGGA 4B4MA 3BA7A 1HM8A 2WAWA 3BAGA 3E26A 5CMFX 1XHBA 2Z87A 2RJ5A 4I4VA 3FUQA 5F8YA 1NMMB 2Y4MA 1NQIB 3D98A 3SXBA 4ASYA 3IM5A 4UEGA 1TOOA 3SNVA 31BIA 1FRWA 3H6RB 1H7LA 1TZFA 3JUJA 4KT7A 4I8MA 5C48A 3VT1A 3CRIA 3IM6A 1S0LA 5HPZA 3Q7WA 2D0JA 3NBEA 2Y9FA 3BA5A 1R80A 3KIAA 2WRYA 1GA8A 1TWEA 3FJDA 3OH1A 2GO2A 3USQA 4D8HA 4C2SA 1YP3A 1FGXA 1JYKA 1TFMB 3NBDA 4NAIA 4A7KA 1WBCA 1H4CA 4OWLA 3AZWA 4I2SA 4LO0C 2YC3A 3POLA 4XFUA 1ZJ1A 4I4QA 3CKNA 5DZUA 4LO7C 5C49A 1H7GA 1YYNA 2WEEA 1JYLA 1H7QA 3OAMA 2AM3A 3K1XA 3USRA 1ZJ0A 3SX3A 1HM0A 1EZIA 4KXOA 5L6SA 1H4DA 1ZHJA 1ZCYA 2Y4LA 1LZJA 4Y7UA 4NAKA 2QYIB 4IQPA 2Z86A 1PWAA 2KLLA 4G6MA 4HO5A 1S0FA 1Q04A 2IWTB 1UPSA 3FJCA 1INJA 4NALA 5C1HA 1V6XA 4OW4A 1AVWB 2LIQA 5CQLX 1PUUB 4J2YA 4LO7B 1G9BA 1JV1A 1VZTA 2VSIA 4B2XA 1O0RA 1H5RB 1OQLB 2ZQOA 1S4OA 1VZUA 4AYJA 1G23A 2VLCA 3N9WA 4EKXB 4KNXA 2D44A 1V83A 4M28A 2RG9B 4LO1C 2JCOA 3ZXDA 5BOWA 1DQGA 4ZFWB 4G6JA 1GWWA 1GWVA 3CKJA 4G3QA 2MIBA 4KNRA 3ZLKA 1IIMA 1II4A 1ZJOA 2UX8A 1DIWA 1R7XA 2HW9A 3FJ8A 1G9CA 4FRAA 1W57A 1PZTA 2RJ6A 3RSJA 3CQAA 3SXEA 4KEJA 3NBCA 2WE9A 3SX5A 3V0AA 3F1RA 3Q80A 4FRBA 1ON6A 5AJNA 5EC5A 4D11A 1VCLA 4XKIA 4L41C 4I37A 1H7TA 4P0KA 1VICA 4AN7B 3OJMA 3ST8A 2P23A 3I0GA 1LVWA 5J49A 2Y4KA 4J18A 3V91A 4GAFA 4J2KA 4OWJA 1G8OA 4I4UA 1HM9A 2RJ4A 3K8DA 5L6VA 1VH1A 3QYDA 5GAQA 3BRGC 4JPZA 4FRMA 5C47A 1EV2A 3CA3A 4KBBA 2BO7A 3I0FA 3RMWA 1S0GA 1Z90A 2YESA 1FN0A 3AKFA 4X37A 4XFSA 4K6RA 3I0CA 5C4CA 4NANA 1E0OA 2Q9XA 4YOLA 1FXJA 1R8NA 5DUYA 2E8BA 2QH5A 1YBIA 4DCKC 5BXPA 5CMGX 1JY0A 1YXWA 5EHAA 4Q9GA 4USOA 3IM7A 1IJTA 1MC3A 3RMVA 3V0OA 3O4AA 1HWMB 2FFVA 1I52A 2X2TA 3CGXA 4FCUA 1M2TB 1H5SB 4JAWA 4D0ZA 1EVTA 2O1HA 4HJJA 1JT4A 5BP5A 5BVPI 3KMVA 2OEGA 3Q7YA 5IDTA 2O1GA 1FMZA 1CVSA 2VUAA 1GX4A 2ICYA 2AESA 4I7IA 2XOAA 3SXGA 4WBCA 2ERMA 3Q7XA 2VXMA 2W0WA 4H04A 1ISZA 4JQ0A 2ZU7A 4GP3A 2FYCB 2Y6PA 3DJ4A 2F8XC 1W77A 4EEOA 4EE5A 1AVUA 2XMHA 4G87A 4Y9XA 1BFGA 2D20A 4OEFA 2PA4A 4L4HA 1V82A 3OJVA 3NBNA 1W55A 2CU2A 3RMYA 3SXDA 1INIA 1QQKA 1ZI4A 3FJKA 2ZQNA 3T8SA 1G1LA 1Z4SA 2O1FA 3CKOA 2DREA 5CMHA 2RJ9A 4EE4A 1ISWA 1VGTA 5F8SA 2P72A 2AM5A 3ZGFA 3T7NA 4AAWA 2WVLA 3H6SE 1FQ9A 3S8KA 3FJ9A 5FYEA 1PZZA 4I96A 4G3PA 5HS2A 3PG0A 4KC2A 2HWAA 2PGVA 2BO4A 1ITBA 3OJ2A 1RY7A 5I1BA 2D43A 2YQCA 3V0BA 1QXMA 1ISVA 4XWIA 1SR4A 1CE7B 2D22A 4GOVA 4HA2A 3GUEA 3AH1A 1XG6A 1S4PA 4CJBA 3HN1A 1HJLA 4QKRA 3V8ZA 3BTAA 4ZBVB 4BMAA 4GP0A 2W0VA 4X3AA 3C9ZA 4MNDA 4MYBA 4D11C 2BO6A 4HR6C 1V6WA 5FNXA 4EFPA 3BRDA 1V6VA 1MP5A 3DUVA 1AF9A 3FGMA 3HMYA 1O7OA 3QVBA 4IRQA 5FU8A 3OH0A 3CA5A 4B3UA 3AKHA 4ISQA 4II0A 3A07A 4J2XA 2Y9GA 1LZ0A 2BO8A 1Q1UA 2PGYA 1LZ7A 3QR5A 3CKQA 3I0HA 3SXCA 1EPWA 1W3FA 4OEGA 4F83A 2JCJA 1ONKB 3UJ0A 5EJ1A 3A22A 1PC8B 2XWNA 3AJ6A 1F31A 5JQQA 2BEBA 4KPZA 3CU1B 1ISXA 4A7ZA 2Q3NB 1S0EA 4ZA3B 2AQZA 5C4EA 1G9RA 3I2AA 2DS0A 2MZBA 3RTIB 5DDVA 1FGGA 2FYAA 3V0QA 1OMZA 4EEAA 5C4DA 2KI6B 1XYFA 4FGFA 1ZCVA 4DENA 4Y7VA 3CRGA 3OBTA 4ZGRB 1I1EA 1IRAX 1JQZA 1O7QA 4QO3A 4P6AA 1HWOB 2DRYA 3FWWA 3U2WA 7I1BA 5FZZA 1NHEB 5C3BA 2KH2A 1FGAA 1S0CA 4OEEA 4GBPA 1FMMS 3N7JA 4KEIA 4DEPA 2ZU9A 4Y64A 5C8RA 5JMCA 4HCQA 3RSBA 1K5VA 4FRHA 4Y62A 1BLAA 4Y7GA 4I0YA 1R7VA 1R82A 3OKRA 1AVXB 1Z0HA 2YQJA 3BAQA 5CMIA 1M16A 1N4KA 3ZC8A 2Y9WC 3CA1A 3CAHA 3NGWA 4B42A 2NZ9A 1JLXA 1EYLA 2K8RA 4M2AA 3FJIA 5C1GA 1H3MA 2UUSA 3FJAA 1BLDA 1ZDFA 3F1CA 3BADA 1SR4C 4XFTA 3PUBA 1KNMA 2A8WA 3FJEA 1EYRA 4ARWA 4IRPA 1W3GA 5FV9A 2FFUA 2DPWA 2E4MA 2F2FA 4I4OA 1IILA 1FV3A 3VSZA 1V84A 4FRLA 4CJMA 4D48A 1BASA 1HJJA 1K5UA 4P0LA 4I1BA 3OH3A 4JISA 2Y4JA 5FTVA 4ZDQA 3CU0A 5EG6C 4I1EA 5FZYA 2D24A 2KI4A 2AH9A 3POKA 2X60A 4IONA 1KWSA 5D63A 3MALA 5D61A 1G3LA 2RIXA 2X65A 4HO6A 4JD0A 4L4IA 2Y9XE 1RMLA 3OGGA 3CA0A 2BEAA 1IRPA 1TVYA 4Y63A 1A8DA 4KC3A 3VEQA 1G93A 2RIZA 3O3PA 3N7MA 4QALA 5JLVA 1FXOA 1H5TB 4I4PA 5BQUA 2FGFA 4G1RA 3A21A 4LO8B 2VS5A 3VT0A 4AYLA 5IFYA 1QG8A 1WT2A 3O4OA 2AFGA 5DVHA 3WINA 3I0KA 3LW6A 2FY7A 2VS3A 3H6RA 3O44A 3FJBA 4LO3A 4B5BA 3BAUA 1GQCA 3WO4A 5C1LA 4CVHA 5E24E 3JUTA 3RTJB 1NKHB 3EE5A 3U2XA 1TP0A 4G9NA 3PKQA 4QBVA 4KPXA 4P02A 3HALA 2RJ7A 1DLLA 1LL0A 1LL2A 3CKVA 3HOMA 5FTSA 3U2VA 3SPTA 4J2SA 3BRKX 4FCEA 1S0BA 4X38A 1S4NA 1JT5A 1YTOA 1IT0A 4KRVA 1Q03A 3NJ5A 41BIA 3R4UA 2ESUA 1R7YA 1BFCA 2J3PA 5IDSA 4J23B 1V6UA 1WSZA 3IAGC 1GX0A 1BFFA 4HO9A 5B2HA 1MC9A 1IOBA 3P6IA 4IY8A 3FFZA 1H5RA 3I0DA 1Z2VA 4I4SA 4HO4A 1WVCA 3UDAA 3JUKA 4KQLA 3E8LC 3RMXA 1NF5B 5CQMX 3AZVA 2FYDB 2VSHA 3FJJA 1DZCA 3D8VA 3BX1C 1JVGA 1VPAA 4YS8A 1T4QA 4TLPA 4KC1A 5DDTA 1WBAA 2F2FC 4Z9WB 2AGDA 3N7KA 2ZU8A 1G97A 1ZCTA 3U2TA 2RJ1A 5CQOA 3OH4A 1OQMB 2YQSA 3FJHA 3B9UA 4LO1A 2PX7A 2V0IA 4G3SA 4ZFYB 6I1BA 3V8YA 2VSAA 3JRRA 5BXRA 1ZIZA 5I1FA 1QQLA 3BAHA 3V0AB 1HIBA 3AH2A 1XZ6A 1TWMA 3O5WB 1HWNB 4P0JA 1VZXA 1FWVA 3V0PA 2VXLA 2ICXA 2FDBM 1R7TA 3WO2A 1FO8A 4Q9PA 3OGFA 2OEFA 1YP4A 2X5ZA 5D62A 3FUOA 3V79C 4D0TA 3K8EA 3I2XA 3Q4SA 4G9MA 1FZWA 1BARA 5BP5C 3AKGA 1LL3A 5BQUC 3H6QA 3WMUA 1HKNA 2NXVA 5C36A 2DRZA 5FNWA 1ZJPA 2MC2A 2NP0A 5EJZA 5C3DA 5C38A 4AC3A 1L2HA 1JT7A 4IYBA 1H5SA 3T7MA 1DFCA 4M4KA 1MD6A 4R7PA 4ZOTA 3UD9A 3WMVA 3BAOA 1QWJA 2P6WA 4LO2A 2XMEA 2P39A 2YQHA 4FRDA 4ENDA 3LTQA 2V0HA 1WT3A 1NUNA 2AAIB 2ZR1B 2OI6A 4EVWA 4FQWA 2MLLB 3P6JA 3WA1A 4HO2A 4JKQA 2VSEA 1WT0A 5C4FA 4LW3A 3LLPA 4HOCA 4EE3A 3CA6A 3OBRA 4R6UB 1HWPB 1R81A 2APCA 1ZCUA 1FV2A 4IZEA 2D23A 2P73A 1DQOA 3EF2A 4ZFUB 3AH4A 1GGPB 1DJSB 3AJ5A 1WD4A 3HBWA 4I4XA 4QKSA 1MP4A 2VS4A 2WGZA 1QGSA 3WO3A 4JKXB 1VGZA 1NZKA 2VU9A 2GZBA 4JP0A 5F8WA 2A8UA 8I1BA 4HO0A 2QN4A 3E25A 3F1YA 4IZXA 1R8OA 1IINA 2RITA 2WVKA 3BAVA 4I6IA 4M2BA 2ET2A 4DDZA 1RG8A 1VGWA 3W9TA 2D7IA 2X2SA 4EFQA 1VH3A 2I1BA 3U0YA 1LZIA 2OI5A 2M49A 3SX8A 3V0BB 2VFZA 3UD7A 2NTDA 4HG6A 2NM1A 5BXSA 1TIEA 4JRAA 4E1KA 3Q7UA 4OUJA 2YUGA 2RIYA 1WD3A 5EIYA 1BA7A 2VXRA 4I3NA 5FZUA 3S8JA 3O4CA 4FVVA 1RZOB 2I5KA 1G95A 1YP2A 5BXCA 2IHOA 4EEEB 3I0LA 2AM4A 1AFCA 1JV3A 2QGIA 2FYBA 1ISYA 1TTUA 3I29B 1ON8A 1SS9A 1G82A 1ZI1A 1G0RA 3O49A 1TW5A 2Z49A 2L5XA 9ILBA 1MP3A 1NWGB 4ZKTB 5F90A 2I7BA 5FU0A 4AN6A 1QGQA 1HV9A 3FJFA 3VWCA 4PC4A 4IY9A 2AE7A 2RQ9A 4QD2C 2WVMA 2XWLA 2RSTA 4ECMA 3UD8A 1JT3A 3HSMA 3PMEA 4QBCA 3AKIA 3ZX7A 2K4AB 1FG5N 1DFQA 1H5SC 3A23A 3O3QA 4EB2B 4DECA 4FRPA 2V0LA 5CQPA 1P63A 4IHZA 4LO2C 1K4VA 4I4RA 4GOYA 3IIRA 3BRFA 2VD4A 5DSSB 4DE7A 21BIA 4QD2B 4Y6UA 1D0HA 1W3AA 1YF8B 3SXAA
chains in the Genus database with same CATH superfamily
2GGOA 4EFRA 4CJCA 4ISRA 4KEKA 3HL3A 2KKIA 1ZI3A 1I1BA 2GGQA 2BFHA 4QC4A 4B4GA 1PZYB 4UY4A 1VGUA 1SZ6B 4Y7FA 2YCMA 2RJ8A 1FOAA 1H4EA 4USPA 1IHKA 2D7RA 1AXMA 4LO0A 2K43A 3CA4A 3O4BA 1G2VA 1H7EA 1ZJ2A 2I5EA 3PKPA 3ZC9A 1WT1A 2E3DA 3PHZA 2V0JA 1XZZA 3V0MA 4X39A 1JVDA 3UJ4A 5AJOA 1ABRB 1JTCA 5FUHA 4ASJA 4Q91A 1J0SA 3VT2A 3R3IA 3N0KA 3DK5A 3U0XA 5G00A 1HCDA 1H7HA 1OMXA 2OI7A 2X5SA 1ZDGA 3OH2A 3SX7A 3OC9A 4FREA 4CJ8A 3OGZA 3MPPG 3D5NA 3I0EA 4Y6NA 4HO3A 2Z48A 4LW6A 4OWKA 2E4MC 4Y7TA 2NS2A 3R4SA 1T9FA 3BB2A 3FOQA 4BQHA 1G9AA 1FWYA 3ILAA 2HWMA 3ZLLA 3ZXGA 1FR9A 3CRHA 4A7YA 2AECA 3N7LA 3I0JA 2WBCA 3I0IX 4Z8SB 4FROA 3T7OA 4F34A 1FO9A 3TQDA 4I4YA 2Q4JA 3IOJA 3P53A 2JCLA 2NVHA 5CMJA 3U2UA 1R7UA 3V0LA 1ILR1 4KC4A 5CQNX 3TZTA 5C3AA 1PUMB 3TC2A 1O23B 3BCVA 3R2WA 3BA4A 1S0DA 4FRQA 4P00A 5AJPA 1TW1A 4B4BA 3V90A 3O4DA 1GQ9A 4ZLBB 5BXTA 1ZI5A 2NYYA 1HCEA 5D91A 3IOIA 3F62B 4EEGA 2AXMA 4EEMA 2QKXA 4B2WA 5C4BA 3VUOA 1FR8A 1G9DA 2JCKA 3V0NA 1FWUA 2LIEA 1H7FA 1ZJ3A 2J0AA 3D7WB 3ZF8A 2D1ZA 3VSFA 3PNNA 2FO1A 1H5SD 4H9WA 2R9KB 2Y7AA 2HZ9A 3WINC 1DZDA 4HO8A 4GAIA 1JLYA 1E5KA 2YC5A 1BFBA 2VXTI 1YROB 2RJ0A 1AVAC 1VM8A 2V0KA 4LO3C 1H5TA 2XWMA 3IOHA 3JTJA 3ZGGA 4B4MA 3BA7A 1HM8A 2WAWA 3BAGA 3E26A 5CMFX 1XHBA 2Z87A 2RJ5A 4I4VA 3FUQA 5F8YA 1NMMB 2Y4MA 1NQIB 3D98A 3SXBA 4ASYA 3IM5A 4UEGA 1TOOA 3SNVA 31BIA 1FRWA 3H6RB 1H7LA 1TZFA 3JUJA 4KT7A 4I8MA 5C48A 3VT1A 3CRIA 3IM6A 1S0LA 5HPZA 3Q7WA 2D0JA 3NBEA 2Y9FA 3BA5A 1R80A 3KIAA 2WRYA 1GA8A 1TWEA 3FJDA 3OH1A 2GO2A 3USQA 4D8HA 4C2SA 1YP3A 1FGXA 1JYKA 1TFMB 3NBDA 4NAIA 4A7KA 1WBCA 1H4CA 4OWLA 3AZWA 4I2SA 4LO0C 2YC3A 3POLA 4XFUA 1ZJ1A 4I4QA 3CKNA 5DZUA 4LO7C 5C49A 1H7GA 1YYNA 2WEEA 1JYLA 1H7QA 3OAMA 2AM3A 3K1XA 3USRA 1ZJ0A 3SX3A 1HM0A 1EZIA 4KXOA 5L6SA 1H4DA 1ZHJA 1ZCYA 2Y4LA 1LZJA 4Y7UA 4NAKA 2QYIB 4IQPA 2Z86A 1PWAA 2KLLA 4G6MA 4HO5A 1S0FA 1Q04A 2IWTB 1UPSA 3FJCA 1INJA 4MIXA 4NALA 5D92A 1V6XA 5C1HA 4OW4A 1AVWB 2LIQA 5CQLX 1PUUB 4J2YA 4LO7B 1G9BA 1JV1A 1VZTA 2VSIA 4B2XA 1O0RA 1H5RB 1OQLB 2ZQOA 1S4OA 1VZUA 4AYJA 1G23A 2VLCA 3N9WA 4EKXB 4KNXA 2D44A 1V83A 4M28A 2RG9B 4LO1C 2JCOA 3ZXDA 5BOWA 1DQGA 4ZFWB 4G6JA 1GWWA 1GWVA 3CKJA 4G3QA 2MIBA 4KNRA 3ZLKA 1IIMA 1II4A 1ZJOA 2UX8A 1DIWA 1R7XA 2HW9A 3FJ8A 1G9CA 4FRAA 1W57A 1PZTA 2RJ6A 3RSJA 3CQAA 3SXEA 4KEJA 3NBCA 2WE9A 3SX5A 3V0AA 3F1RA 3Q80A 4FRBA 1ON6A 5AJNA 5EC5A 4D11A 1VCLA 4XKIA 4L41C 4I37A 1H7TA 4P0KA 1VICA 4AN7B 3OJMA 3ST8A 2P23A 3I0GA 1LVWA 5J49A 2Y4KA 4J18A 3V91A 4GAFA 4J2KA 4OWJA 1G8OA 4I4UA 1HM9A 2RJ4A 3K8DA 5L6VA 1VH1A 3QYDA 5GAQA 3BRGC 4JPZA 4FRMA 5C47A 1EV2A 3CA3A 4KBBA 2BO7A 3I0FA 3RMWA 1S0GA 1Z90A 2YESA 1FN0A 3AKFA 4X37A 4XFSA 4K6RA 3I0CA 5C4CA 4NANA 1E0OA 2Q9XA 4YOLA 1FXJA 1R8NA 5DUYA 2E8BA 2QH5A 1YBIA 4DCKC 5BXPA 5CMGX 1JY0A 1YXWA 5EHAA 4Q9GA 4USOA 3IM7A 1IJTA 1MC3A 3RMVA 3V0OA 3O4AA 1HWMB 2FFVA 1I52A 2X2TA 3CGXA 4FCUA 1M2TB 1H5SB 4JAWA 4D0ZA 1EVTA 2O1HA 4HJJA 1JT4A 5BP5A 5BVPI 3KMVA 2OEGA 3Q7YA 5IDTA 2O1GA 1FMZA 1CVSA 2VUAA 1GX4A 2ICYA 2AESA 4I7IA 2XOAA 3SXGA 4WBCA 2ERMA 3Q7XA 2VXMA 2W0WA 4H04A 1ISZA 4JQ0A 2ZU7A 4GP3A 2FYCB 2Y6PA 3DJ4A 2F8XC 1W77A 4EEOA 4EE5A 1AVUA 2XMHA 4G87A 4Y9XA 1BFGA 2D20A 4OEFA 2PA4A 4L4HA 1V82A 3OJVA 3NBNA 1W55A 2CU2A 3RMYA 3SXDA 1INIA 1QQKA 1ZI4A 3FJKA 2ZQNA 3T8SA 1G1LA 1Z4SA 2O1FA 3CKOA 2DREA 5CMHA 2RJ9A 4EE4A 1ISWA 1VGTA 5F8SA 2P72A 2AM5A 3ZGFA 3T7NA 4AAWA 2WVLA 3H6SE 1FQ9A 3S8KA 3FJ9A 5FYEA 1PZZA 4I96A 4G3PA 5HS2A 3PG0A 4KC2A 2HWAA 2PGVA 2BO4A 1ITBA 3OJ2A 1RY7A 5I1BA 2D43A 2YQCA 3V0BA 1QXMA 4MZGB 1ISVA 4XWIA 1SR4A 1CE7B 2D22A 4GOVA 4HA2A 3GUEA 3AH1A 1XG6A 1S4PA 4CJBA 3HN1A 1HJLA 4QKRA 3V8ZA 3BTAA 4ZBVB 4O6NA 4BMAA 4GP0A 2W0VA 4X3AA 3C9ZA 4MNDA 4MYBA 4D11C 2BO6A 4HR6C 1V6WA 5FNXA 4EFPA 3BRDA 1V6VA 1MP5A 3DUVA 1AF9A 3FGMA 3HMYA 1O7OA 3QVBA 4IRQA 5FU8A 3OH0A 3CA5A 4B3UA 3AKHA 4ISQA 4II0A 3A07A 4J2XA 2Y9GA 1LZ0A 2BO8A 1Q1UA 2PGYA 1LZ7A 3QR5A 3CKQA 3I0HA 3SXCA 1EPWA 1W3FA 4OEGA 4H75A 4F83A 2JCJA 1ONKB 3UJ0A 5EJ1A 3A22A 1PC8B 2XWNA 3AJ6A 1F31A 5JQQA 2BEBA 4KPZA 3CU1B 1ISXA 2VK9A 4A7ZA 2Q3NB 1S0EA 4ZA3B 2AQZA 5C4EA 1G9RA 3I2AA 2DS0A 2MZBA 3RTIB 5DDVA 1FGGA 2FYAA 3V0QA 1OMZA 4EEAA 5C4DA 2KI6B 1XYFA 4FGFA 1ZCVA 4DENA 4Y7VA 3CRGA 3OBTA 4ZGRB 1I1EA 2C0NA 1IRAX 1JQZA 1O7QA 4QO3A 4P6AA 1HWOB 2DRYA 3FWWA 3U2WA 7I1BA 5FZZA 1NHEB 5C3BA 2KH2A 1FGAA 1S0CA 4OEEA 4GBPA 1FMMS 3N7JA 4KEIA 4DEPA 2ZU9A 4Y64A 5C8RA 5JMCA 4HCQA 3RSBA 1K5VA 4FRHA 4Y62A 1BLAA 4Y7GA 4I0YA 1R7VA 1R82A 3OKRA 1AVXB 1Z0HA 2YQJA 3BAQA 5CMIA 1M16A 1N4KA 3ZC8A 2Y9WC 3CA1A 3CAHA 3NGWA 4B42A 2NZ9A 1JLXA 1EYLA 2K8RA 4M2AA 3FJIA 5C1GA 1H3MA 2UUSA 3FJAA 1BLDA 1ZDFA 3F1CA 3BADA 1SR4C 4XFTA 3PUBA 1KNMA 2A8WA 3FJEA 1EYRA 4ARWA 4IRPA 1W3GA 5FV9A 2FFUA 2DPWA 2E4MA 2F2FA 4I4OA 1IILA 1FV3A 3VSZA 1V84A 4FRLA 4CJMA 4D48A 1BASA 1HJJA 1K5UA 4P0LA 4I1BA 3OH3A 4JISA 2Y4JA 5FTVA 4ZDQA 3CU0A 5EG6C 4I1EA 5FZYA 2D24A 2KI4A 2AH9A 3POKA 2X60A 4IONA 1KWSA 5D63A 3MALA 5D61A 1G3LA 2RIXA 2X65A 4HO6A 4JD0A 4L4IA 2Y9XE 1RMLA 3OGGA 3CA0A 2BEAA 1IRPA 1TVYA 4Y63A 1A8DA 4KC3A 3VEQA 1G93A 2RIZA 3O3PA 3N7MA 4QALA 5JLVA 1FXOA 1H5TB 4I4PA 5BQUA 2FGFA 4G1RA 3A21A 4LO8B 2VS5A 3VT0A 4AYLA 5IFYA 1QG8A 1WT2A 3O4OA 2AFGA 5DVHA 3WINA 3I0KA 3LW6A 2FY7A 2VS3A 3H6RA 3O44A 3FJBA 4LO3A 4B5BA 3BAUA 1GQCA 3WO4A 5C1LA 4CVHA 5E24E 3JUTA 3RTJB 1NKHB 3EE5A 3U2XA 1TP0A 4G9NA 3PKQA 4QBVA 4KPXA 4P02A 3HALA 2RJ7A 1DLLA 1LL0A 1LL2A 3CKVA 3HOMA 5FTSA 3U2VA 3SPTA 4J2SA 3BRKX 4FCEA 1S0BA 4X38A 1S4NA 1JT5A 1YTOA 1IT0A 4MZHA 1Q03A 4KRVA 3NJ5A 41BIA 3R4UA 2ESUA 1R7YA 1BFCA 2J3PA 5IDSA 4J23B 1V6UA 1WSZA 3IAGC 1GX0A 1BFFA 4HO9A 5B2HA 1MC9A 1IOBA 3P6IA 4IY8A 4FIXA 3FFZA 1H5RA 3I0DA 1Z2VA 4I4SA 4HO4A 1WVCA 3UDAA 3JUKA 4KQLA 3E8LC 3RMXA 1NF5B 5CQMX 3AZVA 2FYDB 2VSHA 3FJJA 1DZCA 3D8VA 3BX1C 1JVGA 1VPAA 4YS8A 1T4QA 4TLPA 4KC1A 5DDTA 1WBAA 2F2FC 4Z9WB 2AGDA 3N7KA 2ZU8A 1G97A 1ZCTA 3U2TA 2RJ1A 5CQOA 3OH4A 1OQMB 2YQSA 3FJHA 3B9UA 4LO1A 2PX7A 2V0IA 4G3SA 4ZFYB 6I1BA 3V8YA 2VSAA 3JRRA 5BXRA 1ZIZA 4Q7CA 1QQLA 5I1FA 3BAHA 3V0AB 1HIBA 3AH2A 1XZ6A 1TWMA 3O5WB 4FIYA 1HWNB 4P0JA 1VZXA 1FWVA 3V0PA 2VXLA 2ICXA 2FDBM 1R7TA 3WO2A 1FO8A 4Q9PA 2J0BA 3OGFA 2OEFA 1YP4A 2X5ZA 5D62A 3FUOA 3V79C 4D0TA 3K8EA 3I2XA 3Q4SA 4G9MA 1FZWA 1BARA 5BP5C 3AKGA 1LL3A 5BQUC 3H6QA 3WMUA 1HKNA 2NXVA 5C36A 2DRZA 5FNWA 1ZJPA 2MC2A 2NP0A 5EJZA 5C3DA 5C38A 4AC3A 1L2HA 1JT7A 4IYBA 1H5SA 3T7MA 1DFCA 4M4KA 1MD6A 4R7PA 4ZOTA 3UD9A 3WMVA 3BAOA 1QWJA 2P6WA 4LO2A 2XMEA 2P39A 2YQHA 4FRDA 4ENDA 3LTQA 2V0HA 1WT3A 1NUNA 2AAIB 2ZR1B 2OI6A 4EVWA 4FQWA 2MLLB 3P6JA 3WA1A 4HO2A 4JKQA 2VSEA 1WT0A 5C4FA 4LW3A 3LLPA 4HOCA 4EE3A 3CA6A 3OBRA 4R6UB 1HWPB 1R81A 2APCA 1ZCUA 1FV2A 4IZEA 2D23A 2P73A 1DQOA 3EF2A 4ZFUB 3AH4A 1GGPB 1DJSB 3AJ5A 1WD4A 3HBWA 4I4XA 4QKSA 1MP4A 2VS4A 2WGZA 1QGSA 3WO3A 4JKXB 1VGZA 1NZKA 2VU9A 2GZBA 4JP0A 5F8WA 2A8UA 8I1BA 4HO0A 2QN4A 3E25A 3F1YA 4IZXA 1R8OA 1IINA 2RITA 2WVKA 3BAVA 4I6IA 4M2BA 2ET2A 4DDZA 1RG8A 1VGWA 3W9TA 2D7IA 2X2SA 4EFQA 1VH3A 2I1BA 3U0YA 1LZIA 2OI5A 2M49A 4MZFB 3SX8A 3V0BB 2VFZA 3UD7A 2NTDA 4HG6A 2NM1A 5BXSA 1TIEA 4JRAA 4E1KA 3Q7UA 4OUJA 2YUGA 2RIYA 1WD3A 5EIYA 1BA7A 2VXRA 4I3NA 5FZUA 3S8JA 3O4CA 4FVVA 1RZOB 2I5KA 1G95A 1YP2A 5BXCA 2IHOA 4EEEB 3I0LA 2AM4A 1AFCA 1JV3A 2QGIA 2FYBA 1ISYA 1TTUA 3I29B 1ON8A 1SS9A 1G82A 1ZI1A 1G0RA 3O49A 1TW5A 2Z49A 2L5XA 9ILBA 1MP3A 1NWGB 4ZKTB 5F90A 2I7BA 5FU0A 4AN6A 1QGQA 1HV9A 3FJFA 3VWCA 4PC4A 4IY9A 2AE7A 2RQ9A 4QD2C 2WVMA 2XWLA 2RSTA 4ECMA 3UD8A 1JT3A 3HSMA 3PMEA 4QBCA 3AKIA 3ZX7A 2K4AB 1FG5N 1DFQA 1H5SC 3A23A 3O3QA 4EB2B 4DECA 4FRPA 2V0LA 5CQPA 1P63A 4IHZA 4LO2C 1K4VA 4I4RA 4GOYA 3IIRA 3BRFA 2VD4A 5DSSB 4DE7A 21BIA 4QD2B 4Y6UA 1D0HA 1W3AA 1YF8B 3SXAA 4O6MA
chains in the Genus database with same CATH topology
2GGOA 4EFRA 4CJCA 4ISRA 4KEKA 3HL3A 2KKIA 1ZI3A 1I1BA 2GGQA 2BFHA 4QC4A 4B4GA 1PZYB 4UY4A 1VGUA 1SZ6B 4Y7FA 2YCMA 2RJ8A 1FOAA 1H4EA 4USPA 1IHKA 2D7RA 1AXMA 4LO0A 2K43A 3CA4A 3O4BA 1G2VA 1H7EA 1ZJ2A 2I5EA 3PKPA 3ZC9A 1WT1A 2E3DA 3PHZA 2V0JA 1XZZA 3V0MA 4X39A 1JVDA 3UJ4A 5AJOA 1ABRB 1JTCA 5FUHA 4ASJA 4Q91A 1J0SA 3VT2A 3R3IA 3N0KA 3DK5A 3U0XA 5G00A 1HCDA 1H7HA 1OMXA 2OI7A 2X5SA 1ZDGA 3OH2A 3SX7A 3OC9A 4FREA 4CJ8A 3OGZA 3MPPG 3D5NA 3I0EA 4Y6NA 4HO3A 2Z48A 4LW6A 4OWKA 2E4MC 4Y7TA 2NS2A 3R4SA 1T9FA 3BB2A 3FOQA 4BQHA 1G9AA 1FWYA 3ILAA 2HWMA 3ZLLA 3ZXGA 1FR9A 3CRHA 4A7YA 2AECA 3N7LA 3I0JA 2WBCA 3I0IX 4Z8SB 4FROA 3T7OA 4F34A 1FO9A 3TQDA 4I4YA 2Q4JA 3IOJA 3P53A 2JCLA 2NVHA 5CMJA 3U2UA 1R7UA 3V0LA 1ILR1 4KC4A 5CQNX 3TZTA 5C3AA 1PUMB 3TC2A 1O23B 3BCVA 3R2WA 3BA4A 1S0DA 4FRQA 4P00A 5AJPA 1TW1A 4B4BA 3V90A 3O4DA 1GQ9A 4ZLBB 5BXTA 1ZI5A 2NYYA 1HCEA 5D91A 3IOIA 3F62B 4EEGA 2AXMA 4EEMA 2QKXA 4B2WA 5C4BA 3VUOA 1FR8A 1G9DA 2JCKA 3V0NA 1FWUA 2LIEA 1H7FA 1ZJ3A 2J0AA 3D7WB 3ZF8A 2D1ZA 3VSFA 3PNNA 2FO1A 1H5SD 4H9WA 2R9KB 2Y7AA 2HZ9A 3WINC 1DZDA 4HO8A 4GAIA 1JLYA 1E5KA 2YC5A 1BFBA 2VXTI 1YROB 2RJ0A 1AVAC 1VM8A 2V0KA 4LO3C 1H5TA 2XWMA 3IOHA 3JTJA 3ZGGA 4B4MA 3BA7A 1HM8A 2WAWA 3BAGA 3E26A 5CMFX 1XHBA 2Z87A 2RJ5A 4I4VA 3FUQA 5F8YA 1NMMB 2Y4MA 1NQIB 3D98A 3SXBA 4ASYA 3IM5A 4UEGA 1TOOA 3SNVA 31BIA 1FRWA 3H6RB 1H7LA 1TZFA 3JUJA 4KT7A 4I8MA 5C48A 3VT1A 3CRIA 3IM6A 1S0LA 5HPZA 3Q7WA 2D0JA 3NBEA 2Y9FA 3BA5A 1R80A 3KIAA 2WRYA 1GA8A 1TWEA 3FJDA 3OH1A 2GO2A 3USQA 4D8HA 4C2SA 1YP3A 1FGXA 1JYKA 1TFMB 3NBDA 4NAIA 4A7KA 1WBCA 1H4CA 4OWLA 3AZWA 4I2SA 4LO0C 2YC3A 3POLA 4XFUA 1ZJ1A 4I4QA 3CKNA 5DZUA 4LO7C 5C49A 1H7GA 1YYNA 2WEEA 1JYLA 1H7QA 3OAMA 2AM3A 3K1XA 3USRA 1ZJ0A 3SX3A 1HM0A 1EZIA 4KXOA 5L6SA 1H4DA 1ZHJA 1ZCYA 2Y4LA 1LZJA 4Y7UA 4NAKA 2QYIB 4IQPA 2Z86A 1PWAA 2KLLA 4G6MA 4HO5A 1S0FA 1Q04A 2IWTB 1UPSA 3FJCA 1INJA 4MIXA 4NALA 5D92A 1V6XA 5C1HA 4OW4A 1AVWB 2LIQA 5CQLX 1PUUB 4J2YA 4LO7B 1G9BA 1JV1A 1VZTA 2VSIA 4B2XA 1O0RA 1H5RB 1OQLB 2ZQOA 1S4OA 1VZUA 4AYJA 1G23A 2VLCA 3N9WA 4EKXB 4KNXA 2D44A 1V83A 4M28A 2RG9B 4LO1C 2JCOA 3ZXDA 5BOWA 1DQGA 4ZFWB 4G6JA 1GWWA 1GWVA 3CKJA 4G3QA 2MIBA 4KNRA 3ZLKA 1IIMA 1II4A 1ZJOA 2UX8A 1DIWA 1R7XA 2HW9A 3FJ8A 1G9CA 4FRAA 1W57A 1PZTA 2RJ6A 3RSJA 3CQAA 3SXEA 4KEJA 3NBCA 2WE9A 3SX5A 3V0AA 3F1RA 3Q80A 4FRBA 1ON6A 5AJNA 5EC5A 4D11A 1VCLA 4XKIA 4L41C 4I37A 1H7TA 4P0KA 1VICA 4AN7B 3OJMA 3ST8A 2P23A 3I0GA 1LVWA 5J49A 2Y4KA 4J18A 3V91A 4GAFA 4J2KA 4OWJA 1G8OA 4I4UA 1HM9A 2RJ4A 3K8DA 5L6VA 1VH1A 3QYDA 5GAQA 3BRGC 4JPZA 4FRMA 5C47A 1EV2A 3CA3A 4KBBA 2BO7A 3I0FA 3RMWA 1S0GA 1Z90A 2YESA 1FN0A 3AKFA 4X37A 4XFSA 4K6RA 3I0CA 5C4CA 4NANA 1E0OA 2Q9XA 4YOLA 1FXJA 1R8NA 5DUYA 2E8BA 2QH5A 1YBIA 4DCKC 5BXPA 5CMGX 1JY0A 1YXWA 5EHAA 4Q9GA 4USOA 3IM7A 1IJTA 1MC3A 3RMVA 3V0OA 3O4AA 1HWMB 2FFVA 1I52A 2X2TA 3CGXA 4FCUA 1M2TB 1H5SB 4JAWA 4D0ZA 1EVTA 2O1HA 4HJJA 1JT4A 5BP5A 5BVPI 3KMVA 2OEGA 3Q7YA 5IDTA 2O1GA 1FMZA 1CVSA 2VUAA 1GX4A 2ICYA 2AESA 4I7IA 2XOAA 3SXGA 4WBCA 2ERMA 3Q7XA 2VXMA 2W0WA 4H04A 1ISZA 4JQ0A 2ZU7A 4GP3A 2FYCB 2Y6PA 3DJ4A 2F8XC 1W77A 4EEOA 4EE5A 1AVUA 2XMHA 4G87A 4Y9XA 1BFGA 2D20A 4OEFA 2PA4A 4L4HA 1V82A 3OJVA 3NBNA 1W55A 2CU2A 3RMYA 3SXDA 1INIA 1QQKA 1ZI4A 3FJKA 2ZQNA 3T8SA 1G1LA 1Z4SA 2O1FA 3CKOA 2DREA 5CMHA 2RJ9A 4EE4A 1ISWA 1VGTA 5F8SA 2P72A 2AM5A 3ZGFA 3T7NA 4AAWA 2WVLA 3H6SE 1FQ9A 3S8KA 3FJ9A 5FYEA 1PZZA 4I96A 4G3PA 5HS2A 3PG0A 4KC2A 2HWAA 2PGVA 2BO4A 1ITBA 3OJ2A 1RY7A 5I1BA 2D43A 2YQCA 3V0BA 1QXMA 4MZGB 1ISVA 4XWIA 1SR4A 1CE7B 2D22A 4GOVA 4HA2A 3GUEA 3AH1A 1XG6A 1S4PA 4CJBA 3HN1A 1HJLA 4QKRA 3V8ZA 3BTAA 4ZBVB 4O6NA 4BMAA 4GP0A 2W0VA 4X3AA 3C9ZA 4MNDA 4MYBA 4D11C 2BO6A 4HR6C 1V6WA 5FNXA 4EFPA 3BRDA 1V6VA 1MP5A 3DUVA 1AF9A 3FGMA 3HMYA 1O7OA 3QVBA 4IRQA 5FU8A 3OH0A 3CA5A 4B3UA 3AKHA 4ISQA 4II0A 3A07A 4J2XA 2Y9GA 1LZ0A 2BO8A 1Q1UA 2PGYA 1LZ7A 3QR5A 3CKQA 3I0HA 3SXCA 1EPWA 1W3FA 4OEGA 4H75A 4F83A 2JCJA 1ONKB 3UJ0A 5EJ1A 3A22A 1PC8B 2XWNA 3AJ6A 1F31A 5JQQA 2BEBA 4KPZA 3CU1B 1ISXA 2VK9A 4A7ZA 2Q3NB 1S0EA 4ZA3B 2AQZA 5C4EA 1G9RA 3I2AA 2DS0A 2MZBA 3RTIB 5DDVA 1FGGA 2FYAA 3V0QA 1OMZA 4EEAA 5C4DA 2KI6B 1XYFA 4FGFA 1ZCVA 4DENA 4Y7VA 3CRGA 3OBTA 4ZGRB 1I1EA 2C0NA 1IRAX 1JQZA 1O7QA 4QO3A 4P6AA 1HWOB 2DRYA 3FWWA 3U2WA 7I1BA 5FZZA 1NHEB 5C3BA 2KH2A 1FGAA 1S0CA 4OEEA 4GBPA 1FMMS 3N7JA 4KEIA 4DEPA 2ZU9A 4Y64A 5C8RA 5JMCA 4HCQA 3RSBA 1K5VA 4FRHA 4Y62A 1BLAA 4Y7GA 4I0YA 1R7VA 1R82A 3OKRA 1AVXB 1Z0HA 2YQJA 3BAQA 5CMIA 1M16A 1N4KA 3ZC8A 2Y9WC 3CA1A 3CAHA 3NGWA 4B42A 2NZ9A 1JLXA 1EYLA 2K8RA 4M2AA 3FJIA 5C1GA 1H3MA 2UUSA 3FJAA 1BLDA 1ZDFA 3F1CA 3BADA 1SR4C 4XFTA 3PUBA 1KNMA 2A8WA 3FJEA 1EYRA 4ARWA 4IRPA 1W3GA 5FV9A 2FFUA 2DPWA 2E4MA 2F2FA 4I4OA 1IILA 1FV3A 3VSZA 1V84A 4FRLA 4CJMA 4D48A 1BASA 1HJJA 1K5UA 4P0LA 4I1BA 3OH3A 4JISA 2Y4JA 5FTVA 4ZDQA 3CU0A 5EG6C 4I1EA 5FZYA 2D24A 2KI4A 2AH9A 3POKA 2X60A 4IONA 1KWSA 5D63A 3MALA 5D61A 1G3LA 2RIXA 2X65A 4HO6A 4JD0A 4L4IA 2Y9XE 1RMLA 3OGGA 3CA0A 2BEAA 1IRPA 1TVYA 4Y63A 1A8DA 4KC3A 3VEQA 1G93A 2RIZA 3O3PA 3N7MA 4QALA 5JLVA 1FXOA 1H5TB 4I4PA 5BQUA 2FGFA 4G1RA 3A21A 4LO8B 2VS5A 3VT0A 4AYLA 5IFYA 1QG8A 1WT2A 3O4OA 2AFGA 5DVHA 3WINA 3I0KA 3LW6A 2FY7A 2VS3A 3H6RA 3O44A 3FJBA 4LO3A 4B5BA 3BAUA 1GQCA 3WO4A 5C1LA 4CVHA 5E24E 3JUTA 3RTJB 1NKHB 3EE5A 3U2XA 1TP0A 4G9NA 3PKQA 4QBVA 4KPXA 4P02A 3HALA 2RJ7A 1DLLA 1LL0A 1LL2A 3CKVA 3HOMA 5FTSA 3U2VA 3SPTA 4J2SA 3BRKX 4FCEA 1S0BA 4X38A 1S4NA 1JT5A 1YTOA 1IT0A 4MZHA 1Q03A 4KRVA 3NJ5A 41BIA 3R4UA 2ESUA 1R7YA 1BFCA 2J3PA 5IDSA 4J23B 1V6UA 1WSZA 3IAGC 1GX0A 1BFFA 4HO9A 5B2HA 1MC9A 1IOBA 3P6IA 4IY8A 4FIXA 3FFZA 1H5RA 3I0DA 1Z2VA 4I4SA 4HO4A 1WVCA 3UDAA 3JUKA 4KQLA 3E8LC 3RMXA 1NF5B 5CQMX 3AZVA 2FYDB 2VSHA 3FJJA 1DZCA 3D8VA 3BX1C 1JVGA 1VPAA 4YS8A 1T4QA 4TLPA 4KC1A 5DDTA 1WBAA 2F2FC 4Z9WB 2AGDA 3N7KA 2ZU8A 1G97A 1ZCTA 3U2TA 2RJ1A 5CQOA 3OH4A 1OQMB 2YQSA 3FJHA 3B9UA 4LO1A 2PX7A 2V0IA 4G3SA 4ZFYB 6I1BA 3V8YA 2VSAA 3JRRA 5BXRA 1ZIZA 4Q7CA 1QQLA 5I1FA 3BAHA 3V0AB 1HIBA 3AH2A 1XZ6A 1TWMA 3O5WB 4FIYA 1HWNB 4P0JA 1VZXA 1FWVA 3V0PA 2VXLA 2ICXA 2FDBM 1R7TA 3WO2A 1FO8A 4Q9PA 2J0BA 3OGFA 2OEFA 1YP4A 2X5ZA 5D62A 3FUOA 3V79C 4D0TA 3K8EA 3I2XA 3Q4SA 4G9MA 1FZWA 1BARA 5BP5C 3AKGA 1LL3A 5BQUC 3H6QA 3WMUA 1HKNA 2NXVA 5C36A 2DRZA 5FNWA 1ZJPA 2MC2A 2NP0A 5EJZA 5C3DA 5C38A 4AC3A 1L2HA 1JT7A 4IYBA 1H5SA 3T7MA 1DFCA 4M4KA 1MD6A 4R7PA 4ZOTA 3UD9A 3WMVA 3BAOA 1QWJA 2P6WA 4LO2A 2XMEA 2P39A 2YQHA 4FRDA 4ENDA 3LTQA 2V0HA 1WT3A 1NUNA 2AAIB 2ZR1B 2OI6A 4EVWA 4FQWA 2MLLB 3P6JA 3WA1A 4HO2A 4JKQA 2VSEA 1WT0A 5C4FA 4LW3A 3LLPA 4HOCA 4EE3A 3CA6A 3OBRA 4R6UB 1HWPB 1R81A 2APCA 1ZCUA 1FV2A 4IZEA 2D23A 2P73A 1DQOA 3EF2A 4ZFUB 3AH4A 1GGPB 1DJSB 3AJ5A 1WD4A 3HBWA 4I4XA 4QKSA 1MP4A 2VS4A 2WGZA 1QGSA 3WO3A 4JKXB 1VGZA 1NZKA 2VU9A 2GZBA 4JP0A 5F8WA 2A8UA 8I1BA 4HO0A 2QN4A 3E25A 3F1YA 4IZXA 1R8OA 1IINA 2RITA 2WVKA 3BAVA 4I6IA 4M2BA 2ET2A 4DDZA 1RG8A 1VGWA 3W9TA 2D7IA 2X2SA 4EFQA 1VH3A 2I1BA 3U0YA 1LZIA 2OI5A 2M49A 4MZFB 3SX8A 3V0BB 2VFZA 3UD7A 2NTDA 4HG6A 2NM1A 5BXSA 1TIEA 4JRAA 4E1KA 3Q7UA 4OUJA 2YUGA 2RIYA 1WD3A 5EIYA 1BA7A 2VXRA 4I3NA 5FZUA 3S8JA 3O4CA 4FVVA 1RZOB 2I5KA 1G95A 1YP2A 5BXCA 2IHOA 4EEEB 3I0LA 2AM4A 1AFCA 1JV3A 2QGIA 2FYBA 1ISYA 1TTUA 3I29B 1ON8A 1SS9A 1G82A 1ZI1A 1G0RA 3O49A 1TW5A 2Z49A 2L5XA 9ILBA 1MP3A 1NWGB 4ZKTB 5F90A 2I7BA 5FU0A 4AN6A 1QGQA 1HV9A 3FJFA 3VWCA 4PC4A 4IY9A 2AE7A 2RQ9A 4QD2C 2WVMA 2XWLA 2RSTA 4ECMA 3UD8A 1JT3A 3HSMA 3PMEA 4QBCA 3AKIA 3ZX7A 2K4AB 1FG5N 1DFQA 1H5SC 3A23A 3O3QA 4EB2B 4DECA 4FRPA 2V0LA 5CQPA 1P63A 4IHZA 4LO2C 1K4VA 4I4RA 4GOYA 3IIRA 3BRFA 2VD4A 5DSSB 4DE7A 21BIA 4QD2B 4Y6UA 1D0HA 1W3AA 1YF8B 3SXAA 4O6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGO A;  4EFR A;  4CJC A;  4ISR A;  4KEK A;  3HL3 A;  2KKI A;  1ZI3 A;  1I1B A;  2GGQ A;  2BFH A;  4QC4 A;  4B4G A;  1PZY B;  1VGU A;  1SZ6 B;  4Y7F A;  2YCM A;  2RJ8 A;  1FOA A;  1H4E A;  4USP A;  1IHK A;  2D7R A;  1AXM A;  4LO0 A;  2K43 A;  3CA4 A;  3O4B A;  1G2V A;  1H7E A;  1ZJ2 A;  2I5E A;  3PKP A;  3ZC9 A;  1WT1 A;  2E3D A;  3PHZ A;  2V0J A;  1XZZ A;  3V0M A;  4X39 A;  1JVD A;  3UJ4 A;  5AJO A;  1ABR B;  1JTC A;  5FUH A;  4ASJ A;  4Q91 A;  1J0S A;  3VT2 A;  3R3I A;  3N0K A;  3DK5 A;  3U0X A;  5G00 A;  1HCD A;  1H7H A;  1OMX A;  2OI7 A;  2X5S A;  1ZDG A;  3OH2 A;  3SX7 A;  3OC9 A;  4FRE A;  4CJ8 A;  3OGZ A;  3MPP G;  3D5N A;  3I0E A;  4Y6N A;  4HO3 A;  2Z48 A;  4LW6 A;  4OWK A;  2E4M C;  4Y7T A;  3R4S A;  1T9F A;  3BB2 A;  3FOQ A;  4BQH A;  1G9A A;  1FWY A;  3ILA A;  2HWM A;  3ZLL A;  3ZXG A;  1FR9 A;  3CRH A;  4A7Y A;  2AEC A;  3N7L A;  3I0J A;  2WBC A;  3I0I X;  4Z8S B;  4FRO A;  3T7O A;  4F34 A;  1FO9 A;  3TQD A;  4I4Y A;  2Q4J A;  3IOJ A;  3P53 A;  2JCL A;  2NVH A;  5CMJ A;  3U2U A;  1R7U A;  3V0L A;  1ILR 1;  4KC4 A;  5CQN X;  3TZT A;  5C3A A;  1PUM B;  3TC2 A;  1O23 B;  3BCV A;  3R2W A;  3BA4 A;  1S0D A;  4FRQ A;  4P00 A;  5AJP A;  1TW1 A;  4B4B A;  3V90 A;  3O4D A;  1GQ9 A;  4ZLB B;  5BXT A;  1ZI5 A;  2NYY A;  1HCE A;  3IOI A;  3F62 B;  4EEG A;  2AXM A;  4EEM A;  2QKX A;  4B2W A;  5C4B A;  3VUO A;  1FR8 A;  1G9D A;  2JCK A;  3V0N A;  1FWU A;  2LIE A;  1H7F A;  1ZJ3 A;  3D7W B;  3ZF8 A;  2D1Z A;  3VSF A;  3PNN A;  2FO1 A;  1H5S D;  4H9W A;  2R9K B;  2Y7A A;  2HZ9 A;  3WIN C;  1DZD A;  4HO8 A;  4GAI A;  1JLY A;  1E5K A;  2YC5 A;  1BFB A;  2VXT I;  1YRO B;  2RJ0 A;  1AVA C;  1VM8 A;  2V0K A;  4LO3 C;  1H5T A;  2XWM A;  3IOH A;  3JTJ A;  3ZGG A;  4B4M A;  3BA7 A;  1HM8 A;  2WAW A;  3BAG A;  3E26 A;  5CMF X;  1XHB A;  2Z87 A;  2RJ5 A;  4I4V A;  3FUQ A;  5F8Y A;  1NMM B;  2Y4M A;  1NQI B;  3D98 A;  3SXB A;  4ASY A;  3IM5 A;  4UEG A;  1TOO A;  3SNV A;  31BI A;  1FRW A;  3H6R B;  1H7L A;  1TZF A;  3JUJ A;  4KT7 A;  4I8M A;  5C48 A;  3VT1 A;  3CRI A;  3IM6 A;  1S0L A;  5HPZ A;  3Q7W A;  2D0J A;  3NBE A;  2Y9F A;  3BA5 A;  1R80 A;  3KIA A;  2WRY A;  1GA8 A;  1TWE A;  3FJD A;  3OH1 A;  2GO2 A;  3USQ A;  4D8H A;  4C2S A;  1YP3 A;  1FGX A;  1JYK A;  1TFM B;  3NBD A;  4NAI A;  4A7K A;  1WBC A;  1H4C A;  4OWL A;  3AZW A;  4I2S A;  4LO0 C;  2YC3 A;  3POL A;  4XFU A;  1ZJ1 A;  4I4Q A;  3CKN A;  5DZU A;  4LO7 C;  5C49 A;  1H7G A;  1YYN A;  2WEE A;  1JYL A;  1H7Q A;  3OAM A;  2AM3 A;  3K1X A;  3USR A;  1ZJ0 A;  3SX3 A;  1HM0 A;  1EZI A;  4KXO A;  5L6S A;  1H4D A;  1ZHJ A;  1ZCY A;  2Y4L A;  1LZJ A;  4Y7U A;  4NAK A;  2QYI B;  4IQP A;  2Z86 A;  1PWA A;  2KLL A;  4G6M A;  4HO5 A;  1S0F A;  1Q04 A;  2IWT B;  1UPS A;  3FJC A;  1INJ A;  4NAL A;  5C1H A;  1V6X A;  4OW4 A;  1AVW B;  2LIQ A;  5CQL X;  1PUU B;  4J2Y A;  4LO7 B;  1G9B A;  1JV1 A;  1VZT A;  2VSI A;  4B2X A;  1O0R A;  1H5R B;  1OQL B;  2ZQO A;  1S4O A;  1VZU A;  4AYJ A;  1G23 A;  2VLC A;  3N9W A;  4EKX B;  4KNX A;  2D44 A;  1V83 A;  4M28 A;  2RG9 B;  4LO1 C;  2JCO A;  3ZXD A;  5BOW A;  1DQG A;  4ZFW B;  4G6J A;  1GWW A;  1GWV A;  3CKJ A;  4G3Q A;  2MIB A;  4KNR A;  3ZLK A;  1IIM A;  1II4 A;  1ZJO A;  2UX8 A;  1DIW A;  1R7X A;  2HW9 A;  3FJ8 A;  1G9C A;  4FRA A;  1W57 A;  1PZT A;  2RJ6 A;  3RSJ A;  3CQA A;  3SXE A;  4KEJ A;  3NBC A;  2WE9 A;  3SX5 A;  3V0A A;  3F1R A;  3Q80 A;  4FRB A;  1ON6 A;  5AJN A;  5EC5 A;  4D11 A;  1VCL A;  4XKI A;  4L41 C;  4I37 A;  1H7T A;  4P0K A;  1VIC A;  4AN7 B;  3OJM A;  3ST8 A;  2P23 A;  3I0G A;  1LVW A;  5J49 A;  2Y4K A;  4J18 A;  3V91 A;  4GAF A;  4J2K A;  4OWJ A;  1G8O A;  4I4U A;  1HM9 A;  2RJ4 A;  3K8D A;  5L6V A;  1VH1 A;  3QYD A;  5GAQ A;  3BRG C;  4JPZ A;  4FRM A;  5C47 A;  1EV2 A;  3CA3 A;  4KBB A;  2BO7 A;  3I0F A;  3RMW A;  1S0G A;  1Z90 A;  2YES A;  1FN0 A;  3AKF A;  4X37 A;  4XFS A;  4K6R A;  3I0C A;  5C4C A;  4NAN A;  1E0O A;  2Q9X A;  4YOL A;  1FXJ A;  1R8N A;  5DUY A;  2E8B A;  2QH5 A;  1YBI A;  4DCK C;  5BXP A;  5CMG X;  1JY0 A;  1YXW A;  5EHA A;  4Q9G A;  4USO A;  3IM7 A;  1IJT A;  1MC3 A;  3RMV A;  3V0O A;  3O4A A;  1HWM B;  2FFV A;  1I52 A;  2X2T A;  3CGX A;  4FCU A;  1M2T B;  1H5S B;  4JAW A;  4D0Z A;  1EVT A;  2O1H A;  4HJJ A;  1JT4 A;  5BP5 A;  5BVP I;  3KMV A;  2OEG A;  3Q7Y A;  5IDT A;  2O1G A;  1FMZ A;  1CVS A;  2VUA A;  1GX4 A;  2ICY A;  2AES A;  4I7I A;  2XOA A;  3SXG A;  4WBC A;  2ERM A;  3Q7X A;  2VXM A;  2W0W A;  4H04 A;  1ISZ A;  4JQ0 A;  2ZU7 A;  4GP3 A;  2FYC B;  2Y6P A;  3DJ4 A;  2F8X C;  1W77 A;  4EEO A;  4EE5 A;  1AVU A;  2XMH A;  4G87 A;  4Y9X A;  1BFG A;  2D20 A;  4OEF A;  2PA4 A;  4L4H A;  1V82 A;  3OJV A;  3NBN A;  1W55 A;  2CU2 A;  3RMY A;  3SXD A;  1INI A;  1QQK A;  1ZI4 A;  3FJK A;  2ZQN A;  3T8S A;  1G1L A;  1Z4S A;  2O1F A;  3CKO A;  2DRE A;  5CMH A;  2RJ9 A;  4EE4 A;  1ISW A;  1VGT A;  5F8S A;  2P72 A;  2AM5 A;  3ZGF A;  3T7N A;  4AAW A;  2WVL A;  3H6S E;  1FQ9 A;  3S8K A;  3FJ9 A;  5FYE A;  1PZZ A;  4I96 A;  4G3P A;  5HS2 A;  3PG0 A;  4KC2 A;  2HWA A;  2PGV A;  2BO4 A;  1ITB A;  3OJ2 A;  1RY7 A;  5I1B A;  2D43 A;  2YQC A;  3V0B A;  1QXM A;  1ISV A;  4XWI A;  1SR4 A;  1CE7 B;  2D22 A;  4GOV A;  4HA2 A;  3GUE A;  3AH1 A;  1XG6 A;  1S4P A;  4CJB A;  3HN1 A;  1HJL A;  4QKR A;  3V8Z A;  3BTA A;  4ZBV B;  4BMA A;  4GP0 A;  2W0V A;  4X3A A;  3C9Z A;  4MND A;  4MYB A;  4D11 C;  2BO6 A;  4HR6 C;  1V6W A;  5FNX A;  4EFP A;  3BRD A;  1V6V A;  1MP5 A;  3DUV A;  1AF9 A;  3FGM A;  3HMY A;  1O7O A;  3QVB A;  4IRQ A;  5FU8 A;  3OH0 A;  3CA5 A;  4B3U A;  3AKH A;  4ISQ A;  4II0 A;  3A07 A;  4J2X A;  2Y9G A;  1LZ0 A;  2BO8 A;  1Q1U A;  2PGY A;  1LZ7 A;  3QR5 A;  3CKQ A;  3I0H A;  3SXC A;  1EPW A;  1W3F A;  4OEG A;  4F83 A;  2JCJ A;  1ONK B;  3UJ0 A;  5EJ1 A;  3A22 A;  1PC8 B;  2XWN A;  3AJ6 A;  1F31 A;  5JQQ A;  2BEB A;  4KPZ A;  3CU1 B;  1ISX A;  4A7Z A;  2Q3N B;  1S0E A;  4ZA3 B;  2AQZ A;  5C4E A;  1G9R A;  3I2A A;  2DS0 A;  2MZB A;  3RTI B;  5DDV A;  1FGG A;  2FYA A;  3V0Q A;  1OMZ A;  4EEA A;  5C4D A;  2KI6 B;  1XYF A;  4FGF A;  1ZCV A;  4DEN A;  4Y7V A;  3CRG A;  3OBT A;  4ZGR B;  1I1E A;  1IRA X;  1JQZ A;  1O7Q A;  4QO3 A;  4P6A A;  1HWO B;  2DRY A;  3FWW A;  3U2W A;  7I1B A;  5FZZ A;  1NHE B;  5C3B A;  2KH2 A;  1FGA A;  1S0C A;  4OEE A;  4GBP A;  1FMM S;  3N7J A;  4KEI A;  4DEP A;  2ZU9 A;  4Y64 A;  5C8R A;  5JMC A;  4HCQ A;  3RSB A;  1K5V A;  4FRH A;  4Y62 A;  1BLA A;  4Y7G A;  4I0Y A;  1R7V A;  1R82 A;  3OKR A;  1AVX B;  1Z0H A;  2YQJ A;  3BAQ A;  5CMI A;  1M16 A;  1N4K A;  3ZC8 A;  2Y9W C;  3CA1 A;  3CAH A;  3NGW A;  4B42 A;  2NZ9 A;  1JLX A;  1EYL A;  2K8R A;  4M2A A;  3FJI A;  5C1G A;  1H3M A;  2UUS A;  3FJA A;  1BLD A;  1ZDF A;  3F1C A;  3BAD A;  1SR4 C;  4XFT A;  3PUB A;  1KNM A;  2A8W A;  3FJE A;  1EYR A;  4ARW A;  4IRP A;  1W3G A;  5FV9 A;  2FFU A;  2DPW A;  2E4M A;  2F2F A;  4I4O A;  1IIL A;  1FV3 A;  3VSZ A;  1V84 A;  4FRL A;  4CJM A;  4D48 A;  1BAS A;  1HJJ A;  1K5U A;  4P0L A;  4I1B A;  3OH3 A;  4JIS A;  2Y4J A;  5FTV A;  4ZDQ A;  3CU0 A;  5EG6 C;  4I1E A;  5FZY A;  2D24 A;  2KI4 A;  2AH9 A;  3POK A;  2X60 A;  4ION A;  1KWS A;  5D63 A;  3MAL A;  5D61 A;  1G3L A;  2RIX A;  2X65 A;  4HO6 A;  4JD0 A;  4L4I A;  2Y9X E;  1RML A;  3OGG A;  3CA0 A;  2BEA A;  1IRP A;  1TVY A;  4Y63 A;  1A8D A;  4KC3 A;  3VEQ A;  1G93 A;  2RIZ A;  3O3P A;  3N7M A;  4QAL A;  5JLV A;  1FXO A;  1H5T B;  4I4P A;  5BQU A;  2FGF A;  4G1R A;  3A21 A;  4LO8 B;  2VS5 A;  3VT0 A;  4AYL A;  5IFY A;  1QG8 A;  1WT2 A;  3O4O A;  2AFG A;  5DVH A;  3WIN A;  3I0K A;  3LW6 A;  2FY7 A;  2VS3 A;  3H6R A;  3O44 A;  3FJB A;  4LO3 A;  4B5B A;  3BAU A;  1GQC A;  3WO4 A;  5C1L A;  4CVH A;  5E24 E;  3JUT A;  3RTJ B;  1NKH B;  3EE5 A;  3U2X A;  1TP0 A;  4G9N A;  3PKQ A;  4QBV A;  4KPX A;  4P02 A;  3HAL A;  2RJ7 A;  1DLL A;  1LL0 A;  1LL2 A;  3CKV A;  3HOM A;  5FTS A;  3U2V A;  3SPT A;  4J2S A;  3BRK X;  4FCE A;  1S0B A;  4X38 A;  1S4N A;  1JT5 A;  1YTO A;  1IT0 A;  4KRV A;  1Q03 A;  3NJ5 A;  41BI A;  3R4U A;  2ESU A;  1R7Y A;  1BFC A;  2J3P A;  5IDS A;  4J23 B;  1V6U A;  1WSZ A;  3IAG C;  1GX0 A;  1BFF A;  4HO9 A;  5B2H A;  1MC9 A;  1IOB A;  3P6I A;  4IY8 A;  3FFZ A;  1H5R A;  3I0D A;  1Z2V A;  4I4S A;  4HO4 A;  1WVC A;  3UDA A;  3JUK A;  4KQL A;  3E8L C;  3RMX A;  1NF5 B;  5CQM X;  3AZV A;  2FYD B;  2VSH A;  3FJJ A;  1DZC A;  3D8V A;  3BX1 C;  1JVG A;  1VPA A;  4YS8 A;  1T4Q A;  4TLP A;  4KC1 A;  5DDT A;  1WBA A;  2F2F C;  4Z9W B;  2AGD A;  3N7K A;  2ZU8 A;  1G97 A;  1ZCT A;  3U2T A;  2RJ1 A;  5CQO A;  3OH4 A;  1OQM B;  2YQS A;  3FJH A;  3B9U A;  4LO1 A;  2PX7 A;  2V0I A;  4G3S A;  4ZFY B;  6I1B A;  3V8Y A;  2VSA A;  3JRR A;  5BXR A;  1ZIZ A;  5I1F A;  1QQL A;  3BAH A;  3V0A B;  1HIB A;  3AH2 A;  1XZ6 A;  1TWM A;  3O5W B;  1HWN B;  4P0J A;  1VZX A;  1FWV A;  3V0P A;  2VXL A;  2ICX A;  2FDB M;  1R7T A;  3WO2 A;  1FO8 A;  4Q9P A;  3OGF A;  2OEF A;  1YP4 A;  2X5Z A;  5D62 A;  3FUO A;  3V79 C;  4D0T A;  3K8E A;  3I2X A;  3Q4S A;  4G9M A;  1FZW A;  1BAR A;  5BP5 C;  3AKG A;  1LL3 A;  5BQU C;  3H6Q A;  3WMU A;  1HKN A;  2NXV A;  5C36 A;  2DRZ A;  5FNW A;  1ZJP A;  2MC2 A;  2NP0 A;  5EJZ A;  5C3D A;  5C38 A;  4AC3 A;  1L2H A;  1JT7 A;  4IYB A;  1H5S A;  3T7M A;  1DFC A;  4M4K A;  1MD6 A;  4R7P A;  4ZOT A;  3UD9 A;  3WMV A;  3BAO A;  1QWJ A;  2P6W A;  4LO2 A;  2XME A;  2P39 A;  2YQH A;  4FRD A;  4END A;  3LTQ A;  2V0H A;  1WT3 A;  1NUN A;  2AAI B;  2ZR1 B;  2OI6 A;  4EVW A;  4FQW A;  2MLL B;  3P6J A;  3WA1 A;  4HO2 A;  4JKQ A;  2VSE A;  1WT0 A;  5C4F A;  4LW3 A;  3LLP A;  4HOC A;  4EE3 A;  3CA6 A;  3OBR A;  4R6U B;  1HWP B;  1R81 A;  2APC A;  1ZCU A;  1FV2 A;  4IZE A;  2D23 A;  2P73 A;  1DQO A;  3EF2 A;  4ZFU B;  3AH4 A;  1GGP B;  1DJS B;  3AJ5 A;  1WD4 A;  3HBW A;  4I4X A;  4QKS A;  1MP4 A;  2VS4 A;  2WGZ A;  1QGS A;  3WO3 A;  4JKX B;  1VGZ A;  1NZK A;  2VU9 A;  2GZB A;  4JP0 A;  5F8W A;  2A8U A;  8I1B A;  4HO0 A;  2QN4 A;  3E25 A;  3F1Y A;  4IZX A;  1R8O A;  1IIN A;  2RIT A;  2WVK A;  3BAV A;  4I6I A;  4M2B A;  2ET2 A;  4DDZ A;  1RG8 A;  1VGW A;  3W9T A;  2D7I A;  2X2S A;  4EFQ A;  1VH3 A;  2I1B A;  3U0Y A;  1LZI A;  2OI5 A;  2M49 A;  3SX8 A;  3V0B B;  2VFZ A;  3UD7 A;  2NTD A;  4HG6 A;  2NM1 A;  5BXS A;  1TIE A;  4JRA A;  4E1K A;  3Q7U A;  4OUJ A;  2YUG A;  2RIY A;  1WD3 A;  5EIY A;  1BA7 A;  2VXR A;  4I3N A;  5FZU A;  3S8J A;  3O4C A;  4FVV A;  1RZO B;  2I5K A;  1G95 A;  1YP2 A;  5BXC A;  2IHO A;  4EEE B;  3I0L A;  2AM4 A;  1AFC A;  1JV3 A;  2QGI A;  2FYB A;  1ISY A;  1TTU A;  3I29 B;  1ON8 A;  1SS9 A;  1G82 A;  1ZI1 A;  1G0R A;  3O49 A;  1TW5 A;  2Z49 A;  2L5X A;  9ILB A;  1MP3 A;  1NWG B;  4ZKT B;  5F90 A;  2I7B A;  5FU0 A;  4AN6 A;  1QGQ A;  1HV9 A;  3FJF A;  3VWC A;  4PC4 A;  4IY9 A;  2AE7 A;  2RQ9 A;  4QD2 C;  2WVM A;  2XWL A;  2RST A;  4ECM A;  3UD8 A;  1JT3 A;  3HSM A;  3PME A;  4QBC A;  3AKI A;  3ZX7 A;  2K4A B;  1FG5 N;  1DFQ A;  1H5S C;  3A23 A;  3O3Q A;  4EB2 B;  4DEC A;  4FRP A;  2V0L A;  5CQP A;  1P63 A;  4IHZ A;  4LO2 C;  1K4V A;  4I4R A;  4GOY A;  3IIR A;  3BRF A;  2VD4 A;  5DSS B;  4DE7 A;  21BI A;  4QD2 B;  4Y6U A;  1D0H A;  1W3A A;  1YF8 B;  3SXA A; 
#chains in the Genus database with same CATH topology
 2GGO A;  4EFR A;  4CJC A;  4ISR A;  4KEK A;  3HL3 A;  2KKI A;  1ZI3 A;  1I1B A;  2GGQ A;  2BFH A;  4QC4 A;  4B4G A;  1PZY B;  4UY4 A;  1VGU A;  1SZ6 B;  4Y7F A;  2YCM A;  2RJ8 A;  1FOA A;  1H4E A;  4USP A;  1IHK A;  2D7R A;  1AXM A;  4LO0 A;  2K43 A;  3CA4 A;  3O4B A;  1G2V A;  1H7E A;  1ZJ2 A;  2I5E A;  3PKP A;  3ZC9 A;  1WT1 A;  2E3D A;  3PHZ A;  2V0J A;  1XZZ A;  3V0M A;  4X39 A;  1JVD A;  3UJ4 A;  5AJO A;  1ABR B;  1JTC A;  5FUH A;  4ASJ A;  4Q91 A;  1J0S A;  3VT2 A;  3R3I A;  3N0K A;  3DK5 A;  3U0X A;  5G00 A;  1HCD A;  1H7H A;  1OMX A;  2OI7 A;  2X5S A;  1ZDG A;  3OH2 A;  3SX7 A;  3OC9 A;  4FRE A;  4CJ8 A;  3OGZ A;  3MPP G;  3D5N A;  3I0E A;  4Y6N A;  4HO3 A;  2Z48 A;  4LW6 A;  4OWK A;  2E4M C;  4Y7T A;  2NS2 A;  3R4S A;  1T9F A;  3BB2 A;  3FOQ A;  4BQH A;  1G9A A;  1FWY A;  3ILA A;  2HWM A;  3ZLL A;  3ZXG A;  1FR9 A;  3CRH A;  4A7Y A;  2AEC A;  3N7L A;  3I0J A;  2WBC A;  3I0I X;  4Z8S B;  4FRO A;  3T7O A;  4F34 A;  1FO9 A;  3TQD A;  4I4Y A;  2Q4J A;  3IOJ A;  3P53 A;  2JCL A;  2NVH A;  5CMJ A;  3U2U A;  1R7U A;  3V0L A;  1ILR 1;  4KC4 A;  5CQN X;  3TZT A;  5C3A A;  1PUM B;  3TC2 A;  1O23 B;  3BCV A;  3R2W A;  3BA4 A;  1S0D A;  4FRQ A;  4P00 A;  5AJP A;  1TW1 A;  4B4B A;  3V90 A;  3O4D A;  1GQ9 A;  4ZLB B;  5BXT A;  1ZI5 A;  2NYY A;  1HCE A;  5D91 A;  3IOI A;  3F62 B;  4EEG A;  2AXM A;  4EEM A;  2QKX A;  4B2W A;  5C4B A;  3VUO A;  1FR8 A;  1G9D A;  2JCK A;  3V0N A;  1FWU A;  2LIE A;  1H7F A;  1ZJ3 A;  2J0A A;  3D7W B;  3ZF8 A;  2D1Z A;  3VSF A;  3PNN A;  2FO1 A;  1H5S D;  4H9W A;  2R9K B;  2Y7A A;  2HZ9 A;  3WIN C;  1DZD A;  4HO8 A;  4GAI A;  1JLY A;  1E5K A;  2YC5 A;  1BFB A;  2VXT I;  1YRO B;  2RJ0 A;  1AVA C;  1VM8 A;  2V0K A;  4LO3 C;  1H5T A;  2XWM A;  3IOH A;  3JTJ A;  3ZGG A;  4B4M A;  3BA7 A;  1HM8 A;  2WAW A;  3BAG A;  3E26 A;  5CMF X;  1XHB A;  2Z87 A;  2RJ5 A;  4I4V A;  3FUQ A;  5F8Y A;  1NMM B;  2Y4M A;  1NQI B;  3D98 A;  3SXB A;  4ASY A;  3IM5 A;  4UEG A;  1TOO A;  3SNV A;  31BI A;  1FRW A;  3H6R B;  1H7L A;  1TZF A;  3JUJ A;  4KT7 A;  4I8M A;  5C48 A;  3VT1 A;  3CRI A;  3IM6 A;  1S0L A;  5HPZ A;  3Q7W A;  2D0J A;  3NBE A;  2Y9F A;  3BA5 A;  1R80 A;  3KIA A;  2WRY A;  1GA8 A;  1TWE A;  3FJD A;  3OH1 A;  2GO2 A;  3USQ A;  4D8H A;  4C2S A;  1YP3 A;  1FGX A;  1JYK A;  1TFM B;  3NBD A;  4NAI A;  4A7K A;  1WBC A;  1H4C A;  4OWL A;  3AZW A;  4I2S A;  4LO0 C;  2YC3 A;  3POL A;  4XFU A;  1ZJ1 A;  4I4Q A;  3CKN A;  5DZU A;  4LO7 C;  5C49 A;  1H7G A;  1YYN A;  2WEE A;  1JYL A;  1H7Q A;  3OAM A;  2AM3 A;  3K1X A;  3USR A;  1ZJ0 A;  3SX3 A;  1HM0 A;  1EZI A;  4KXO A;  5L6S A;  1H4D A;  1ZHJ A;  1ZCY A;  2Y4L A;  1LZJ A;  4Y7U A;  4NAK A;  2QYI B;  4IQP A;  2Z86 A;  1PWA A;  2KLL A;  4G6M A;  4HO5 A;  1S0F A;  1Q04 A;  2IWT B;  1UPS A;  3FJC A;  1INJ A;  4MIX A;  4NAL A;  5D92 A;  1V6X A;  5C1H A;  4OW4 A;  1AVW B;  2LIQ A;  5CQL X;  1PUU B;  4J2Y A;  4LO7 B;  1G9B A;  1JV1 A;  1VZT A;  2VSI A;  4B2X A;  1O0R A;  1H5R B;  1OQL B;  2ZQO A;  1S4O A;  1VZU A;  4AYJ A;  1G23 A;  2VLC A;  3N9W A;  4EKX B;  4KNX A;  2D44 A;  1V83 A;  4M28 A;  2RG9 B;  4LO1 C;  2JCO A;  3ZXD A;  5BOW A;  1DQG A;  4ZFW B;  4G6J A;  1GWW A;  1GWV A;  3CKJ A;  4G3Q A;  2MIB A;  4KNR A;  3ZLK A;  1IIM A;  1II4 A;  1ZJO A;  2UX8 A;  1DIW A;  1R7X A;  2HW9 A;  3FJ8 A;  1G9C A;  4FRA A;  1W57 A;  1PZT A;  2RJ6 A;  3RSJ A;  3CQA A;  3SXE A;  4KEJ A;  3NBC A;  2WE9 A;  3SX5 A;  3V0A A;  3F1R A;  3Q80 A;  4FRB A;  1ON6 A;  5AJN A;  5EC5 A;  4D11 A;  1VCL A;  4XKI A;  4L41 C;  4I37 A;  1H7T A;  4P0K A;  1VIC A;  4AN7 B;  3OJM A;  3ST8 A;  2P23 A;  3I0G A;  1LVW A;  5J49 A;  2Y4K A;  4J18 A;  3V91 A;  4GAF A;  4J2K A;  4OWJ A;  1G8O A;  4I4U A;  1HM9 A;  2RJ4 A;  3K8D A;  5L6V A;  1VH1 A;  3QYD A;  5GAQ A;  3BRG C;  4JPZ A;  4FRM A;  5C47 A;  1EV2 A;  3CA3 A;  4KBB A;  2BO7 A;  3I0F A;  3RMW A;  1S0G A;  1Z90 A;  2YES A;  1FN0 A;  3AKF A;  4X37 A;  4XFS A;  4K6R A;  3I0C A;  5C4C A;  4NAN A;  1E0O A;  2Q9X A;  4YOL A;  1FXJ A;  1R8N A;  5DUY A;  2E8B A;  2QH5 A;  1YBI A;  4DCK C;  5BXP A;  5CMG X;  1JY0 A;  1YXW A;  5EHA A;  4Q9G A;  4USO A;  3IM7 A;  1IJT A;  1MC3 A;  3RMV A;  3V0O A;  3O4A A;  1HWM B;  2FFV A;  1I52 A;  2X2T A;  3CGX A;  4FCU A;  1M2T B;  1H5S B;  4JAW A;  4D0Z A;  1EVT A;  2O1H A;  4HJJ A;  1JT4 A;  5BP5 A;  5BVP I;  3KMV A;  2OEG A;  3Q7Y A;  5IDT A;  2O1G A;  1FMZ A;  1CVS A;  2VUA A;  1GX4 A;  2ICY A;  2AES A;  4I7I A;  2XOA A;  3SXG A;  4WBC A;  2ERM A;  3Q7X A;  2VXM A;  2W0W A;  4H04 A;  1ISZ A;  4JQ0 A;  2ZU7 A;  4GP3 A;  2FYC B;  2Y6P A;  3DJ4 A;  2F8X C;  1W77 A;  4EEO A;  4EE5 A;  1AVU A;  2XMH A;  4G87 A;  4Y9X A;  1BFG A;  2D20 A;  4OEF A;  2PA4 A;  4L4H A;  1V82 A;  3OJV A;  3NBN A;  1W55 A;  2CU2 A;  3RMY A;  3SXD A;  1INI A;  1QQK A;  1ZI4 A;  3FJK A;  2ZQN A;  3T8S A;  1G1L A;  1Z4S A;  2O1F A;  3CKO A;  2DRE A;  5CMH A;  2RJ9 A;  4EE4 A;  1ISW A;  1VGT A;  5F8S A;  2P72 A;  2AM5 A;  3ZGF A;  3T7N A;  4AAW A;  2WVL A;  3H6S E;  1FQ9 A;  3S8K A;  3FJ9 A;  5FYE A;  1PZZ A;  4I96 A;  4G3P A;  5HS2 A;  3PG0 A;  4KC2 A;  2HWA A;  2PGV A;  2BO4 A;  1ITB A;  3OJ2 A;  1RY7 A;  5I1B A;  2D43 A;  2YQC A;  3V0B A;  1QXM A;  4MZG B;  1ISV A;  4XWI A;  1SR4 A;  1CE7 B;  2D22 A;  4GOV A;  4HA2 A;  3GUE A;  3AH1 A;  1XG6 A;  1S4P A;  4CJB A;  3HN1 A;  1HJL A;  4QKR A;  3V8Z A;  3BTA A;  4ZBV B;  4O6N A;  4BMA A;  4GP0 A;  2W0V A;  4X3A A;  3C9Z A;  4MND A;  4MYB A;  4D11 C;  2BO6 A;  4HR6 C;  1V6W A;  5FNX A;  4EFP A;  3BRD A;  1V6V A;  1MP5 A;  3DUV A;  1AF9 A;  3FGM A;  3HMY A;  1O7O A;  3QVB A;  4IRQ A;  5FU8 A;  3OH0 A;  3CA5 A;  4B3U A;  3AKH A;  4ISQ A;  4II0 A;  3A07 A;  4J2X A;  2Y9G A;  1LZ0 A;  2BO8 A;  1Q1U A;  2PGY A;  1LZ7 A;  3QR5 A;  3CKQ A;  3I0H A;  3SXC A;  1EPW A;  1W3F A;  4OEG A;  4H75 A;  4F83 A;  2JCJ A;  1ONK B;  3UJ0 A;  5EJ1 A;  3A22 A;  1PC8 B;  2XWN A;  3AJ6 A;  1F31 A;  5JQQ A;  2BEB A;  4KPZ A;  3CU1 B;  1ISX A;  2VK9 A;  4A7Z A;  2Q3N B;  1S0E A;  4ZA3 B;  2AQZ A;  5C4E A;  1G9R A;  3I2A A;  2DS0 A;  2MZB A;  3RTI B;  5DDV A;  1FGG A;  2FYA A;  3V0Q A;  1OMZ A;  4EEA A;  5C4D A;  2KI6 B;  1XYF A;  4FGF A;  1ZCV A;  4DEN A;  4Y7V A;  3CRG A;  3OBT A;  4ZGR B;  1I1E A;  2C0N A;  1IRA X;  1JQZ A;  1O7Q A;  4QO3 A;  4P6A A;  1HWO B;  2DRY A;  3FWW A;  3U2W A;  7I1B A;  5FZZ A;  1NHE B;  5C3B A;  2KH2 A;  1FGA A;  1S0C A;  4OEE A;  4GBP A;  1FMM S;  3N7J A;  4KEI A;  4DEP A;  2ZU9 A;  4Y64 A;  5C8R A;  5JMC A;  4HCQ A;  3RSB A;  1K5V A;  4FRH A;  4Y62 A;  1BLA A;  4Y7G A;  4I0Y A;  1R7V A;  1R82 A;  3OKR A;  1AVX B;  1Z0H A;  2YQJ A;  3BAQ A;  5CMI A;  1M16 A;  1N4K A;  3ZC8 A;  2Y9W C;  3CA1 A;  3CAH A;  3NGW A;  4B42 A;  2NZ9 A;  1JLX A;  1EYL A;  2K8R A;  4M2A A;  3FJI A;  5C1G A;  1H3M A;  2UUS A;  3FJA A;  1BLD A;  1ZDF A;  3F1C A;  3BAD A;  1SR4 C;  4XFT A;  3PUB A;  1KNM A;  2A8W A;  3FJE A;  1EYR A;  4ARW A;  4IRP A;  1W3G A;  5FV9 A;  2FFU A;  2DPW A;  2E4M A;  2F2F A;  4I4O A;  1IIL A;  1FV3 A;  3VSZ A;  1V84 A;  4FRL A;  4CJM A;  4D48 A;  1BAS A;  1HJJ A;  1K5U A;  4P0L A;  4I1B A;  3OH3 A;  4JIS A;  2Y4J A;  5FTV A;  4ZDQ A;  3CU0 A;  5EG6 C;  4I1E A;  5FZY A;  2D24 A;  2KI4 A;  2AH9 A;  3POK A;  2X60 A;  4ION A;  1KWS A;  5D63 A;  3MAL A;  5D61 A;  1G3L A;  2RIX A;  2X65 A;  4HO6 A;  4JD0 A;  4L4I A;  2Y9X E;  1RML A;  3OGG A;  3CA0 A;  2BEA A;  1IRP A;  1TVY A;  4Y63 A;  1A8D A;  4KC3 A;  3VEQ A;  1G93 A;  2RIZ A;  3O3P A;  3N7M A;  4QAL A;  5JLV A;  1FXO A;  1H5T B;  4I4P A;  5BQU A;  2FGF A;  4G1R A;  3A21 A;  4LO8 B;  2VS5 A;  3VT0 A;  4AYL A;  5IFY A;  1QG8 A;  1WT2 A;  3O4O A;  2AFG A;  5DVH A;  3WIN A;  3I0K A;  3LW6 A;  2FY7 A;  2VS3 A;  3H6R A;  3O44 A;  3FJB A;  4LO3 A;  4B5B A;  3BAU A;  1GQC A;  3WO4 A;  5C1L A;  4CVH A;  5E24 E;  3JUT A;  3RTJ B;  1NKH B;  3EE5 A;  3U2X A;  1TP0 A;  4G9N A;  3PKQ A;  4QBV A;  4KPX A;  4P02 A;  3HAL A;  2RJ7 A;  1DLL A;  1LL0 A;  1LL2 A;  3CKV A;  3HOM A;  5FTS A;  3U2V A;  3SPT A;  4J2S A;  3BRK X;  4FCE A;  1S0B A;  4X38 A;  1S4N A;  1JT5 A;  1YTO A;  1IT0 A;  4MZH A;  1Q03 A;  4KRV A;  3NJ5 A;  41BI A;  3R4U A;  2ESU A;  1R7Y A;  1BFC A;  2J3P A;  5IDS A;  4J23 B;  1V6U A;  1WSZ A;  3IAG C;  1GX0 A;  1BFF A;  4HO9 A;  5B2H A;  1MC9 A;  1IOB A;  3P6I A;  4IY8 A;  4FIX A;  3FFZ A;  1H5R A;  3I0D A;  1Z2V A;  4I4S A;  4HO4 A;  1WVC A;  3UDA A;  3JUK A;  4KQL A;  3E8L C;  3RMX A;  1NF5 B;  5CQM X;  3AZV A;  2FYD B;  2VSH A;  3FJJ A;  1DZC A;  3D8V A;  3BX1 C;  1JVG A;  1VPA A;  4YS8 A;  1T4Q A;  4TLP A;  4KC1 A;  5DDT A;  1WBA A;  2F2F C;  4Z9W B;  2AGD A;  3N7K A;  2ZU8 A;  1G97 A;  1ZCT A;  3U2T A;  2RJ1 A;  5CQO A;  3OH4 A;  1OQM B;  2YQS A;  3FJH A;  3B9U A;  4LO1 A;  2PX7 A;  2V0I A;  4G3S A;  4ZFY B;  6I1B A;  3V8Y A;  2VSA A;  3JRR A;  5BXR A;  1ZIZ A;  4Q7C A;  1QQL A;  5I1F A;  3BAH A;  3V0A B;  1HIB A;  3AH2 A;  1XZ6 A;  1TWM A;  3O5W B;  4FIY A;  1HWN B;  4P0J A;  1VZX A;  1FWV A;  3V0P A;  2VXL A;  2ICX A;  2FDB M;  1R7T A;  3WO2 A;  1FO8 A;  4Q9P A;  2J0B A;  3OGF A;  2OEF A;  1YP4 A;  2X5Z A;  5D62 A;  3FUO A;  3V79 C;  4D0T A;  3K8E A;  3I2X A;  3Q4S A;  4G9M A;  1FZW A;  1BAR A;  5BP5 C;  3AKG A;  1LL3 A;  5BQU C;  3H6Q A;  3WMU A;  1HKN A;  2NXV A;  5C36 A;  2DRZ A;  5FNW A;  1ZJP A;  2MC2 A;  2NP0 A;  5EJZ A;  5C3D A;  5C38 A;  4AC3 A;  1L2H A;  1JT7 A;  4IYB A;  1H5S A;  3T7M A;  1DFC A;  4M4K A;  1MD6 A;  4R7P A;  4ZOT A;  3UD9 A;  3WMV A;  3BAO A;  1QWJ A;  2P6W A;  4LO2 A;  2XME A;  2P39 A;  2YQH A;  4FRD A;  4END A;  3LTQ A;  2V0H A;  1WT3 A;  1NUN A;  2AAI B;  2ZR1 B;  2OI6 A;  4EVW A;  4FQW A;  2MLL B;  3P6J A;  3WA1 A;  4HO2 A;  4JKQ A;  2VSE A;  1WT0 A;  5C4F A;  4LW3 A;  3LLP A;  4HOC A;  4EE3 A;  3CA6 A;  3OBR A;  4R6U B;  1HWP B;  1R81 A;  2APC A;  1ZCU A;  1FV2 A;  4IZE A;  2D23 A;  2P73 A;  1DQO A;  3EF2 A;  4ZFU B;  3AH4 A;  1GGP B;  1DJS B;  3AJ5 A;  1WD4 A;  3HBW A;  4I4X A;  4QKS A;  1MP4 A;  2VS4 A;  2WGZ A;  1QGS A;  3WO3 A;  4JKX B;  1VGZ A;  1NZK A;  2VU9 A;  2GZB A;  4JP0 A;  5F8W A;  2A8U A;  8I1B A;  4HO0 A;  2QN4 A;  3E25 A;  3F1Y A;  4IZX A;  1R8O A;  1IIN A;  2RIT A;  2WVK A;  3BAV A;  4I6I A;  4M2B A;  2ET2 A;  4DDZ A;  1RG8 A;  1VGW A;  3W9T A;  2D7I A;  2X2S A;  4EFQ A;  1VH3 A;  2I1B A;  3U0Y A;  1LZI A;  2OI5 A;  2M49 A;  4MZF B;  3SX8 A;  3V0B B;  2VFZ A;  3UD7 A;  2NTD A;  4HG6 A;  2NM1 A;  5BXS A;  1TIE A;  4JRA A;  4E1K A;  3Q7U A;  4OUJ A;  2YUG A;  2RIY A;  1WD3 A;  5EIY A;  1BA7 A;  2VXR A;  4I3N A;  5FZU A;  3S8J A;  3O4C A;  4FVV A;  1RZO B;  2I5K A;  1G95 A;  1YP2 A;  5BXC A;  2IHO A;  4EEE B;  3I0L A;  2AM4 A;  1AFC A;  1JV3 A;  2QGI A;  2FYB A;  1ISY A;  1TTU A;  3I29 B;  1ON8 A;  1SS9 A;  1G82 A;  1ZI1 A;  1G0R A;  3O49 A;  1TW5 A;  2Z49 A;  2L5X A;  9ILB A;  1MP3 A;  1NWG B;  4ZKT B;  5F90 A;  2I7B A;  5FU0 A;  4AN6 A;  1QGQ A;  1HV9 A;  3FJF A;  3VWC A;  4PC4 A;  4IY9 A;  2AE7 A;  2RQ9 A;  4QD2 C;  2WVM A;  2XWL A;  2RST A;  4ECM A;  3UD8 A;  1JT3 A;  3HSM A;  3PME A;  4QBC A;  3AKI A;  3ZX7 A;  2K4A B;  1FG5 N;  1DFQ A;  1H5S C;  3A23 A;  3O3Q A;  4EB2 B;  4DEC A;  4FRP A;  2V0L A;  5CQP A;  1P63 A;  4IHZ A;  4LO2 C;  1K4V A;  4I4R A;  4GOY A;  3IIR A;  3BRF A;  2VD4 A;  5DSS B;  4DE7 A;  21BI A;  4QD2 B;  4Y6U A;  1D0H A;  1W3A A;  1YF8 B;  3SXA A;  4O6M A; 
#chains in the Genus database with same CATH homology
 2GGO A;  4EFR A;  4CJC A;  4ISR A;  4KEK A;  3HL3 A;  2KKI A;  1ZI3 A;  1I1B A;  2GGQ A;  2BFH A;  4QC4 A;  4B4G A;  1PZY B;  4UY4 A;  1VGU A;  1SZ6 B;  4Y7F A;  2YCM A;  2RJ8 A;  1FOA A;  1H4E A;  4USP A;  1IHK A;  2D7R A;  1AXM A;  4LO0 A;  2K43 A;  3CA4 A;  3O4B A;  1G2V A;  1H7E A;  1ZJ2 A;  2I5E A;  3PKP A;  3ZC9 A;  1WT1 A;  2E3D A;  3PHZ A;  2V0J A;  1XZZ A;  3V0M A;  4X39 A;  1JVD A;  3UJ4 A;  5AJO A;  1ABR B;  1JTC A;  5FUH A;  4ASJ A;  4Q91 A;  1J0S A;  3VT2 A;  3R3I A;  3N0K A;  3DK5 A;  3U0X A;  5G00 A;  1HCD A;  1H7H A;  1OMX A;  2OI7 A;  2X5S A;  1ZDG A;  3OH2 A;  3SX7 A;  3OC9 A;  4FRE A;  4CJ8 A;  3OGZ A;  3MPP G;  3D5N A;  3I0E A;  4Y6N A;  4HO3 A;  2Z48 A;  4LW6 A;  4OWK A;  2E4M C;  4Y7T A;  2NS2 A;  3R4S A;  1T9F A;  3BB2 A;  3FOQ A;  4BQH A;  1G9A A;  1FWY A;  3ILA A;  2HWM A;  3ZLL A;  3ZXG A;  1FR9 A;  3CRH A;  4A7Y A;  2AEC A;  3N7L A;  3I0J A;  2WBC A;  3I0I X;  4Z8S B;  4FRO A;  3T7O A;  4F34 A;  1FO9 A;  3TQD A;  4I4Y A;  2Q4J A;  3IOJ A;  3P53 A;  2JCL A;  2NVH A;  5CMJ A;  3U2U A;  1R7U A;  3V0L A;  1ILR 1;  4KC4 A;  5CQN X;  3TZT A;  5C3A A;  1PUM B;  3TC2 A;  1O23 B;  3BCV A;  3R2W A;  3BA4 A;  1S0D A;  4FRQ A;  4P00 A;  5AJP A;  1TW1 A;  4B4B A;  3V90 A;  3O4D A;  1GQ9 A;  4ZLB B;  5BXT A;  1ZI5 A;  2NYY A;  1HCE A;  5D91 A;  3IOI A;  3F62 B;  4EEG A;  2AXM A;  4EEM A;  2QKX A;  4B2W A;  5C4B A;  3VUO A;  1FR8 A;  1G9D A;  2JCK A;  3V0N A;  1FWU A;  2LIE A;  1H7F A;  1ZJ3 A;  2J0A A;  3D7W B;  3ZF8 A;  2D1Z A;  3VSF A;  3PNN A;  2FO1 A;  1H5S D;  4H9W A;  2R9K B;  2Y7A A;  2HZ9 A;  3WIN C;  1DZD A;  4HO8 A;  4GAI A;  1JLY A;  1E5K A;  2YC5 A;  1BFB A;  2VXT I;  1YRO B;  2RJ0 A;  1AVA C;  1VM8 A;  2V0K A;  4LO3 C;  1H5T A;  2XWM A;  3IOH A;  3JTJ A;  3ZGG A;  4B4M A;  3BA7 A;  1HM8 A;  2WAW A;  3BAG A;  3E26 A;  5CMF X;  1XHB A;  2Z87 A;  2RJ5 A;  4I4V A;  3FUQ A;  5F8Y A;  1NMM B;  2Y4M A;  1NQI B;  3D98 A;  3SXB A;  4ASY A;  3IM5 A;  4UEG A;  1TOO A;  3SNV A;  31BI A;  1FRW A;  3H6R B;  1H7L A;  1TZF A;  3JUJ A;  4KT7 A;  4I8M A;  5C48 A;  3VT1 A;  3CRI A;  3IM6 A;  1S0L A;  5HPZ A;  3Q7W A;  2D0J A;  3NBE A;  2Y9F A;  3BA5 A;  1R80 A;  3KIA A;  2WRY A;  1GA8 A;  1TWE A;  3FJD A;  3OH1 A;  2GO2 A;  3USQ A;  4D8H A;  4C2S A;  1YP3 A;  1FGX A;  1JYK A;  1TFM B;  3NBD A;  4NAI A;  4A7K A;  1WBC A;  1H4C A;  4OWL A;  3AZW A;  4I2S A;  4LO0 C;  2YC3 A;  3POL A;  4XFU A;  1ZJ1 A;  4I4Q A;  3CKN A;  5DZU A;  4LO7 C;  5C49 A;  1H7G A;  1YYN A;  2WEE A;  1JYL A;  1H7Q A;  3OAM A;  2AM3 A;  3K1X A;  3USR A;  1ZJ0 A;  3SX3 A;  1HM0 A;  1EZI A;  4KXO A;  5L6S A;  1H4D A;  1ZHJ A;  1ZCY A;  2Y4L A;  1LZJ A;  4Y7U A;  4NAK A;  2QYI B;  4IQP A;  2Z86 A;  1PWA A;  2KLL A;  4G6M A;  4HO5 A;  1S0F A;  1Q04 A;  2IWT B;  1UPS A;  3FJC A;  1INJ A;  4MIX A;  4NAL A;  5D92 A;  1V6X A;  5C1H A;  4OW4 A;  1AVW B;  2LIQ A;  5CQL X;  1PUU B;  4J2Y A;  4LO7 B;  1G9B A;  1JV1 A;  1VZT A;  2VSI A;  4B2X A;  1O0R A;  1H5R B;  1OQL B;  2ZQO A;  1S4O A;  1VZU A;  4AYJ A;  1G23 A;  2VLC A;  3N9W A;  4EKX B;  4KNX A;  2D44 A;  1V83 A;  4M28 A;  2RG9 B;  4LO1 C;  2JCO A;  3ZXD A;  5BOW A;  1DQG A;  4ZFW B;  4G6J A;  1GWW A;  1GWV A;  3CKJ A;  4G3Q A;  2MIB A;  4KNR A;  3ZLK A;  1IIM A;  1II4 A;  1ZJO A;  2UX8 A;  1DIW A;  1R7X A;  2HW9 A;  3FJ8 A;  1G9C A;  4FRA A;  1W57 A;  1PZT A;  2RJ6 A;  3RSJ A;  3CQA A;  3SXE A;  4KEJ A;  3NBC A;  2WE9 A;  3SX5 A;  3V0A A;  3F1R A;  3Q80 A;  4FRB A;  1ON6 A;  5AJN A;  5EC5 A;  4D11 A;  1VCL A;  4XKI A;  4L41 C;  4I37 A;  1H7T A;  4P0K A;  1VIC A;  4AN7 B;  3OJM A;  3ST8 A;  2P23 A;  3I0G A;  1LVW A;  5J49 A;  2Y4K A;  4J18 A;  3V91 A;  4GAF A;  4J2K A;  4OWJ A;  1G8O A;  4I4U A;  1HM9 A;  2RJ4 A;  3K8D A;  5L6V A;  1VH1 A;  3QYD A;  5GAQ A;  3BRG C;  4JPZ A;  4FRM A;  5C47 A;  1EV2 A;  3CA3 A;  4KBB A;  2BO7 A;  3I0F A;  3RMW A;  1S0G A;  1Z90 A;  2YES A;  1FN0 A;  3AKF A;  4X37 A;  4XFS A;  4K6R A;  3I0C A;  5C4C A;  4NAN A;  1E0O A;  2Q9X A;  4YOL A;  1FXJ A;  1R8N A;  5DUY A;  2E8B A;  2QH5 A;  1YBI A;  4DCK C;  5BXP A;  5CMG X;  1JY0 A;  1YXW A;  5EHA A;  4Q9G A;  4USO A;  3IM7 A;  1IJT A;  1MC3 A;  3RMV A;  3V0O A;  3O4A A;  1HWM B;  2FFV A;  1I52 A;  2X2T A;  3CGX A;  4FCU A;  1M2T B;  1H5S B;  4JAW A;  4D0Z A;  1EVT A;  2O1H A;  4HJJ A;  1JT4 A;  5BP5 A;  5BVP I;  3KMV A;  2OEG A;  3Q7Y A;  5IDT A;  2O1G A;  1FMZ A;  1CVS A;  2VUA A;  1GX4 A;  2ICY A;  2AES A;  4I7I A;  2XOA A;  3SXG A;  4WBC A;  2ERM A;  3Q7X A;  2VXM A;  2W0W A;  4H04 A;  1ISZ A;  4JQ0 A;  2ZU7 A;  4GP3 A;  2FYC B;  2Y6P A;  3DJ4 A;  2F8X C;  1W77 A;  4EEO A;  4EE5 A;  1AVU A;  2XMH A;  4G87 A;  4Y9X A;  1BFG A;  2D20 A;  4OEF A;  2PA4 A;  4L4H A;  1V82 A;  3OJV A;  3NBN A;  1W55 A;  2CU2 A;  3RMY A;  3SXD A;  1INI A;  1QQK A;  1ZI4 A;  3FJK A;  2ZQN A;  3T8S A;  1G1L A;  1Z4S A;  2O1F A;  3CKO A;  2DRE A;  5CMH A;  2RJ9 A;  4EE4 A;  1ISW A;  1VGT A;  5F8S A;  2P72 A;  2AM5 A;  3ZGF A;  3T7N A;  4AAW A;  2WVL A;  3H6S E;  1FQ9 A;  3S8K A;  3FJ9 A;  5FYE A;  1PZZ A;  4I96 A;  4G3P A;  5HS2 A;  3PG0 A;  4KC2 A;  2HWA A;  2PGV A;  2BO4 A;  1ITB A;  3OJ2 A;  1RY7 A;  5I1B A;  2D43 A;  2YQC A;  3V0B A;  1QXM A;  4MZG B;  1ISV A;  4XWI A;  1SR4 A;  1CE7 B;  2D22 A;  4GOV A;  4HA2 A;  3GUE A;  3AH1 A;  1XG6 A;  1S4P A;  4CJB A;  3HN1 A;  1HJL A;  4QKR A;  3V8Z A;  3BTA A;  4ZBV B;  4O6N A;  4BMA A;  4GP0 A;  2W0V A;  4X3A A;  3C9Z A;  4MND A;  4MYB A;  4D11 C;  2BO6 A;  4HR6 C;  1V6W A;  5FNX A;  4EFP A;  3BRD A;  1V6V A;  1MP5 A;  3DUV A;  1AF9 A;  3FGM A;  3HMY A;  1O7O A;  3QVB A;  4IRQ A;  5FU8 A;  3OH0 A;  3CA5 A;  4B3U A;  3AKH A;  4ISQ A;  4II0 A;  3A07 A;  4J2X A;  2Y9G A;  1LZ0 A;  2BO8 A;  1Q1U A;  2PGY A;  1LZ7 A;  3QR5 A;  3CKQ A;  3I0H A;  3SXC A;  1EPW A;  1W3F A;  4OEG A;  4H75 A;  4F83 A;  2JCJ A;  1ONK B;  3UJ0 A;  5EJ1 A;  3A22 A;  1PC8 B;  2XWN A;  3AJ6 A;  1F31 A;  5JQQ A;  2BEB A;  4KPZ A;  3CU1 B;  1ISX A;  2VK9 A;  4A7Z A;  2Q3N B;  1S0E A;  4ZA3 B;  2AQZ A;  5C4E A;  1G9R A;  3I2A A;  2DS0 A;  2MZB A;  3RTI B;  5DDV A;  1FGG A;  2FYA A;  3V0Q A;  1OMZ A;  4EEA A;  5C4D A;  2KI6 B;  1XYF A;  4FGF A;  1ZCV A;  4DEN A;  4Y7V A;  3CRG A;  3OBT A;  4ZGR B;  1I1E A;  2C0N A;  1IRA X;  1JQZ A;  1O7Q A;  4QO3 A;  4P6A A;  1HWO B;  2DRY A;  3FWW A;  3U2W A;  7I1B A;  5FZZ A;  1NHE B;  5C3B A;  2KH2 A;  1FGA A;  1S0C A;  4OEE A;  4GBP A;  1FMM S;  3N7J A;  4KEI A;  4DEP A;  2ZU9 A;  4Y64 A;  5C8R A;  5JMC A;  4HCQ A;  3RSB A;  1K5V A;  4FRH A;  4Y62 A;  1BLA A;  4Y7G A;  4I0Y A;  1R7V A;  1R82 A;  3OKR A;  1AVX B;  1Z0H A;  2YQJ A;  3BAQ A;  5CMI A;  1M16 A;  1N4K A;  3ZC8 A;  2Y9W C;  3CA1 A;  3CAH A;  3NGW A;  4B42 A;  2NZ9 A;  1JLX A;  1EYL A;  2K8R A;  4M2A A;  3FJI A;  5C1G A;  1H3M A;  2UUS A;  3FJA A;  1BLD A;  1ZDF A;  3F1C A;  3BAD A;  1SR4 C;  4XFT A;  3PUB A;  1KNM A;  2A8W A;  3FJE A;  1EYR A;  4ARW A;  4IRP A;  1W3G A;  5FV9 A;  2FFU A;  2DPW A;  2E4M A;  2F2F A;  4I4O A;  1IIL A;  1FV3 A;  3VSZ A;  1V84 A;  4FRL A;  4CJM A;  4D48 A;  1BAS A;  1HJJ A;  1K5U A;  4P0L A;  4I1B A;  3OH3 A;  4JIS A;  2Y4J A;  5FTV A;  4ZDQ A;  3CU0 A;  5EG6 C;  4I1E A;  5FZY A;  2D24 A;  2KI4 A;  2AH9 A;  3POK A;  2X60 A;  4ION A;  1KWS A;  5D63 A;  3MAL A;  5D61 A;  1G3L A;  2RIX A;  2X65 A;  4HO6 A;  4JD0 A;  4L4I A;  2Y9X E;  1RML A;  3OGG A;  3CA0 A;  2BEA A;  1IRP A;  1TVY A;  4Y63 A;  1A8D A;  4KC3 A;  3VEQ A;  1G93 A;  2RIZ A;  3O3P A;  3N7M A;  4QAL A;  5JLV A;  1FXO A;  1H5T B;  4I4P A;  5BQU A;  2FGF A;  4G1R A;  3A21 A;  4LO8 B;  2VS5 A;  3VT0 A;  4AYL A;  5IFY A;  1QG8 A;  1WT2 A;  3O4O A;  2AFG A;  5DVH A;  3WIN A;  3I0K A;  3LW6 A;  2FY7 A;  2VS3 A;  3H6R A;  3O44 A;  3FJB A;  4LO3 A;  4B5B A;  3BAU A;  1GQC A;  3WO4 A;  5C1L A;  4CVH A;  5E24 E;  3JUT A;  3RTJ B;  1NKH B;  3EE5 A;  3U2X A;  1TP0 A;  4G9N A;  3PKQ A;  4QBV A;  4KPX A;  4P02 A;  3HAL A;  2RJ7 A;  1DLL A;  1LL0 A;  1LL2 A;  3CKV A;  3HOM A;  5FTS A;  3U2V A;  3SPT A;  4J2S A;  3BRK X;  4FCE A;  1S0B A;  4X38 A;  1S4N A;  1JT5 A;  1YTO A;  1IT0 A;  4MZH A;  1Q03 A;  4KRV A;  3NJ5 A;  41BI A;  3R4U A;  2ESU A;  1R7Y A;  1BFC A;  2J3P A;  5IDS A;  4J23 B;  1V6U A;  1WSZ A;  3IAG C;  1GX0 A;  1BFF A;  4HO9 A;  5B2H A;  1MC9 A;  1IOB A;  3P6I A;  4IY8 A;  4FIX A;  3FFZ A;  1H5R A;  3I0D A;  1Z2V A;  4I4S A;  4HO4 A;  1WVC A;  3UDA A;  3JUK A;  4KQL A;  3E8L C;  3RMX A;  1NF5 B;  5CQM X;  3AZV A;  2FYD B;  2VSH A;  3FJJ A;  1DZC A;  3D8V A;  3BX1 C;  1JVG A;  1VPA A;  4YS8 A;  1T4Q A;  4TLP A;  4KC1 A;  5DDT A;  1WBA A;  2F2F C;  4Z9W B;  2AGD A;  3N7K A;  2ZU8 A;  1G97 A;  1ZCT A;  3U2T A;  2RJ1 A;  5CQO A;  3OH4 A;  1OQM B;  2YQS A;  3FJH A;  3B9U A;  4LO1 A;  2PX7 A;  2V0I A;  4G3S A;  4ZFY B;  6I1B A;  3V8Y A;  2VSA A;  3JRR A;  5BXR A;  1ZIZ A;  4Q7C A;  1QQL A;  5I1F A;  3BAH A;  3V0A B;  1HIB A;  3AH2 A;  1XZ6 A;  1TWM A;  3O5W B;  4FIY A;  1HWN B;  4P0J A;  1VZX A;  1FWV A;  3V0P A;  2VXL A;  2ICX A;  2FDB M;  1R7T A;  3WO2 A;  1FO8 A;  4Q9P A;  2J0B A;  3OGF A;  2OEF A;  1YP4 A;  2X5Z A;  5D62 A;  3FUO A;  3V79 C;  4D0T A;  3K8E A;  3I2X A;  3Q4S A;  4G9M A;  1FZW A;  1BAR A;  5BP5 C;  3AKG A;  1LL3 A;  5BQU C;  3H6Q A;  3WMU A;  1HKN A;  2NXV A;  5C36 A;  2DRZ A;  5FNW A;  1ZJP A;  2MC2 A;  2NP0 A;  5EJZ A;  5C3D A;  5C38 A;  4AC3 A;  1L2H A;  1JT7 A;  4IYB A;  1H5S A;  3T7M A;  1DFC A;  4M4K A;  1MD6 A;  4R7P A;  4ZOT A;  3UD9 A;  3WMV A;  3BAO A;  1QWJ A;  2P6W A;  4LO2 A;  2XME A;  2P39 A;  2YQH A;  4FRD A;  4END A;  3LTQ A;  2V0H A;  1WT3 A;  1NUN A;  2AAI B;  2ZR1 B;  2OI6 A;  4EVW A;  4FQW A;  2MLL B;  3P6J A;  3WA1 A;  4HO2 A;  4JKQ A;  2VSE A;  1WT0 A;  5C4F A;  4LW3 A;  3LLP A;  4HOC A;  4EE3 A;  3CA6 A;  3OBR A;  4R6U B;  1HWP B;  1R81 A;  2APC A;  1ZCU A;  1FV2 A;  4IZE A;  2D23 A;  2P73 A;  1DQO A;  3EF2 A;  4ZFU B;  3AH4 A;  1GGP B;  1DJS B;  3AJ5 A;  1WD4 A;  3HBW A;  4I4X A;  4QKS A;  1MP4 A;  2VS4 A;  2WGZ A;  1QGS A;  3WO3 A;  4JKX B;  1VGZ A;  1NZK A;  2VU9 A;  2GZB A;  4JP0 A;  5F8W A;  2A8U A;  8I1B A;  4HO0 A;  2QN4 A;  3E25 A;  3F1Y A;  4IZX A;  1R8O A;  1IIN A;  2RIT A;  2WVK A;  3BAV A;  4I6I A;  4M2B A;  2ET2 A;  4DDZ A;  1RG8 A;  1VGW A;  3W9T A;  2D7I A;  2X2S A;  4EFQ A;  1VH3 A;  2I1B A;  3U0Y A;  1LZI A;  2OI5 A;  2M49 A;  4MZF B;  3SX8 A;  3V0B B;  2VFZ A;  3UD7 A;  2NTD A;  4HG6 A;  2NM1 A;  5BXS A;  1TIE A;  4JRA A;  4E1K A;  3Q7U A;  4OUJ A;  2YUG A;  2RIY A;  1WD3 A;  5EIY A;  1BA7 A;  2VXR A;  4I3N A;  5FZU A;  3S8J A;  3O4C A;  4FVV A;  1RZO B;  2I5K A;  1G95 A;  1YP2 A;  5BXC A;  2IHO A;  4EEE B;  3I0L A;  2AM4 A;  1AFC A;  1JV3 A;  2QGI A;  2FYB A;  1ISY A;  1TTU A;  3I29 B;  1ON8 A;  1SS9 A;  1G82 A;  1ZI1 A;  1G0R A;  3O49 A;  1TW5 A;  2Z49 A;  2L5X A;  9ILB A;  1MP3 A;  1NWG B;  4ZKT B;  5F90 A;  2I7B A;  5FU0 A;  4AN6 A;  1QGQ A;  1HV9 A;  3FJF A;  3VWC A;  4PC4 A;  4IY9 A;  2AE7 A;  2RQ9 A;  4QD2 C;  2WVM A;  2XWL A;  2RST A;  4ECM A;  3UD8 A;  1JT3 A;  3HSM A;  3PME A;  4QBC A;  3AKI A;  3ZX7 A;  2K4A B;  1FG5 N;  1DFQ A;  1H5S C;  3A23 A;  3O3Q A;  4EB2 B;  4DEC A;  4FRP A;  2V0L A;  5CQP A;  1P63 A;  4IHZ A;  4LO2 C;  1K4V A;  4I4R A;  4GOY A;  3IIR A;  3BRF A;  2VD4 A;  5DSS B;  4DE7 A;  21BI A;  4QD2 B;  4Y6U A;  1D0H A;  1W3A A;  1YF8 B;  3SXA A;  4O6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...