2FFUA

Crystal structure of human ppgalnact-2 complexed with udp and ea2
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
494
structure length
494
Chain Sequence
KVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHDQCQRKQWRVDLPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLGKIEKVRVLRNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTRVVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYMTPEQRRSRQGNPVAPIKTPMIAGGLFVMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRKQHPYTFPGGSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLENVYPELRVPDHQDIAFGALQQGTNCLDTLGHFADGVVGVYECHNAGGNQEWALTKEKSVKHMDLCLTVVDRAPGSLIKLQGCRENDSRQKWEQIEGNSKLRHVGSNLCLDSRTAKSGGLSVEVCGPALSQQWKFTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Polypeptide N-acetylgalactosaminyltransferase 2
publication title Dynamic Association between the Catalytic and Lectin Domains of Human UDP-GalNAc:Polypeptide {alpha}-N-Acetylgalactosaminyltransferase-2
pubmed doi rcsb
source organism Homo sapiens
total genus 171
structure length 494
sequence length 494
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ffuA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2ffuA01
1LZIA 2RJ4A 3E25A 4HO6A 4II0A 3ZGGA 4ARWA 4CJBA 1XHBA 2VLCA 3CGXA 4KPXA 4DECA 4QO3A 1AVUA 2WEEA 5DVHA 3TZTA 3O3QA 1GA8A 3EF2A 4QBCA 3IOHA 3BRKX 3R2WA 4FCUA 4G87A 3RMWA 4PC4A 2ZU7A 3I0CA 3Q4SA 2XWLA 1IOBA 1FGXA 3A07A 2OEGA 3SXAA 4EE5A 4L4HA 1QXMA 3B9UA 1HV9A 3P53A 2KI4A 4KC3A 2Y4JA 1R81A 4G3PA 1H5SD 2AGDA 4NANA 6I1BA 4DDZA 4ZOTA 1WT3A 5IDTA 2D20A 1FGGA 3FJJA 2E4MC 3N7JA 4OEGA 1G97A 4M4KA 1ILR1 1DLLA 3JUTA 1LL2A 5J49A 2CU2A 1YYNA 3FUOA 2WE9A 4I4PA 1K5VA 3I0DA 5EJ1A 2AFGA 2OI5A 2OI6A 3BX1C 1ISYA 4NAKA 1JLXA 2BFHA 3N7KA 2OI7A 1M2TB 4G6MA 2XOAA 4DEPA 4FGFA 1G8OA 3FJKA 4HR6C 4KC2A 1G23A 3WMVA 1BLDA 2RJ7A 5L6SA 3FGMA 4ZFYB 1FXJA 4KQLA 3SXDA 1Q03A 3BRGC 1S4NA 8I1BA 2ERMA 3IIRA 2VSHA 4LO3A 2XWNA 4JQ0A 3OH0A 2XWMA 4KXOA 4YS8A 3BAQA 3FJCA 3DJ4A 1G82A 2D0JA 1NZKA 1GQCA 1H5SC 1HWPB 1JYLA 2RITA 2YESA 1FXOA 1R7XA 4ZKTB 2ESUA 1KWSA 2AH9A 3DUVA 1HM8A 4JRAA 1IRPA 1P63A 4X39A 3WINC 1XZ6A 5EJZA 1INJA 3F1CA 1FV3A 3SPTA 3RMYA 5C49A 5BQUC 1H5SB 3PNNA 1LL0A 2ZU9A 1TWMA 3H6RA 1H5TB 2DPWA 2RIZA 1Z2VA 3A21A 3VSFA 2F2FC 3ZC9A 3ILAA 2VS5A 4FRHA 4IRPA 4J18A 4B4BA 2FGFA 5FTVA 2Z86A 4J23B 5CQNX 3UD9A 3V0BB 4ASJA 1BFFA 4IZXA 1ISZA 3NBDA 3O4DA 1NKHB 2FYCB 2MC2A 4A7YA 3JTJA 2RJ1A 3I2AA 4YOLA 2D43A 1ZDGA 3AH4A 2HZ9A 2NZ9A 4ECMA 1ZJ2A 4M28A 3U2XA 1QQLA 3QYDA 1JT4A 3PG0A 5C4BA 2APCA 1VGZA 1IT0A 2Q9XA 2D24A 4LO8B 3OGGA 1FN0A 5BXTA 1G9BA 1FR9A 3E8LC 3AJ5A 4LO0A 1BARA 5BP5A 2AM3A 5EC5A 1PZYB 5C4FA 1ZI1A 4TLPA 1ABRB 21BIA 3KMVA 2ICXA 3ZLKA 2ET2A 5E24E 3AH2A 2GZBA 1G9CA 3NBCA 1PC8B 4I1BA 2BEBA 3IM6A 1G3LA 2FYAA 3HN1A 4LO1A 1ON8A 1Z90A 2O1FA 2P72A 3ZLLA 2Y7AA 4EVWA 4OWLA 4FRDA 1JY0A 3A23A 5FNXA 2W0WA 4AYLA 4P0JA 1YBIA 1ZCUA 2X5ZA 3FJDA 1TP0A 4GP0A 2VXRA 1AXMA 5F8YA 4QC4A 3SNVA 4Y7FA 1TW5A 5DSSB 4G9MA 4LO3C 3PKPA 3I0JA 1H7EA 2QH5A 1YF8B 3BADA 3FJIA 3KIAA 4HOCA 2ZU8A 3VUOA 2HWAA 2L5XA 1LZ7A 1WBCA 2FDBM 3P6JA 3TQDA 4HO2A 3IOIA 3OJMA 3VWCA 4OEEA 2DS0A 1FG5N 2W0VA 3ZF8A 3V91A 2KI6B 1E5KA 1W3FA 4I3NA 5AJNA 3LLPA 5C4CA 1BLAA 1GQ9A 2Y9WC 4X38A 1R8NA 1YP2A 3OJ2A 5D63A 3O3PA 3T7NA 3O4OA 1FRWA 5BXPA 1ZI5A 1TIEA 1TZFA 3BA5A 4I4QA 1SR4A 4XFTA 5FNWA 2Y9FA 1QQKA 3BA4A 4EFRA 2Y4MA 1ZCTA 1HJLA 4KEJA 2YUGA 3UD7A 1IIMA 4H04A 1CVSA 4I4VA 3WA1A 4CJMA 2AAIB 2KLLA 2UUSA 1DJSB 3SXBA 3QVBA 4Y9XA 1H4EA 2ICYA 5B2HA 2Y9GA 4IYBA 2MZBA 3ZXGA 4LO0C 4XFSA 4ZGRB 1H7FA 1AF9A 3T7OA 2WVKA 2X2SA 1H5RB 1XYFA 1EPWA 3MPPG 1FR8A 5JLVA 2YCMA 1QGQA 3OH1A 4Y7VA 1MP4A 4OUJA 4Y6UA 5D61A 5I1FA 2DRYA 3AKHA 4UEGA 2K8RA 4KC1A 4OW4A 3Q7YA 3RTIB 4HO3A 3PHZA 4LO1C 5FZZA 1K4VA 3HL3A 1LZJA 4FCEA 1VZTA 1I1BA 31BIA 1S4PA 3AH1A 1G2VA 1V84A 3RSBA 4B2XA 5C3DA 2XMHA 5FV9A 3RMXA 4J2SA 5CMIA 3I0EA 2V0KA 3I0FA 4EEOA 3A22A 1OQLB 3N7LA 2JCKA 4ZDQA 1H4CA 3VT2A 2AXMA 2E8BA 3PKQA 3T7MA 3DK5A 5F8WA 1HM0A 1V6UA 4F34A 4Q9PA 3ZC8A 1ZIZA 1F31A 5CMJA 5IFYA 2MIBA 3HBWA 4D8HA 1H3MA 1A8DA 1BFCA 1II4A 4KRVA 5GAQA 1E0OA 4XKIA 1EYLA 4QBVA 4QKRA 1G1LA 1VPAA 3OH3A 3U2TA 1MD6A 1I52A 3GUEA 1Z0HA 3K8DA 4D11A 3AKIA 1FWYA 1PZTA 2P73A 3NGWA 3CRGA 4EFPA 1QWJA 4M2AA 1G9AA 1G95A 4I2SA 2NXVA 2PA4A 3Q80A 5CMGX 3D7WB 5DZUA 2D7RA 1V6VA 5BXRA 1FMMS 3CA3A 1HWMB 1GWVA 3O4BA 1SZ6B 2VU9A 1SR4C 1GWWA 1K5UA 3H6SE 4OWJA 1ZJ3A 2IWTB 4B4GA 4ZFWB 1AVXB 4NALA 2NVHA 5FZYA 4ENDA 4G6JA 1JT7A 3CKJA 4J2YA 1ON6A 1NMMB 5C3AA 3OBTA 2K43A 2GO2A 4P00A 3V0PA 3WO4A 1ISWA 3U0XA 4CJCA 4NAIA 4D48A 1RG8A 2FFUA 3VEQA 1D0HA 4P0LA 1WVCA 3CA6A 3OH4A 4JKQA 1T9FA 3VT1A 1PUUB 1PZZA 1VZXA 3JRRA 1S0BA 2IHOA 4GAFA 4E1KA 2D23A 1LZ0A 1VGUA 3I29B 3FJEA 4QALA 2RSTA 1OQMB 4Y64A 5C47A 3OJVA 4IQPA 1H7HA 3V0NA 4H9WA 4Z8SB 1EYRA 4HO4A 2LIEA 5C38A 1R7YA 4EFQA 1NF5B 3N9WA 4LW6A 1RY7A 3P6IA 4QD2C 5CQMX 1FWVA 4I4YA 3VSZA 3FJHA 4LW3A 4KPZA 5AJPA 4EE4A 5C8RA 3RTJB 5F8SA 4B4MA 4EE3A 1R7VA 3HSMA 5DDTA 2FFVA 2VXTI 1UPSA 3TC2A 2WGZA 4AC3A 1MC3A 1KNMA 4FROA 2K4AB 2OEFA 1ZJOA 2RJ5A 3AKFA 4ZLBB 1S0LA 3N0KA 1FO9A 1RZOB 1H7LA 2NP0A 2QGIA 1ZJ1A 1GGPB 2YQJA 1J0SA 3OKRA 2J3PA 3LW6A 3N7MA 3AZVA 1DQOA 1V6XA 2AM4A 3O5WB 3BCVA 1DZCA 3I0IX 4USOA 3BB2A 3W9TA 2YC3A 1HCEA 4FRBA 3JUKA 2I1BA 4I6IA 4R6UB 1FZWA 2E3DA 1EVTA 1QG8A 1HKNA 2MLLB 2LIQA 3CKNA 2WVLA 5CQPA 2VS3A 3SX8A 3FOQA 4JKXB 2ZQNA 4EEEB 1H7QA 4Y6NA 1DFQA 3I0HA 1DQGA 2VXLA 5C1GA 1BA7A 3V0OA 4BMAA 1PWAA 3CAHA 4I4OA 4D0TA 2X5SA 5FUHA 3U2VA 4B3UA 5BVPI 4EKXB 3ZX7A 3V0LA 4Q91A 1H4DA 2E4MA 1W3AA 1V82A 1WT0A 3V0AA 1ZHJA 1FOAA 4X37A 4WBCA 2RJ8A 2UX8A 4Y63A 3SXCA 2NM1A 4EB2B 2KKIA 4X3AA 2QKXA 3R4UA 5CMHA 2HWMA 1HJJA 3I0GA 3H6RB 2X65A 4B42A 4KNXA 1HIBA 4CJ8A 5FZUA 1JV1A 3VT0A 2RJ6A 1CE7B 4XWIA 4MNDA 4L4IA 3EE5A 2WAWA 4FRAA 4GBPA 2X2TA 1W57A 2JCLA 4FRPA 5I1BA 2YQSA 1AVWB 3U2UA 3K1XA 3V0QA 5FTSA 5BXCA 2AE7A 3F62B 3OGFA 2JCJA 2KH2A 2BO6A 2V0LA 3ZXDA 1YP4A 4FRMA 5C1LA 4JISA 2BEAA 3FJAA 3CRHA 3FUQA 1H5TA 4I4RA 4ZA3B 4FVVA 1MP5A 5BP5C 3BRFA 4Y7TA 5C48A 4C2SA 3O49A 4I0YA 3H6QA 3CU0A 1ZDFA 4IRQA 3WMUA 4KBBA 4LO2A 1HWNB 5BOWA 1WSZA 3U0YA 1FQ9A 1YTOA 2ZR1B 2RG9B 4USPA 4Z9WB 3V0BA 1TVYA 4FREA 5CQLX 4I96A 2VXMA 3D5NA 2D7IA 1G9RA 1S4OA 1VZUA 4KNRA 2QYIB 1WD4A 3BA7A 2YC5A 4HO9A 4ASYA 4Y7UA 3D8VA 1GX4A 3R4SA 1SS9A 3FFZA 4K6RA 3CKQA 1O7OA 1BASA 9ILBA 1WT2A 2PGYA 2FYBA 1IILA 1NQIB 2D1ZA 2VSAA 4XFUA 1S0GA 2R9KB 2Z87A 3IOJA 3F1RA 3JUJA 5C36A 4ZFUB 1YXWA 2BO8A 4GOYA 3U2WA 2BO4A 3SX5A 4EEGA 2VUAA 1YP3A 2RIYA 2PX7A 3SX7A 3NBNA 1PUMB 1IINA 1JT3A 3PUBA 1ZI3A 1FGAA 3AZWA 1V6WA 4GOVA 1MP3A 4EEAA 1MC9A 1N4KA 1R7UA 5JMCA 4FQWA 2DRZA 4IONA 3V79C 4I7IA 3OH2A 1Q1UA 3D98A 5AJOA 5FU0A 3HOMA 4HA2A 1TTUA 5CMFX 1R7TA 3R3IA 5HPZA 3SXGA 1VH1A 1ONKB 1OMZA 2P39A 1JLYA 4I37A 1O7QA 4GP3A 4A7ZA 3V0AB 3K8EA 2A8WA 1NWGB 2AECA 2V0JA 3UJ4A 2VFZA 3T8SA 1OMXA 1O0RA 5CQOA 3FJ9A 4I8MA 1HM9A 2D22A 3BAGA 4I4XA 4ZBVB 1JTCA 4HJJA 3RSJA 1ZJPA 2YQCA 4HCQA 3O4CA 4I4UA 4Q9GA 3V8YA 4Y62A 2F8XC 3V0MA 1WT1A 1QGSA 3CA0A 4A7KA 1H7TA 2NTDA 1VGWA 3UJ0A 2VSIA 4JAWA 1BFGA 1TW1A 4J2KA 4G1RA 5JQQA 4HO5A 4AYJA 2Y9XE 4LO2C 3RMVA 5DUYA 2D44A 3BAOA 3QR5A 3O44A 4ISRA 4JP0A 3E26A 2VS4A 3FWWA 4CVHA 4B5BA 1L2HA 3Q7WA 4I1EA 4JPZA 2I7BA 4IY8A 2QN4A 2Y6PA 2ZQOA 3BAVA 1W55A 3OC9A 41BIA 1V83A 1BFBA 5D62A 1JV3A 3ZGFA 1T4QA 1Q04A 3CA4A 3V8ZA 1IRAX 1FV2A 4MYBA 2VD4A 7I1BA 2HW9A 3OBRA 4QD2B 2I5EA 3BAUA 5F90A 2WRYA 2XMEA 4OEFA 1O23B 3ST8A 4AAWA 1JVDA 3CQAA 1ISXA 2RJ0A 5IDSA 2NYYA 2YQHA 1HWOB 2PGVA 4IY9A 1GX0A 5G00A 1WBAA 2WBCA 4IHZA 3S8KA 3UDAA 4LO7C 3UD8A 1FO8A 1H5RA 2A8UA 3Q7UA 3OGZA 1LVWA 4GAIA 2M49A 1FMZA 1AVAC 1H7GA 1VM8A 2Q4JA 3CKVA 4I4SA 3F1YA 3I0KA 1G9DA 2JCOA 4J2XA 2P6WA 2BO7A 4JD0A 1JYKA 3HALA 4HO8A 2AESA 1R8OA 2AM5A 4LO7B 1W3GA 3IM7A 1DFCA 1S0DA 3V90A 4D11C 1ZCYA 2Y4KA 5C4EA 1IHKA 3NJ5A 2WVMA 3FJ8A 5FU8A 1R82A 3FJFA 4L41C 4R7PA 4HO0A 4QKSA 4HG6A 3POLA 5HS2A 3O4AA 2O1GA 5C3BA 3CU1B 2Z49A 2GGQA 5C4DA 1S0CA 3BAHA 4KC4A 4KEIA 3I2XA 3NBEA 1IJTA 4KEKA 1JQZA 4F83A 1EZIA 4Y7GA 4AN7B 3FJBA 3SX3A 4FRLA 4DENA 4ISQA 1TWEA 1G0RA 1EV2A 3USRA 4DCKC 4DE7A 4D0ZA 3CKOA 5BXSA 1WD3A 3BRDA 3POKA 1DZDA 2V0IA 2V0HA 1VCLA 5L6VA 3WO2A 2Y4LA 3I0LA 1INIA 1JVGA 1DIWA 1AFCA 1XZZA 4EEMA 1NHEB 1S0EA 3PMEA 3WO3A 3CRIA 3OAMA 4G3QA 5FYEA 1R80A 3AJ6A 2Z48A 2Q3NB 5EHAA 3Q7XA 3S8JA 2O1HA 4B2WA 5C1HA 2RJ9A 4G9NA 1JT5A 4P0KA 4P6AA 4AN6A 2X60A 1TFMB 1I1EA 1RMLA 1LL3A 5EIYA 1FWUA 1ISVA 1H5SA 3IAGC 1HCDA 4IZEA 3HMYA 2RIXA 3WINA 1M16A 2FYDB 5BQUA 1Z4SA 2VSEA 3CA5A 3LTQA 1W77A 4P02A 1S0FA 2AQZA 2FO1A 1VGTA 1ITBA 2FY7A 2P23A 2RQ9A 1G93A 2F2FA 2I5KA 1NUNA 3CA1A 3IM5A 1TOOA 2GGOA 4G3SA 3C9ZA 3SXEA 1XG6A 1ZCVA 3MALA 3AKGA 5DDVA 3USQA 4KT7A 2DREA 4FRQA 5EG6C 1ZI4A 4BQHA 1ZJ0A 4M2BA 1VH3A 4OWKA 1YROB 1VICA 3BTAA
chains in the Genus database with same CATH superfamily
1LZIA 2RJ4A 3E25A 4HO6A 4II0A 3ZGGA 4ARWA 4CJBA 1XHBA 2VLCA 3CGXA 4KPXA 4DECA 4QO3A 1AVUA 4MZHA 5DVHA 2WEEA 3TZTA 3O3QA 1GA8A 3EF2A 4QBCA 3IOHA 3BRKX 3R2WA 4FCUA 4G87A 3RMWA 4PC4A 2ZU7A 3I0CA 3Q4SA 2XWLA 2NS2A 1IOBA 1FGXA 3A07A 2OEGA 3SXAA 4EE5A 4L4HA 1QXMA 3B9UA 1HV9A 3P53A 2KI4A 4KC3A 2Y4JA 1R81A 4G3PA 1H5SD 2AGDA 4NANA 6I1BA 4DDZA 4ZOTA 1WT3A 5IDTA 2D20A 1FGGA 3FJJA 2E4MC 3N7JA 4OEGA 1G97A 4M4KA 1ILR1 1DLLA 3JUTA 1LL2A 5J49A 2CU2A 1YYNA 3FUOA 2WE9A 4I4PA 1K5VA 3I0DA 5EJ1A 2AFGA 2OI5A 2OI6A 3BX1C 1ISYA 4NAKA 1JLXA 2BFHA 3N7KA 2OI7A 1M2TB 4G6MA 2XOAA 4DEPA 4FGFA 1G8OA 3FJKA 4HR6C 4KC2A 1G23A 3WMVA 1BLDA 2RJ7A 5L6SA 3FGMA 4ZFYB 1FXJA 4KQLA 3SXDA 1Q03A 3BRGC 1S4NA 8I1BA 2ERMA 3IIRA 2VSHA 4LO3A 2XWNA 4JQ0A 3OH0A 2XWMA 4KXOA 4YS8A 3BAQA 3FJCA 3DJ4A 1G82A 2D0JA 1NZKA 1GQCA 1H5SC 1HWPB 1JYLA 2RITA 2YESA 1FXOA 1R7XA 4ZKTB 2ESUA 1KWSA 2AH9A 3DUVA 1HM8A 4JRAA 1IRPA 1P63A 4X39A 3WINC 1XZ6A 5EJZA 1INJA 3F1CA 1FV3A 3SPTA 3RMYA 5C49A 5BQUC 1H5SB 3PNNA 1LL0A 2ZU9A 1TWMA 3H6RA 1H5TB 2DPWA 2RIZA 1Z2VA 3A21A 3VSFA 2F2FC 3ZC9A 3ILAA 2VS5A 4FRHA 4IRPA 4J18A 4B4BA 2FGFA 5FTVA 2Z86A 4J23B 5CQNX 3UD9A 3V0BB 4ASJA 1BFFA 4IZXA 1ISZA 3NBDA 3O4DA 1NKHB 2FYCB 2MC2A 4A7YA 3JTJA 2RJ1A 3I2AA 4YOLA 2D43A 1ZDGA 4FIXA 3AH4A 2HZ9A 2NZ9A 4ECMA 1ZJ2A 4M28A 3U2XA 1QQLA 3QYDA 1JT4A 3PG0A 5C4BA 2APCA 1VGZA 1IT0A 2Q9XA 2D24A 4LO8B 3OGGA 1FN0A 5BXTA 1G9BA 1FR9A 3E8LC 3AJ5A 4LO0A 1BARA 5BP5A 2AM3A 5EC5A 1PZYB 5C4FA 1ZI1A 4TLPA 1ABRB 21BIA 3KMVA 2ICXA 3ZLKA 2ET2A 5E24E 3AH2A 2GZBA 1G9CA 3NBCA 1PC8B 4I1BA 2BEBA 3IM6A 1G3LA 2FYAA 3HN1A 4LO1A 1ON8A 1Z90A 2O1FA 2P72A 3ZLLA 2Y7AA 4EVWA 4OWLA 4FRDA 1JY0A 3A23A 5FNXA 2W0WA 4AYLA 4P0JA 1YBIA 1ZCUA 2X5ZA 3FJDA 1TP0A 4GP0A 2VXRA 1AXMA 5F8YA 4QC4A 3SNVA 4Y7FA 1TW5A 5DSSB 4G9MA 4LO3C 3PKPA 3I0JA 1H7EA 2QH5A 1YF8B 3BADA 3FJIA 3KIAA 4HOCA 2ZU8A 3VUOA 2HWAA 4FIYA 2L5XA 1LZ7A 1WBCA 2FDBM 3P6JA 3TQDA 4HO2A 3IOIA 3OJMA 3VWCA 4OEEA 2DS0A 1FG5N 2W0VA 3ZF8A 3V91A 2KI6B 1E5KA 1W3FA 4I3NA 5AJNA 3LLPA 5C4CA 1BLAA 1GQ9A 2Y9WC 4X38A 1R8NA 1YP2A 3OJ2A 5D63A 3O3PA 3T7NA 3O4OA 1FRWA 5BXPA 1ZI5A 1TIEA 1TZFA 3BA5A 4I4QA 1SR4A 4XFTA 5FNWA 2Y9FA 1QQKA 3BA4A 4EFRA 2Y4MA 1ZCTA 1HJLA 4KEJA 2YUGA 3UD7A 1IIMA 4H04A 1CVSA 4I4VA 3WA1A 4CJMA 2AAIB 2KLLA 2UUSA 1DJSB 3SXBA 3QVBA 4Y9XA 1H4EA 2ICYA 5B2HA 2Y9GA 4IYBA 2MZBA 3ZXGA 4LO0C 4XFSA 4ZGRB 1H7FA 1AF9A 3T7OA 2C0NA 2X2SA 1H5RB 1XYFA 1EPWA 3MPPG 1FR8A 5JLVA 2WVKA 1QGQA 2YCMA 3OH1A 4Y7VA 1MP4A 4OUJA 4Y6UA 5D61A 5I1FA 2DRYA 3AKHA 4UEGA 2K8RA 4KC1A 4OW4A 3Q7YA 3RTIB 4HO3A 3PHZA 4LO1C 5FZZA 1K4VA 3HL3A 1LZJA 4FCEA 1VZTA 1I1BA 31BIA 1S4PA 3AH1A 1G2VA 1V84A 3RSBA 4B2XA 5C3DA 2XMHA 5FV9A 3RMXA 4J2SA 5CMIA 3I0EA 2V0KA 3I0FA 4EEOA 3A22A 1OQLB 3N7LA 2JCKA 4ZDQA 1H4CA 3VT2A 2AXMA 2E8BA 3PKQA 3T7MA 3DK5A 5F8WA 1HM0A 1V6UA 4F34A 4Q9PA 3ZC8A 1ZIZA 1F31A 5CMJA 5IFYA 2MIBA 3HBWA 4D8HA 1H3MA 1A8DA 1BFCA 1II4A 4KRVA 5GAQA 1E0OA 4XKIA 1EYLA 4QBVA 4QKRA 1G1LA 1VPAA 3OH3A 3U2TA 1MD6A 1I52A 3GUEA 1Z0HA 3K8DA 4D11A 3AKIA 1FWYA 1PZTA 2P73A 3NGWA 3CRGA 4EFPA 1QWJA 4M2AA 4MZGB 1G9AA 1G95A 4I2SA 2NXVA 2PA4A 3Q80A 5CMGX 3D7WB 5DZUA 2D7RA 1V6VA 5BXRA 1FMMS 3CA3A 1HWMB 1GWVA 3O4BA 1SZ6B 2VU9A 1SR4C 1GWWA 1K5UA 3H6SE 4OWJA 1ZJ3A 2IWTB 4B4GA 4ZFWB 1AVXB 4NALA 2NVHA 5FZYA 4ENDA 4G6JA 1JT7A 3CKJA 4J2YA 1ON6A 1NMMB 5C3AA 3OBTA 2K43A 2GO2A 4P00A 3V0PA 4H75A 3WO4A 1ISWA 3U0XA 4CJCA 4NAIA 4D48A 1RG8A 2FFUA 3VEQA 1D0HA 4P0LA 1WVCA 3CA6A 3OH4A 4JKQA 1T9FA 3VT1A 1PUUB 1PZZA 1VZXA 3JRRA 1S0BA 2IHOA 4GAFA 4E1KA 2D23A 1LZ0A 1VGUA 3I29B 3FJEA 4QALA 2RSTA 1OQMB 4Y64A 5C47A 3OJVA 4IQPA 1H7HA 3V0NA 4H9WA 4Z8SB 1EYRA 4HO4A 2LIEA 4O6MA 5C38A 1R7YA 4EFQA 1NF5B 3N9WA 4LW6A 1RY7A 3P6IA 4QD2C 5CQMX 1FWVA 4I4YA 3VSZA 3FJHA 4LW3A 4KPZA 5AJPA 4EE4A 5C8RA 3RTJB 5F8SA 4B4MA 4EE3A 1R7VA 3HSMA 5DDTA 2FFVA 2VXTI 1UPSA 3TC2A 2WGZA 4AC3A 1MC3A 5D91A 1KNMA 4FROA 2K4AB 2OEFA 1ZJOA 2RJ5A 3AKFA 4ZLBB 1S0LA 3N0KA 1FO9A 1RZOB 1H7LA 2NP0A 2J0AA 2QGIA 1ZJ1A 1GGPB 2YQJA 1J0SA 3OKRA 2J3PA 3LW6A 3N7MA 3AZVA 1DQOA 1V6XA 2AM4A 3O5WB 3BCVA 1DZCA 3I0IX 4USOA 3BB2A 3W9TA 2YC3A 1HCEA 4FRBA 3JUKA 2I1BA 4I6IA 4R6UB 1FZWA 2E3DA 1EVTA 1QG8A 1HKNA 2MLLB 2LIQA 3CKNA 2WVLA 5CQPA 2VS3A 3SX8A 3FOQA 4JKXB 2ZQNA 4EEEB 1H7QA 4Y6NA 1DFQA 3I0HA 1DQGA 2VXLA 5C1GA 1BA7A 3V0OA 4BMAA 1PWAA 3CAHA 4I4OA 4D0TA 2X5SA 5FUHA 3U2VA 4B3UA 5BVPI 4EKXB 3ZX7A 3V0LA 4Q91A 1H4DA 2E4MA 1W3AA 1V82A 1WT0A 3V0AA 1ZHJA 1FOAA 4X37A 4WBCA 2RJ8A 2UX8A 4Y63A 3SXCA 2NM1A 4Q7CA 4EB2B 2KKIA 4X3AA 2QKXA 3R4UA 5CMHA 2HWMA 1HJJA 3I0GA 3H6RB 2X65A 4B42A 4KNXA 1HIBA 4CJ8A 5FZUA 1JV1A 3VT0A 2RJ6A 1CE7B 4XWIA 4MNDA 4L4IA 3EE5A 2WAWA 4FRAA 4GBPA 2X2TA 1W57A 2JCLA 4FRPA 2J0BA 5I1BA 2YQSA 1AVWB 3U2UA 3K1XA 3V0QA 5FTSA 5BXCA 2AE7A 3F62B 3OGFA 2JCJA 2KH2A 2BO6A 2V0LA 3ZXDA 1YP4A 4FRMA 5C1LA 4JISA 2BEAA 3FJAA 3CRHA 3FUQA 1H5TA 4I4RA 4ZA3B 4FVVA 1MP5A 5BP5C 3BRFA 4Y7TA 5C48A 4C2SA 3O49A 4I0YA 3H6QA 3CU0A 1ZDFA 4IRQA 3WMUA 4KBBA 4LO2A 1HWNB 5BOWA 1WSZA 3U0YA 1FQ9A 1YTOA 2ZR1B 2RG9B 4USPA 4Z9WB 3V0BA 1TVYA 4FREA 5CQLX 4I96A 2VXMA 3D5NA 2D7IA 1G9RA 1S4OA 1VZUA 4KNRA 2QYIB 1WD4A 3BA7A 2YC5A 4HO9A 4ASYA 4Y7UA 3D8VA 1GX4A 3R4SA 1SS9A 3FFZA 4K6RA 3CKQA 1O7OA 1BASA 9ILBA 1WT2A 2PGYA 2FYBA 1IILA 1NQIB 2D1ZA 2VSAA 4XFUA 1S0GA 2R9KB 2Z87A 3IOJA 3F1RA 3JUJA 5C36A 4ZFUB 1YXWA 2BO8A 4GOYA 3U2WA 2BO4A 3SX5A 4EEGA 2VUAA 1YP3A 2RIYA 2PX7A 3SX7A 3NBNA 1PUMB 1IINA 1JT3A 3PUBA 1ZI3A 1FGAA 3AZWA 1V6WA 4GOVA 1MP3A 4EEAA 1MC9A 1N4KA 1R7UA 5JMCA 4FQWA 2DRZA 4IONA 3V79C 4I7IA 3OH2A 1Q1UA 3D98A 5AJOA 5FU0A 3HOMA 4HA2A 1TTUA 5CMFX 1R7TA 3R3IA 5HPZA 3SXGA 1VH1A 1ONKB 1OMZA 2P39A 1JLYA 4I37A 1O7QA 4GP3A 4A7ZA 3V0AB 3K8EA 2A8WA 1NWGB 2AECA 2V0JA 3UJ4A 2VFZA 3T8SA 1OMXA 1O0RA 5CQOA 3FJ9A 4I8MA 1HM9A 2D22A 3BAGA 4I4XA 4ZBVB 1JTCA 4HJJA 3RSJA 1ZJPA 2YQCA 4HCQA 3O4CA 4I4UA 4Q9GA 3V8YA 4Y62A 2F8XC 3V0MA 1WT1A 1QGSA 3CA0A 4A7KA 1H7TA 2NTDA 1VGWA 3UJ0A 2VSIA 4JAWA 1BFGA 1TW1A 4J2KA 4G1RA 4O6NA 5JQQA 4HO5A 4AYJA 2Y9XE 4LO2C 5D92A 3RMVA 5DUYA 2D44A 3BAOA 3QR5A 3O44A 4ISRA 4JP0A 3E26A 2VS4A 3FWWA 4CVHA 4B5BA 1L2HA 3Q7WA 4I1EA 4JPZA 2I7BA 4IY8A 2QN4A 2Y6PA 2ZQOA 3BAVA 4UY4A 1W55A 3OC9A 41BIA 1V83A 1BFBA 5D62A 1JV3A 3ZGFA 1T4QA 1Q04A 3CA4A 3V8ZA 1IRAX 1FV2A 4MYBA 2VD4A 7I1BA 2HW9A 3OBRA 4QD2B 2I5EA 3BAUA 5F90A 2WRYA 2XMEA 4OEFA 1O23B 3ST8A 4AAWA 1JVDA 3CQAA 1ISXA 2RJ0A 5IDSA 2NYYA 2YQHA 1HWOB 2PGVA 4IY9A 1GX0A 5G00A 1WBAA 2WBCA 4IHZA 3S8KA 3UDAA 4LO7C 3UD8A 1FO8A 1H5RA 2A8UA 3Q7UA 3OGZA 1LVWA 4GAIA 2M49A 1FMZA 1AVAC 1H7GA 1VM8A 2Q4JA 3CKVA 4I4SA 3F1YA 3I0KA 1G9DA 2JCOA 4J2XA 2P6WA 2BO7A 4JD0A 1JYKA 3HALA 4HO8A 2AESA 1R8OA 2AM5A 4LO7B 1W3GA 3IM7A 1DFCA 1S0DA 3V90A 4D11C 1ZCYA 2Y4KA 5C4EA 1IHKA 3NJ5A 2WVMA 3FJ8A 5FU8A 1R82A 3FJFA 4L41C 4R7PA 4HO0A 4QKSA 4HG6A 3POLA 5HS2A 2VK9A 3O4AA 2O1GA 5C3BA 3CU1B 2Z49A 2GGQA 4MIXA 1S0CA 5C4DA 3BAHA 4KC4A 4KEIA 3I2XA 3NBEA 1IJTA 4KEKA 1JQZA 4F83A 1EZIA 4Y7GA 4AN7B 3FJBA 3SX3A 4FRLA 4DENA 4ISQA 1TWEA 1G0RA 1EV2A 3USRA 4DCKC 4DE7A 4D0ZA 3CKOA 5BXSA 1WD3A 3BRDA 3POKA 1DZDA 2V0IA 2V0HA 1VCLA 5L6VA 3WO2A 2Y4LA 3I0LA 1INIA 1JVGA 1DIWA 1AFCA 1XZZA 4EEMA 1NHEB 1S0EA 3PMEA 3WO3A 3CRIA 3OAMA 4G3QA 5FYEA 1R80A 3AJ6A 2Z48A 2Q3NB 5EHAA 3Q7XA 3S8JA 2O1HA 4B2WA 5C1HA 2RJ9A 4G9NA 1JT5A 4P0KA 4P6AA 4AN6A 2X60A 1TFMB 1I1EA 1RMLA 1LL3A 5EIYA 1FWUA 1ISVA 1H5SA 4MZFB 3IAGC 1HCDA 4IZEA 3HMYA 2RIXA 3WINA 1M16A 2FYDB 5BQUA 1Z4SA 2VSEA 3CA5A 3LTQA 1W77A 4P02A 1S0FA 2AQZA 2FO1A 1VGTA 1ITBA 2FY7A 2P23A 2RQ9A 1G93A 2F2FA 2I5KA 1NUNA 3CA1A 3IM5A 1TOOA 2GGOA 4G3SA 3C9ZA 3SXEA 1XG6A 1ZCVA 3MALA 3AKGA 5DDVA 3USQA 4KT7A 2DREA 4FRQA 5EG6C 1ZI4A 4BQHA 1ZJ0A 4M2BA 1VH3A 4OWKA 1YROB 1VICA 3BTAA
chains in the Genus database with same CATH topology
1LZIA 2RJ4A 3E25A 4HO6A 4II0A 3ZGGA 4ARWA 4CJBA 1XHBA 2VLCA 3CGXA 4KPXA 4DECA 4QO3A 1AVUA 4MZHA 5DVHA 2WEEA 3TZTA 3O3QA 1GA8A 3EF2A 4QBCA 3IOHA 3BRKX 3R2WA 4FCUA 4G87A 3RMWA 4PC4A 2ZU7A 3I0CA 3Q4SA 2XWLA 2NS2A 1IOBA 1FGXA 3A07A 2OEGA 3SXAA 4EE5A 4L4HA 1QXMA 3B9UA 1HV9A 3P53A 2KI4A 4KC3A 2Y4JA 1R81A 4G3PA 1H5SD 2AGDA 4NANA 6I1BA 4DDZA 4ZOTA 1WT3A 5IDTA 2D20A 1FGGA 3FJJA 2E4MC 3N7JA 4OEGA 1G97A 4M4KA 1ILR1 1DLLA 3JUTA 1LL2A 5J49A 2CU2A 1YYNA 3FUOA 2WE9A 4I4PA 1K5VA 3I0DA 5EJ1A 2AFGA 2OI5A 2OI6A 3BX1C 1ISYA 4NAKA 1JLXA 2BFHA 3N7KA 2OI7A 1M2TB 4G6MA 2XOAA 4DEPA 4FGFA 1G8OA 3FJKA 4HR6C 4KC2A 1G23A 3WMVA 1BLDA 2RJ7A 5L6SA 3FGMA 4ZFYB 1FXJA 4KQLA 3SXDA 1Q03A 3BRGC 1S4NA 8I1BA 2ERMA 3IIRA 2VSHA 4LO3A 2XWNA 4JQ0A 3OH0A 2XWMA 4KXOA 4YS8A 3BAQA 3FJCA 3DJ4A 1G82A 2D0JA 1NZKA 1GQCA 1H5SC 1HWPB 1JYLA 2RITA 2YESA 1FXOA 1R7XA 4ZKTB 2ESUA 1KWSA 2AH9A 3DUVA 1HM8A 4JRAA 1IRPA 1P63A 4X39A 3WINC 1XZ6A 5EJZA 1INJA 3F1CA 1FV3A 3SPTA 3RMYA 5C49A 5BQUC 1H5SB 3PNNA 1LL0A 2ZU9A 1TWMA 3H6RA 1H5TB 2DPWA 2RIZA 1Z2VA 3A21A 3VSFA 2F2FC 3ZC9A 3ILAA 2VS5A 4FRHA 4IRPA 4J18A 4B4BA 2FGFA 5FTVA 2Z86A 4J23B 5CQNX 3UD9A 3V0BB 4ASJA 1BFFA 4IZXA 1ISZA 3NBDA 3O4DA 1NKHB 2FYCB 2MC2A 4A7YA 3JTJA 2RJ1A 3I2AA 4YOLA 2D43A 1ZDGA 4FIXA 3AH4A 2HZ9A 2NZ9A 4ECMA 1ZJ2A 4M28A 3U2XA 1QQLA 3QYDA 1JT4A 3PG0A 5C4BA 2APCA 1VGZA 1IT0A 2Q9XA 2D24A 4LO8B 3OGGA 1FN0A 5BXTA 1G9BA 1FR9A 3E8LC 3AJ5A 4LO0A 1BARA 5BP5A 2AM3A 5EC5A 1PZYB 5C4FA 1ZI1A 4TLPA 1ABRB 21BIA 3KMVA 2ICXA 3ZLKA 2ET2A 5E24E 3AH2A 2GZBA 1G9CA 3NBCA 1PC8B 4I1BA 2BEBA 3IM6A 1G3LA 2FYAA 3HN1A 4LO1A 1ON8A 1Z90A 2O1FA 2P72A 3ZLLA 2Y7AA 4EVWA 4OWLA 4FRDA 1JY0A 3A23A 5FNXA 2W0WA 4AYLA 4P0JA 1YBIA 1ZCUA 2X5ZA 3FJDA 1TP0A 4GP0A 2VXRA 1AXMA 5F8YA 4QC4A 3SNVA 4Y7FA 1TW5A 5DSSB 4G9MA 4LO3C 3PKPA 3I0JA 1H7EA 2QH5A 1YF8B 3BADA 3FJIA 3KIAA 4HOCA 2ZU8A 3VUOA 2HWAA 4FIYA 2L5XA 1LZ7A 1WBCA 2FDBM 3P6JA 3TQDA 4HO2A 3IOIA 3OJMA 3VWCA 4OEEA 2DS0A 1FG5N 2W0VA 3ZF8A 3V91A 2KI6B 1E5KA 1W3FA 4I3NA 5AJNA 3LLPA 5C4CA 1BLAA 1GQ9A 2Y9WC 4X38A 1R8NA 1YP2A 3OJ2A 5D63A 3O3PA 3T7NA 3O4OA 1FRWA 5BXPA 1ZI5A 1TIEA 1TZFA 3BA5A 4I4QA 1SR4A 4XFTA 5FNWA 2Y9FA 1QQKA 3BA4A 4EFRA 2Y4MA 1ZCTA 1HJLA 4KEJA 2YUGA 3UD7A 1IIMA 4H04A 1CVSA 4I4VA 3WA1A 4CJMA 2AAIB 2KLLA 2UUSA 1DJSB 3SXBA 3QVBA 4Y9XA 1H4EA 2ICYA 5B2HA 2Y9GA 4IYBA 2MZBA 3ZXGA 4LO0C 4XFSA 4ZGRB 1H7FA 1AF9A 3T7OA 2C0NA 2X2SA 1H5RB 1XYFA 1EPWA 3MPPG 1FR8A 5JLVA 2WVKA 1QGQA 2YCMA 3OH1A 4Y7VA 1MP4A 4OUJA 4Y6UA 5D61A 5I1FA 2DRYA 3AKHA 4UEGA 2K8RA 4KC1A 4OW4A 3Q7YA 3RTIB 4HO3A 3PHZA 4LO1C 5FZZA 1K4VA 3HL3A 1LZJA 4FCEA 1VZTA 1I1BA 31BIA 1S4PA 3AH1A 1G2VA 1V84A 3RSBA 4B2XA 5C3DA 2XMHA 5FV9A 3RMXA 4J2SA 5CMIA 3I0EA 2V0KA 3I0FA 4EEOA 3A22A 1OQLB 3N7LA 2JCKA 4ZDQA 1H4CA 3VT2A 2AXMA 2E8BA 3PKQA 3T7MA 3DK5A 5F8WA 1HM0A 1V6UA 4F34A 4Q9PA 3ZC8A 1ZIZA 1F31A 5CMJA 5IFYA 2MIBA 3HBWA 4D8HA 1H3MA 1A8DA 1BFCA 1II4A 4KRVA 5GAQA 1E0OA 4XKIA 1EYLA 4QBVA 4QKRA 1G1LA 1VPAA 3OH3A 3U2TA 1MD6A 1I52A 3GUEA 1Z0HA 3K8DA 4D11A 3AKIA 1FWYA 1PZTA 2P73A 3NGWA 3CRGA 4EFPA 1QWJA 4M2AA 4MZGB 1G9AA 1G95A 4I2SA 2NXVA 2PA4A 3Q80A 5CMGX 3D7WB 5DZUA 2D7RA 1V6VA 5BXRA 1FMMS 3CA3A 1HWMB 1GWVA 3O4BA 1SZ6B 2VU9A 1SR4C 1GWWA 1K5UA 3H6SE 4OWJA 1ZJ3A 2IWTB 4B4GA 4ZFWB 1AVXB 4NALA 2NVHA 5FZYA 4ENDA 4G6JA 1JT7A 3CKJA 4J2YA 1ON6A 1NMMB 5C3AA 3OBTA 2K43A 2GO2A 4P00A 3V0PA 4H75A 3WO4A 1ISWA 3U0XA 4CJCA 4NAIA 4D48A 1RG8A 2FFUA 3VEQA 1D0HA 4P0LA 1WVCA 3CA6A 3OH4A 4JKQA 1T9FA 3VT1A 1PUUB 1PZZA 1VZXA 3JRRA 1S0BA 2IHOA 4GAFA 4E1KA 2D23A 1LZ0A 1VGUA 3I29B 3FJEA 4QALA 2RSTA 1OQMB 4Y64A 5C47A 3OJVA 4IQPA 1H7HA 3V0NA 4H9WA 4Z8SB 1EYRA 4HO4A 2LIEA 4O6MA 5C38A 1R7YA 4EFQA 1NF5B 3N9WA 4LW6A 1RY7A 3P6IA 4QD2C 5CQMX 1FWVA 4I4YA 3VSZA 3FJHA 4LW3A 4KPZA 5AJPA 4EE4A 5C8RA 3RTJB 5F8SA 4B4MA 4EE3A 1R7VA 3HSMA 5DDTA 2FFVA 2VXTI 1UPSA 3TC2A 2WGZA 4AC3A 1MC3A 5D91A 1KNMA 4FROA 2K4AB 2OEFA 1ZJOA 2RJ5A 3AKFA 4ZLBB 1S0LA 3N0KA 1FO9A 1RZOB 1H7LA 2NP0A 2J0AA 2QGIA 1ZJ1A 1GGPB 2YQJA 1J0SA 3OKRA 2J3PA 3LW6A 3N7MA 3AZVA 1DQOA 1V6XA 2AM4A 3O5WB 3BCVA 1DZCA 3I0IX 4USOA 3BB2A 3W9TA 2YC3A 1HCEA 4FRBA 3JUKA 2I1BA 4I6IA 4R6UB 1FZWA 2E3DA 1EVTA 1QG8A 1HKNA 2MLLB 2LIQA 3CKNA 2WVLA 5CQPA 2VS3A 3SX8A 3FOQA 4JKXB 2ZQNA 4EEEB 1H7QA 4Y6NA 1DFQA 3I0HA 1DQGA 2VXLA 5C1GA 1BA7A 3V0OA 4BMAA 1PWAA 3CAHA 4I4OA 4D0TA 2X5SA 5FUHA 3U2VA 4B3UA 5BVPI 4EKXB 3ZX7A 3V0LA 4Q91A 1H4DA 2E4MA 1W3AA 1V82A 1WT0A 3V0AA 1ZHJA 1FOAA 4X37A 4WBCA 2RJ8A 2UX8A 4Y63A 3SXCA 2NM1A 4Q7CA 4EB2B 2KKIA 4X3AA 2QKXA 3R4UA 5CMHA 2HWMA 1HJJA 3I0GA 3H6RB 2X65A 4B42A 4KNXA 1HIBA 4CJ8A 5FZUA 1JV1A 3VT0A 2RJ6A 1CE7B 4XWIA 4MNDA 4L4IA 3EE5A 2WAWA 4FRAA 4GBPA 2X2TA 1W57A 2JCLA 4FRPA 2J0BA 5I1BA 2YQSA 1AVWB 3U2UA 3K1XA 3V0QA 5FTSA 5BXCA 2AE7A 3F62B 3OGFA 2JCJA 2KH2A 2BO6A 2V0LA 3ZXDA 1YP4A 4FRMA 5C1LA 4JISA 2BEAA 3FJAA 3CRHA 3FUQA 1H5TA 4I4RA 4ZA3B 4FVVA 1MP5A 5BP5C 3BRFA 4Y7TA 5C48A 4C2SA 3O49A 4I0YA 3H6QA 3CU0A 1ZDFA 4IRQA 3WMUA 4KBBA 4LO2A 1HWNB 5BOWA 1WSZA 3U0YA 1FQ9A 1YTOA 2ZR1B 2RG9B 4USPA 4Z9WB 3V0BA 1TVYA 4FREA 5CQLX 4I96A 2VXMA 3D5NA 2D7IA 1G9RA 1S4OA 1VZUA 4KNRA 2QYIB 1WD4A 3BA7A 2YC5A 4HO9A 4ASYA 4Y7UA 3D8VA 1GX4A 3R4SA 1SS9A 3FFZA 4K6RA 3CKQA 1O7OA 1BASA 9ILBA 1WT2A 2PGYA 2FYBA 1IILA 1NQIB 2D1ZA 2VSAA 4XFUA 1S0GA 2R9KB 2Z87A 3IOJA 3F1RA 3JUJA 5C36A 4ZFUB 1YXWA 2BO8A 4GOYA 3U2WA 2BO4A 3SX5A 4EEGA 2VUAA 1YP3A 2RIYA 2PX7A 3SX7A 3NBNA 1PUMB 1IINA 1JT3A 3PUBA 1ZI3A 1FGAA 3AZWA 1V6WA 4GOVA 1MP3A 4EEAA 1MC9A 1N4KA 1R7UA 5JMCA 4FQWA 2DRZA 4IONA 3V79C 4I7IA 3OH2A 1Q1UA 3D98A 5AJOA 5FU0A 3HOMA 4HA2A 1TTUA 5CMFX 1R7TA 3R3IA 5HPZA 3SXGA 1VH1A 1ONKB 1OMZA 2P39A 1JLYA 4I37A 1O7QA 4GP3A 4A7ZA 3V0AB 3K8EA 2A8WA 1NWGB 2AECA 2V0JA 3UJ4A 2VFZA 3T8SA 1OMXA 1O0RA 5CQOA 3FJ9A 4I8MA 1HM9A 2D22A 3BAGA 4I4XA 4ZBVB 1JTCA 4HJJA 3RSJA 1ZJPA 2YQCA 4HCQA 3O4CA 4I4UA 4Q9GA 3V8YA 4Y62A 2F8XC 3V0MA 1WT1A 1QGSA 3CA0A 4A7KA 1H7TA 2NTDA 1VGWA 3UJ0A 2VSIA 4JAWA 1BFGA 1TW1A 4J2KA 4G1RA 4O6NA 5JQQA 4HO5A 4AYJA 2Y9XE 4LO2C 5D92A 3RMVA 5DUYA 2D44A 3BAOA 3QR5A 3O44A 4ISRA 4JP0A 3E26A 2VS4A 3FWWA 4CVHA 4B5BA 1L2HA 3Q7WA 4I1EA 4JPZA 2I7BA 4IY8A 2QN4A 2Y6PA 2ZQOA 3BAVA 4UY4A 1W55A 3OC9A 41BIA 1V83A 1BFBA 5D62A 1JV3A 3ZGFA 1T4QA 1Q04A 3CA4A 3V8ZA 1IRAX 1FV2A 4MYBA 2VD4A 7I1BA 2HW9A 3OBRA 4QD2B 2I5EA 3BAUA 5F90A 2WRYA 2XMEA 4OEFA 1O23B 3ST8A 4AAWA 1JVDA 3CQAA 1ISXA 2RJ0A 5IDSA 2NYYA 2YQHA 1HWOB 2PGVA 4IY9A 1GX0A 5G00A 1WBAA 2WBCA 4IHZA 3S8KA 3UDAA 4LO7C 3UD8A 1FO8A 1H5RA 2A8UA 3Q7UA 3OGZA 1LVWA 4GAIA 2M49A 1FMZA 1AVAC 1H7GA 1VM8A 2Q4JA 3CKVA 4I4SA 3F1YA 3I0KA 1G9DA 2JCOA 4J2XA 2P6WA 2BO7A 4JD0A 1JYKA 3HALA 4HO8A 2AESA 1R8OA 2AM5A 4LO7B 1W3GA 3IM7A 1DFCA 1S0DA 3V90A 4D11C 1ZCYA 2Y4KA 5C4EA 1IHKA 3NJ5A 2WVMA 3FJ8A 5FU8A 1R82A 3FJFA 4L41C 4R7PA 4HO0A 4QKSA 4HG6A 3POLA 5HS2A 2VK9A 3O4AA 2O1GA 5C3BA 3CU1B 2Z49A 2GGQA 4MIXA 1S0CA 5C4DA 3BAHA 4KC4A 4KEIA 3I2XA 3NBEA 1IJTA 4KEKA 1JQZA 4F83A 1EZIA 4Y7GA 4AN7B 3FJBA 3SX3A 4FRLA 4DENA 4ISQA 1TWEA 1G0RA 1EV2A 3USRA 4DCKC 4DE7A 4D0ZA 3CKOA 5BXSA 1WD3A 3BRDA 3POKA 1DZDA 2V0IA 2V0HA 1VCLA 5L6VA 3WO2A 2Y4LA 3I0LA 1INIA 1JVGA 1DIWA 1AFCA 1XZZA 4EEMA 1NHEB 1S0EA 3PMEA 3WO3A 3CRIA 3OAMA 4G3QA 5FYEA 1R80A 3AJ6A 2Z48A 2Q3NB 5EHAA 3Q7XA 3S8JA 2O1HA 4B2WA 5C1HA 2RJ9A 4G9NA 1JT5A 4P0KA 4P6AA 4AN6A 2X60A 1TFMB 1I1EA 1RMLA 1LL3A 5EIYA 1FWUA 1ISVA 1H5SA 4MZFB 3IAGC 1HCDA 4IZEA 3HMYA 2RIXA 3WINA 1M16A 2FYDB 5BQUA 1Z4SA 2VSEA 3CA5A 3LTQA 1W77A 4P02A 1S0FA 2AQZA 2FO1A 1VGTA 1ITBA 2FY7A 2P23A 2RQ9A 1G93A 2F2FA 2I5KA 1NUNA 3CA1A 3IM5A 1TOOA 2GGOA 4G3SA 3C9ZA 3SXEA 1XG6A 1ZCVA 3MALA 3AKGA 5DDVA 3USQA 4KT7A 2DREA 4FRQA 5EG6C 1ZI4A 4BQHA 1ZJ0A 4M2BA 1VH3A 4OWKA 1YROB 1VICA 3BTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LZI A;  2RJ4 A;  3E25 A;  4HO6 A;  4II0 A;  3ZGG A;  4ARW A;  4CJB A;  1XHB A;  2VLC A;  3CGX A;  4KPX A;  4DEC A;  4QO3 A;  1AVU A;  2WEE A;  5DVH A;  3TZT A;  3O3Q A;  1GA8 A;  3EF2 A;  4QBC A;  3IOH A;  3BRK X;  3R2W A;  4FCU A;  4G87 A;  3RMW A;  4PC4 A;  2ZU7 A;  3I0C A;  3Q4S A;  2XWL A;  1IOB A;  1FGX A;  3A07 A;  2OEG A;  3SXA A;  4EE5 A;  4L4H A;  1QXM A;  3B9U A;  1HV9 A;  3P53 A;  2KI4 A;  4KC3 A;  2Y4J A;  1R81 A;  4G3P A;  1H5S D;  2AGD A;  4NAN A;  6I1B A;  4DDZ A;  4ZOT A;  1WT3 A;  5IDT A;  2D20 A;  1FGG A;  3FJJ A;  2E4M C;  3N7J A;  4OEG A;  1G97 A;  4M4K A;  1ILR 1;  1DLL A;  3JUT A;  1LL2 A;  5J49 A;  2CU2 A;  1YYN A;  3FUO A;  2WE9 A;  4I4P A;  1K5V A;  3I0D A;  5EJ1 A;  2AFG A;  2OI5 A;  2OI6 A;  3BX1 C;  1ISY A;  4NAK A;  1JLX A;  2BFH A;  3N7K A;  2OI7 A;  1M2T B;  4G6M A;  2XOA A;  4DEP A;  4FGF A;  1G8O A;  3FJK A;  4HR6 C;  4KC2 A;  1G23 A;  3WMV A;  1BLD A;  2RJ7 A;  5L6S A;  3FGM A;  4ZFY B;  1FXJ A;  4KQL A;  3SXD A;  1Q03 A;  3BRG C;  1S4N A;  8I1B A;  2ERM A;  3IIR A;  2VSH A;  4LO3 A;  2XWN A;  4JQ0 A;  3OH0 A;  2XWM A;  4KXO A;  4YS8 A;  3BAQ A;  3FJC A;  3DJ4 A;  1G82 A;  2D0J A;  1NZK A;  1GQC A;  1H5S C;  1HWP B;  1JYL A;  2RIT A;  2YES A;  1FXO A;  1R7X A;  4ZKT B;  2ESU A;  1KWS A;  2AH9 A;  3DUV A;  1HM8 A;  4JRA A;  1IRP A;  1P63 A;  4X39 A;  3WIN C;  1XZ6 A;  5EJZ A;  1INJ A;  3F1C A;  1FV3 A;  3SPT A;  3RMY A;  5C49 A;  5BQU C;  1H5S B;  3PNN A;  1LL0 A;  2ZU9 A;  1TWM A;  3H6R A;  1H5T B;  2DPW A;  2RIZ A;  1Z2V A;  3A21 A;  3VSF A;  2F2F C;  3ZC9 A;  3ILA A;  2VS5 A;  4FRH A;  4IRP A;  4J18 A;  4B4B A;  2FGF A;  5FTV A;  2Z86 A;  4J23 B;  5CQN X;  3UD9 A;  3V0B B;  4ASJ A;  1BFF A;  4IZX A;  1ISZ A;  3NBD A;  3O4D A;  1NKH B;  2FYC B;  2MC2 A;  4A7Y A;  3JTJ A;  2RJ1 A;  3I2A A;  4YOL A;  2D43 A;  1ZDG A;  3AH4 A;  2HZ9 A;  2NZ9 A;  4ECM A;  1ZJ2 A;  4M28 A;  3U2X A;  1QQL A;  3QYD A;  1JT4 A;  3PG0 A;  5C4B A;  2APC A;  1VGZ A;  1IT0 A;  2Q9X A;  2D24 A;  4LO8 B;  3OGG A;  1FN0 A;  5BXT A;  1G9B A;  1FR9 A;  3E8L C;  3AJ5 A;  4LO0 A;  1BAR A;  5BP5 A;  2AM3 A;  5EC5 A;  1PZY B;  5C4F A;  1ZI1 A;  4TLP A;  1ABR B;  21BI A;  3KMV A;  2ICX A;  3ZLK A;  2ET2 A;  5E24 E;  3AH2 A;  2GZB A;  1G9C A;  3NBC A;  1PC8 B;  4I1B A;  2BEB A;  3IM6 A;  1G3L A;  2FYA A;  3HN1 A;  4LO1 A;  1ON8 A;  1Z90 A;  2O1F A;  2P72 A;  3ZLL A;  2Y7A A;  4EVW A;  4OWL A;  4FRD A;  1JY0 A;  3A23 A;  5FNX A;  2W0W A;  4AYL A;  4P0J A;  1YBI A;  1ZCU A;  2X5Z A;  3FJD A;  1TP0 A;  4GP0 A;  2VXR A;  1AXM A;  5F8Y A;  4QC4 A;  3SNV A;  4Y7F A;  1TW5 A;  5DSS B;  4G9M A;  4LO3 C;  3PKP A;  3I0J A;  1H7E A;  2QH5 A;  1YF8 B;  3BAD A;  3FJI A;  3KIA A;  4HOC A;  2ZU8 A;  3VUO A;  2HWA A;  2L5X A;  1LZ7 A;  1WBC A;  2FDB M;  3P6J A;  3TQD A;  4HO2 A;  3IOI A;  3OJM A;  3VWC A;  4OEE A;  2DS0 A;  1FG5 N;  2W0V A;  3ZF8 A;  3V91 A;  2KI6 B;  1E5K A;  1W3F A;  4I3N A;  5AJN A;  3LLP A;  5C4C A;  1BLA A;  1GQ9 A;  2Y9W C;  4X38 A;  1R8N A;  1YP2 A;  3OJ2 A;  5D63 A;  3O3P A;  3T7N A;  3O4O A;  1FRW A;  5BXP A;  1ZI5 A;  1TIE A;  1TZF A;  3BA5 A;  4I4Q A;  1SR4 A;  4XFT A;  5FNW A;  2Y9F A;  1QQK A;  3BA4 A;  4EFR A;  2Y4M A;  1ZCT A;  1HJL A;  4KEJ A;  2YUG A;  3UD7 A;  1IIM A;  4H04 A;  1CVS A;  4I4V A;  3WA1 A;  4CJM A;  2AAI B;  2KLL A;  2UUS A;  1DJS B;  3SXB A;  3QVB A;  4Y9X A;  1H4E A;  2ICY A;  5B2H A;  2Y9G A;  4IYB A;  2MZB A;  3ZXG A;  4LO0 C;  4XFS A;  4ZGR B;  1H7F A;  1AF9 A;  3T7O A;  2WVK A;  2X2S A;  1H5R B;  1XYF A;  1EPW A;  3MPP G;  1FR8 A;  5JLV A;  2YCM A;  1QGQ A;  3OH1 A;  4Y7V A;  1MP4 A;  4OUJ A;  4Y6U A;  5D61 A;  5I1F A;  2DRY A;  3AKH A;  4UEG A;  2K8R A;  4KC1 A;  4OW4 A;  3Q7Y A;  3RTI B;  4HO3 A;  3PHZ A;  4LO1 C;  5FZZ A;  1K4V A;  3HL3 A;  1LZJ A;  4FCE A;  1VZT A;  1I1B A;  31BI A;  1S4P A;  3AH1 A;  1G2V A;  1V84 A;  3RSB A;  4B2X A;  5C3D A;  2XMH A;  5FV9 A;  3RMX A;  4J2S A;  5CMI A;  3I0E A;  2V0K A;  3I0F A;  4EEO A;  3A22 A;  1OQL B;  3N7L A;  2JCK A;  4ZDQ A;  1H4C A;  3VT2 A;  2AXM A;  2E8B A;  3PKQ A;  3T7M A;  3DK5 A;  5F8W A;  1HM0 A;  1V6U A;  4F34 A;  4Q9P A;  3ZC8 A;  1ZIZ A;  1F31 A;  5CMJ A;  5IFY A;  2MIB A;  3HBW A;  4D8H A;  1H3M A;  1A8D A;  1BFC A;  1II4 A;  4KRV A;  5GAQ A;  1E0O A;  4XKI A;  1EYL A;  4QBV A;  4QKR A;  1G1L A;  1VPA A;  3OH3 A;  3U2T A;  1MD6 A;  1I52 A;  3GUE A;  1Z0H A;  3K8D A;  4D11 A;  3AKI A;  1FWY A;  1PZT A;  2P73 A;  3NGW A;  3CRG A;  4EFP A;  1QWJ A;  4M2A A;  1G9A A;  1G95 A;  4I2S A;  2NXV A;  2PA4 A;  3Q80 A;  5CMG X;  3D7W B;  5DZU A;  2D7R A;  1V6V A;  5BXR A;  1FMM S;  3CA3 A;  1HWM B;  1GWV A;  3O4B A;  1SZ6 B;  2VU9 A;  1SR4 C;  1GWW A;  1K5U A;  3H6S E;  4OWJ A;  1ZJ3 A;  2IWT B;  4B4G A;  4ZFW B;  1AVX B;  4NAL A;  2NVH A;  5FZY A;  4END A;  4G6J A;  1JT7 A;  3CKJ A;  4J2Y A;  1ON6 A;  1NMM B;  5C3A A;  3OBT A;  2K43 A;  2GO2 A;  4P00 A;  3V0P A;  3WO4 A;  1ISW A;  3U0X A;  4CJC A;  4NAI A;  4D48 A;  1RG8 A;  2FFU A;  3VEQ A;  1D0H A;  4P0L A;  1WVC A;  3CA6 A;  3OH4 A;  4JKQ A;  1T9F A;  3VT1 A;  1PUU B;  1PZZ A;  1VZX A;  3JRR A;  1S0B A;  2IHO A;  4GAF A;  4E1K A;  2D23 A;  1LZ0 A;  1VGU A;  3I29 B;  3FJE A;  4QAL A;  2RST A;  1OQM B;  4Y64 A;  5C47 A;  3OJV A;  4IQP A;  1H7H A;  3V0N A;  4H9W A;  4Z8S B;  1EYR A;  4HO4 A;  2LIE A;  5C38 A;  1R7Y A;  4EFQ A;  1NF5 B;  3N9W A;  4LW6 A;  1RY7 A;  3P6I A;  4QD2 C;  5CQM X;  1FWV A;  4I4Y A;  3VSZ A;  3FJH A;  4LW3 A;  4KPZ A;  5AJP A;  4EE4 A;  5C8R A;  3RTJ B;  5F8S A;  4B4M A;  4EE3 A;  1R7V A;  3HSM A;  5DDT A;  2FFV A;  2VXT I;  1UPS A;  3TC2 A;  2WGZ A;  4AC3 A;  1MC3 A;  1KNM A;  4FRO A;  2K4A B;  2OEF A;  1ZJO A;  2RJ5 A;  3AKF A;  4ZLB B;  1S0L A;  3N0K A;  1FO9 A;  1RZO B;  1H7L A;  2NP0 A;  2QGI A;  1ZJ1 A;  1GGP B;  2YQJ A;  1J0S A;  3OKR A;  2J3P A;  3LW6 A;  3N7M A;  3AZV A;  1DQO A;  1V6X A;  2AM4 A;  3O5W B;  3BCV A;  1DZC A;  3I0I X;  4USO A;  3BB2 A;  3W9T A;  2YC3 A;  1HCE A;  4FRB A;  3JUK A;  2I1B A;  4I6I A;  4R6U B;  1FZW A;  2E3D A;  1EVT A;  1QG8 A;  1HKN A;  2MLL B;  2LIQ A;  3CKN A;  2WVL A;  5CQP A;  2VS3 A;  3SX8 A;  3FOQ A;  4JKX B;  2ZQN A;  4EEE B;  1H7Q A;  4Y6N A;  1DFQ A;  3I0H A;  1DQG A;  2VXL A;  5C1G A;  1BA7 A;  3V0O A;  4BMA A;  1PWA A;  3CAH A;  4I4O A;  4D0T A;  2X5S A;  5FUH A;  3U2V A;  4B3U A;  5BVP I;  4EKX B;  3ZX7 A;  3V0L A;  4Q91 A;  1H4D A;  2E4M A;  1W3A A;  1V82 A;  1WT0 A;  3V0A A;  1ZHJ A;  1FOA A;  4X37 A;  4WBC A;  2RJ8 A;  2UX8 A;  4Y63 A;  3SXC A;  2NM1 A;  4EB2 B;  2KKI A;  4X3A A;  2QKX A;  3R4U A;  5CMH A;  2HWM A;  1HJJ A;  3I0G A;  3H6R B;  2X65 A;  4B42 A;  4KNX A;  1HIB A;  4CJ8 A;  5FZU A;  1JV1 A;  3VT0 A;  2RJ6 A;  1CE7 B;  4XWI A;  4MND A;  4L4I A;  3EE5 A;  2WAW A;  4FRA A;  4GBP A;  2X2T A;  1W57 A;  2JCL A;  4FRP A;  5I1B A;  2YQS A;  1AVW B;  3U2U A;  3K1X A;  3V0Q A;  5FTS A;  5BXC A;  2AE7 A;  3F62 B;  3OGF A;  2JCJ A;  2KH2 A;  2BO6 A;  2V0L A;  3ZXD A;  1YP4 A;  4FRM A;  5C1L A;  4JIS A;  2BEA A;  3FJA A;  3CRH A;  3FUQ A;  1H5T A;  4I4R A;  4ZA3 B;  4FVV A;  1MP5 A;  5BP5 C;  3BRF A;  4Y7T A;  5C48 A;  4C2S A;  3O49 A;  4I0Y A;  3H6Q A;  3CU0 A;  1ZDF A;  4IRQ A;  3WMU A;  4KBB A;  4LO2 A;  1HWN B;  5BOW A;  1WSZ A;  3U0Y A;  1FQ9 A;  1YTO A;  2ZR1 B;  2RG9 B;  4USP A;  4Z9W B;  3V0B A;  1TVY A;  4FRE A;  5CQL X;  4I96 A;  2VXM A;  3D5N A;  2D7I A;  1G9R A;  1S4O A;  1VZU A;  4KNR A;  2QYI B;  1WD4 A;  3BA7 A;  2YC5 A;  4HO9 A;  4ASY A;  4Y7U A;  3D8V A;  1GX4 A;  3R4S A;  1SS9 A;  3FFZ A;  4K6R A;  3CKQ A;  1O7O A;  1BAS A;  9ILB A;  1WT2 A;  2PGY A;  2FYB A;  1IIL A;  1NQI B;  2D1Z A;  2VSA A;  4XFU A;  1S0G A;  2R9K B;  2Z87 A;  3IOJ A;  3F1R A;  3JUJ A;  5C36 A;  4ZFU B;  1YXW A;  2BO8 A;  4GOY A;  3U2W A;  2BO4 A;  3SX5 A;  4EEG A;  2VUA A;  1YP3 A;  2RIY A;  2PX7 A;  3SX7 A;  3NBN A;  1PUM B;  1IIN A;  1JT3 A;  3PUB A;  1ZI3 A;  1FGA A;  3AZW A;  1V6W A;  4GOV A;  1MP3 A;  4EEA A;  1MC9 A;  1N4K A;  1R7U A;  5JMC A;  4FQW A;  2DRZ A;  4ION A;  3V79 C;  4I7I A;  3OH2 A;  1Q1U A;  3D98 A;  5AJO A;  5FU0 A;  3HOM A;  4HA2 A;  1TTU A;  5CMF X;  1R7T A;  3R3I A;  5HPZ A;  3SXG A;  1VH1 A;  1ONK B;  1OMZ A;  2P39 A;  1JLY A;  4I37 A;  1O7Q A;  4GP3 A;  4A7Z A;  3V0A B;  3K8E A;  2A8W A;  1NWG B;  2AEC A;  2V0J A;  3UJ4 A;  2VFZ A;  3T8S A;  1OMX A;  1O0R A;  5CQO A;  3FJ9 A;  4I8M A;  1HM9 A;  2D22 A;  3BAG A;  4I4X A;  4ZBV B;  1JTC A;  4HJJ A;  3RSJ A;  1ZJP A;  2YQC A;  4HCQ A;  3O4C A;  4I4U A;  4Q9G A;  3V8Y A;  4Y62 A;  2F8X C;  3V0M A;  1WT1 A;  1QGS A;  3CA0 A;  4A7K A;  1H7T A;  2NTD A;  1VGW A;  3UJ0 A;  2VSI A;  4JAW A;  1BFG A;  1TW1 A;  4J2K A;  4G1R A;  5JQQ A;  4HO5 A;  4AYJ A;  2Y9X E;  4LO2 C;  3RMV A;  5DUY A;  2D44 A;  3BAO A;  3QR5 A;  3O44 A;  4ISR A;  4JP0 A;  3E26 A;  2VS4 A;  3FWW A;  4CVH A;  4B5B A;  1L2H A;  3Q7W A;  4I1E A;  4JPZ A;  2I7B A;  4IY8 A;  2QN4 A;  2Y6P A;  2ZQO A;  3BAV A;  1W55 A;  3OC9 A;  41BI A;  1V83 A;  1BFB A;  5D62 A;  1JV3 A;  3ZGF A;  1T4Q A;  1Q04 A;  3CA4 A;  3V8Z A;  1IRA X;  1FV2 A;  4MYB A;  2VD4 A;  7I1B A;  2HW9 A;  3OBR A;  4QD2 B;  2I5E A;  3BAU A;  5F90 A;  2WRY A;  2XME A;  4OEF A;  1O23 B;  3ST8 A;  4AAW A;  1JVD A;  3CQA A;  1ISX A;  2RJ0 A;  5IDS A;  2NYY A;  2YQH A;  1HWO B;  2PGV A;  4IY9 A;  1GX0 A;  5G00 A;  1WBA A;  2WBC A;  4IHZ A;  3S8K A;  3UDA A;  4LO7 C;  3UD8 A;  1FO8 A;  1H5R A;  2A8U A;  3Q7U A;  3OGZ A;  1LVW A;  4GAI A;  2M49 A;  1FMZ A;  1AVA C;  1H7G A;  1VM8 A;  2Q4J A;  3CKV A;  4I4S A;  3F1Y A;  3I0K A;  1G9D A;  2JCO A;  4J2X A;  2P6W A;  2BO7 A;  4JD0 A;  1JYK A;  3HAL A;  4HO8 A;  2AES A;  1R8O A;  2AM5 A;  4LO7 B;  1W3G A;  3IM7 A;  1DFC A;  1S0D A;  3V90 A;  4D11 C;  1ZCY A;  2Y4K A;  5C4E A;  1IHK A;  3NJ5 A;  2WVM A;  3FJ8 A;  5FU8 A;  1R82 A;  3FJF A;  4L41 C;  4R7P A;  4HO0 A;  4QKS A;  4HG6 A;  3POL A;  5HS2 A;  3O4A A;  2O1G A;  5C3B A;  3CU1 B;  2Z49 A;  2GGQ A;  5C4D A;  1S0C A;  3BAH A;  4KC4 A;  4KEI A;  3I2X A;  3NBE A;  1IJT A;  4KEK A;  1JQZ A;  4F83 A;  1EZI A;  4Y7G A;  4AN7 B;  3FJB A;  3SX3 A;  4FRL A;  4DEN A;  4ISQ A;  1TWE A;  1G0R A;  1EV2 A;  3USR A;  4DCK C;  4DE7 A;  4D0Z A;  3CKO A;  5BXS A;  1WD3 A;  3BRD A;  3POK A;  1DZD A;  2V0I A;  2V0H A;  1VCL A;  5L6V A;  3WO2 A;  2Y4L A;  3I0L A;  1INI A;  1JVG A;  1DIW A;  1AFC A;  1XZZ A;  4EEM A;  1NHE B;  1S0E A;  3PME A;  3WO3 A;  3CRI A;  3OAM A;  4G3Q A;  5FYE A;  1R80 A;  3AJ6 A;  2Z48 A;  2Q3N B;  5EHA A;  3Q7X A;  3S8J A;  2O1H A;  4B2W A;  5C1H A;  2RJ9 A;  4G9N A;  1JT5 A;  4P0K A;  4P6A A;  4AN6 A;  2X60 A;  1TFM B;  1I1E A;  1RML A;  1LL3 A;  5EIY A;  1FWU A;  1ISV A;  1H5S A;  3IAG C;  1HCD A;  4IZE A;  3HMY A;  2RIX A;  3WIN A;  1M16 A;  2FYD B;  5BQU A;  1Z4S A;  2VSE A;  3CA5 A;  3LTQ A;  1W77 A;  4P02 A;  1S0F A;  2AQZ A;  2FO1 A;  1VGT A;  1ITB A;  2FY7 A;  2P23 A;  2RQ9 A;  1G93 A;  2F2F A;  2I5K A;  1NUN A;  3CA1 A;  3IM5 A;  1TOO A;  2GGO A;  4G3S A;  3C9Z A;  3SXE A;  1XG6 A;  1ZCV A;  3MAL A;  3AKG A;  5DDV A;  3USQ A;  4KT7 A;  2DRE A;  4FRQ A;  5EG6 C;  1ZI4 A;  4BQH A;  1ZJ0 A;  4M2B A;  1VH3 A;  4OWK A;  1YRO B;  1VIC A;  3BTA A; 
#chains in the Genus database with same CATH topology
 1LZI A;  2RJ4 A;  3E25 A;  4HO6 A;  4II0 A;  3ZGG A;  4ARW A;  4CJB A;  1XHB A;  2VLC A;  3CGX A;  4KPX A;  4DEC A;  4QO3 A;  1AVU A;  4MZH A;  5DVH A;  2WEE A;  3TZT A;  3O3Q A;  1GA8 A;  3EF2 A;  4QBC A;  3IOH A;  3BRK X;  3R2W A;  4FCU A;  4G87 A;  3RMW A;  4PC4 A;  2ZU7 A;  3I0C A;  3Q4S A;  2XWL A;  2NS2 A;  1IOB A;  1FGX A;  3A07 A;  2OEG A;  3SXA A;  4EE5 A;  4L4H A;  1QXM A;  3B9U A;  1HV9 A;  3P53 A;  2KI4 A;  4KC3 A;  2Y4J A;  1R81 A;  4G3P A;  1H5S D;  2AGD A;  4NAN A;  6I1B A;  4DDZ A;  4ZOT A;  1WT3 A;  5IDT A;  2D20 A;  1FGG A;  3FJJ A;  2E4M C;  3N7J A;  4OEG A;  1G97 A;  4M4K A;  1ILR 1;  1DLL A;  3JUT A;  1LL2 A;  5J49 A;  2CU2 A;  1YYN A;  3FUO A;  2WE9 A;  4I4P A;  1K5V A;  3I0D A;  5EJ1 A;  2AFG A;  2OI5 A;  2OI6 A;  3BX1 C;  1ISY A;  4NAK A;  1JLX A;  2BFH A;  3N7K A;  2OI7 A;  1M2T B;  4G6M A;  2XOA A;  4DEP A;  4FGF A;  1G8O A;  3FJK A;  4HR6 C;  4KC2 A;  1G23 A;  3WMV A;  1BLD A;  2RJ7 A;  5L6S A;  3FGM A;  4ZFY B;  1FXJ A;  4KQL A;  3SXD A;  1Q03 A;  3BRG C;  1S4N A;  8I1B A;  2ERM A;  3IIR A;  2VSH A;  4LO3 A;  2XWN A;  4JQ0 A;  3OH0 A;  2XWM A;  4KXO A;  4YS8 A;  3BAQ A;  3FJC A;  3DJ4 A;  1G82 A;  2D0J A;  1NZK A;  1GQC A;  1H5S C;  1HWP B;  1JYL A;  2RIT A;  2YES A;  1FXO A;  1R7X A;  4ZKT B;  2ESU A;  1KWS A;  2AH9 A;  3DUV A;  1HM8 A;  4JRA A;  1IRP A;  1P63 A;  4X39 A;  3WIN C;  1XZ6 A;  5EJZ A;  1INJ A;  3F1C A;  1FV3 A;  3SPT A;  3RMY A;  5C49 A;  5BQU C;  1H5S B;  3PNN A;  1LL0 A;  2ZU9 A;  1TWM A;  3H6R A;  1H5T B;  2DPW A;  2RIZ A;  1Z2V A;  3A21 A;  3VSF A;  2F2F C;  3ZC9 A;  3ILA A;  2VS5 A;  4FRH A;  4IRP A;  4J18 A;  4B4B A;  2FGF A;  5FTV A;  2Z86 A;  4J23 B;  5CQN X;  3UD9 A;  3V0B B;  4ASJ A;  1BFF A;  4IZX A;  1ISZ A;  3NBD A;  3O4D A;  1NKH B;  2FYC B;  2MC2 A;  4A7Y A;  3JTJ A;  2RJ1 A;  3I2A A;  4YOL A;  2D43 A;  1ZDG A;  4FIX A;  3AH4 A;  2HZ9 A;  2NZ9 A;  4ECM A;  1ZJ2 A;  4M28 A;  3U2X A;  1QQL A;  3QYD A;  1JT4 A;  3PG0 A;  5C4B A;  2APC A;  1VGZ A;  1IT0 A;  2Q9X A;  2D24 A;  4LO8 B;  3OGG A;  1FN0 A;  5BXT A;  1G9B A;  1FR9 A;  3E8L C;  3AJ5 A;  4LO0 A;  1BAR A;  5BP5 A;  2AM3 A;  5EC5 A;  1PZY B;  5C4F A;  1ZI1 A;  4TLP A;  1ABR B;  21BI A;  3KMV A;  2ICX A;  3ZLK A;  2ET2 A;  5E24 E;  3AH2 A;  2GZB A;  1G9C A;  3NBC A;  1PC8 B;  4I1B A;  2BEB A;  3IM6 A;  1G3L A;  2FYA A;  3HN1 A;  4LO1 A;  1ON8 A;  1Z90 A;  2O1F A;  2P72 A;  3ZLL A;  2Y7A A;  4EVW A;  4OWL A;  4FRD A;  1JY0 A;  3A23 A;  5FNX A;  2W0W A;  4AYL A;  4P0J A;  1YBI A;  1ZCU A;  2X5Z A;  3FJD A;  1TP0 A;  4GP0 A;  2VXR A;  1AXM A;  5F8Y A;  4QC4 A;  3SNV A;  4Y7F A;  1TW5 A;  5DSS B;  4G9M A;  4LO3 C;  3PKP A;  3I0J A;  1H7E A;  2QH5 A;  1YF8 B;  3BAD A;  3FJI A;  3KIA A;  4HOC A;  2ZU8 A;  3VUO A;  2HWA A;  4FIY A;  2L5X A;  1LZ7 A;  1WBC A;  2FDB M;  3P6J A;  3TQD A;  4HO2 A;  3IOI A;  3OJM A;  3VWC A;  4OEE A;  2DS0 A;  1FG5 N;  2W0V A;  3ZF8 A;  3V91 A;  2KI6 B;  1E5K A;  1W3F A;  4I3N A;  5AJN A;  3LLP A;  5C4C A;  1BLA A;  1GQ9 A;  2Y9W C;  4X38 A;  1R8N A;  1YP2 A;  3OJ2 A;  5D63 A;  3O3P A;  3T7N A;  3O4O A;  1FRW A;  5BXP A;  1ZI5 A;  1TIE A;  1TZF A;  3BA5 A;  4I4Q A;  1SR4 A;  4XFT A;  5FNW A;  2Y9F A;  1QQK A;  3BA4 A;  4EFR A;  2Y4M A;  1ZCT A;  1HJL A;  4KEJ A;  2YUG A;  3UD7 A;  1IIM A;  4H04 A;  1CVS A;  4I4V A;  3WA1 A;  4CJM A;  2AAI B;  2KLL A;  2UUS A;  1DJS B;  3SXB A;  3QVB A;  4Y9X A;  1H4E A;  2ICY A;  5B2H A;  2Y9G A;  4IYB A;  2MZB A;  3ZXG A;  4LO0 C;  4XFS A;  4ZGR B;  1H7F A;  1AF9 A;  3T7O A;  2C0N A;  2X2S A;  1H5R B;  1XYF A;  1EPW A;  3MPP G;  1FR8 A;  5JLV A;  2WVK A;  1QGQ A;  2YCM A;  3OH1 A;  4Y7V A;  1MP4 A;  4OUJ A;  4Y6U A;  5D61 A;  5I1F A;  2DRY A;  3AKH A;  4UEG A;  2K8R A;  4KC1 A;  4OW4 A;  3Q7Y A;  3RTI B;  4HO3 A;  3PHZ A;  4LO1 C;  5FZZ A;  1K4V A;  3HL3 A;  1LZJ A;  4FCE A;  1VZT A;  1I1B A;  31BI A;  1S4P A;  3AH1 A;  1G2V A;  1V84 A;  3RSB A;  4B2X A;  5C3D A;  2XMH A;  5FV9 A;  3RMX A;  4J2S A;  5CMI A;  3I0E A;  2V0K A;  3I0F A;  4EEO A;  3A22 A;  1OQL B;  3N7L A;  2JCK A;  4ZDQ A;  1H4C A;  3VT2 A;  2AXM A;  2E8B A;  3PKQ A;  3T7M A;  3DK5 A;  5F8W A;  1HM0 A;  1V6U A;  4F34 A;  4Q9P A;  3ZC8 A;  1ZIZ A;  1F31 A;  5CMJ A;  5IFY A;  2MIB A;  3HBW A;  4D8H A;  1H3M A;  1A8D A;  1BFC A;  1II4 A;  4KRV A;  5GAQ A;  1E0O A;  4XKI A;  1EYL A;  4QBV A;  4QKR A;  1G1L A;  1VPA A;  3OH3 A;  3U2T A;  1MD6 A;  1I52 A;  3GUE A;  1Z0H A;  3K8D A;  4D11 A;  3AKI A;  1FWY A;  1PZT A;  2P73 A;  3NGW A;  3CRG A;  4EFP A;  1QWJ A;  4M2A A;  4MZG B;  1G9A A;  1G95 A;  4I2S A;  2NXV A;  2PA4 A;  3Q80 A;  5CMG X;  3D7W B;  5DZU A;  2D7R A;  1V6V A;  5BXR A;  1FMM S;  3CA3 A;  1HWM B;  1GWV A;  3O4B A;  1SZ6 B;  2VU9 A;  1SR4 C;  1GWW A;  1K5U A;  3H6S E;  4OWJ A;  1ZJ3 A;  2IWT B;  4B4G A;  4ZFW B;  1AVX B;  4NAL A;  2NVH A;  5FZY A;  4END A;  4G6J A;  1JT7 A;  3CKJ A;  4J2Y A;  1ON6 A;  1NMM B;  5C3A A;  3OBT A;  2K43 A;  2GO2 A;  4P00 A;  3V0P A;  4H75 A;  3WO4 A;  1ISW A;  3U0X A;  4CJC A;  4NAI A;  4D48 A;  1RG8 A;  2FFU A;  3VEQ A;  1D0H A;  4P0L A;  1WVC A;  3CA6 A;  3OH4 A;  4JKQ A;  1T9F A;  3VT1 A;  1PUU B;  1PZZ A;  1VZX A;  3JRR A;  1S0B A;  2IHO A;  4GAF A;  4E1K A;  2D23 A;  1LZ0 A;  1VGU A;  3I29 B;  3FJE A;  4QAL A;  2RST A;  1OQM B;  4Y64 A;  5C47 A;  3OJV A;  4IQP A;  1H7H A;  3V0N A;  4H9W A;  4Z8S B;  1EYR A;  4HO4 A;  2LIE A;  4O6M A;  5C38 A;  1R7Y A;  4EFQ A;  1NF5 B;  3N9W A;  4LW6 A;  1RY7 A;  3P6I A;  4QD2 C;  5CQM X;  1FWV A;  4I4Y A;  3VSZ A;  3FJH A;  4LW3 A;  4KPZ A;  5AJP A;  4EE4 A;  5C8R A;  3RTJ B;  5F8S A;  4B4M A;  4EE3 A;  1R7V A;  3HSM A;  5DDT A;  2FFV A;  2VXT I;  1UPS A;  3TC2 A;  2WGZ A;  4AC3 A;  1MC3 A;  5D91 A;  1KNM A;  4FRO A;  2K4A B;  2OEF A;  1ZJO A;  2RJ5 A;  3AKF A;  4ZLB B;  1S0L A;  3N0K A;  1FO9 A;  1RZO B;  1H7L A;  2NP0 A;  2J0A A;  2QGI A;  1ZJ1 A;  1GGP B;  2YQJ A;  1J0S A;  3OKR A;  2J3P A;  3LW6 A;  3N7M A;  3AZV A;  1DQO A;  1V6X A;  2AM4 A;  3O5W B;  3BCV A;  1DZC A;  3I0I X;  4USO A;  3BB2 A;  3W9T A;  2YC3 A;  1HCE A;  4FRB A;  3JUK A;  2I1B A;  4I6I A;  4R6U B;  1FZW A;  2E3D A;  1EVT A;  1QG8 A;  1HKN A;  2MLL B;  2LIQ A;  3CKN A;  2WVL A;  5CQP A;  2VS3 A;  3SX8 A;  3FOQ A;  4JKX B;  2ZQN A;  4EEE B;  1H7Q A;  4Y6N A;  1DFQ A;  3I0H A;  1DQG A;  2VXL A;  5C1G A;  1BA7 A;  3V0O A;  4BMA A;  1PWA A;  3CAH A;  4I4O A;  4D0T A;  2X5S A;  5FUH A;  3U2V A;  4B3U A;  5BVP I;  4EKX B;  3ZX7 A;  3V0L A;  4Q91 A;  1H4D A;  2E4M A;  1W3A A;  1V82 A;  1WT0 A;  3V0A A;  1ZHJ A;  1FOA A;  4X37 A;  4WBC A;  2RJ8 A;  2UX8 A;  4Y63 A;  3SXC A;  2NM1 A;  4Q7C A;  4EB2 B;  2KKI A;  4X3A A;  2QKX A;  3R4U A;  5CMH A;  2HWM A;  1HJJ A;  3I0G A;  3H6R B;  2X65 A;  4B42 A;  4KNX A;  1HIB A;  4CJ8 A;  5FZU A;  1JV1 A;  3VT0 A;  2RJ6 A;  1CE7 B;  4XWI A;  4MND A;  4L4I A;  3EE5 A;  2WAW A;  4FRA A;  4GBP A;  2X2T A;  1W57 A;  2JCL A;  4FRP A;  2J0B A;  5I1B A;  2YQS A;  1AVW B;  3U2U A;  3K1X A;  3V0Q A;  5FTS A;  5BXC A;  2AE7 A;  3F62 B;  3OGF A;  2JCJ A;  2KH2 A;  2BO6 A;  2V0L A;  3ZXD A;  1YP4 A;  4FRM A;  5C1L A;  4JIS A;  2BEA A;  3FJA A;  3CRH A;  3FUQ A;  1H5T A;  4I4R A;  4ZA3 B;  4FVV A;  1MP5 A;  5BP5 C;  3BRF A;  4Y7T A;  5C48 A;  4C2S A;  3O49 A;  4I0Y A;  3H6Q A;  3CU0 A;  1ZDF A;  4IRQ A;  3WMU A;  4KBB A;  4LO2 A;  1HWN B;  5BOW A;  1WSZ A;  3U0Y A;  1FQ9 A;  1YTO A;  2ZR1 B;  2RG9 B;  4USP A;  4Z9W B;  3V0B A;  1TVY A;  4FRE A;  5CQL X;  4I96 A;  2VXM A;  3D5N A;  2D7I A;  1G9R A;  1S4O A;  1VZU A;  4KNR A;  2QYI B;  1WD4 A;  3BA7 A;  2YC5 A;  4HO9 A;  4ASY A;  4Y7U A;  3D8V A;  1GX4 A;  3R4S A;  1SS9 A;  3FFZ A;  4K6R A;  3CKQ A;  1O7O A;  1BAS A;  9ILB A;  1WT2 A;  2PGY A;  2FYB A;  1IIL A;  1NQI B;  2D1Z A;  2VSA A;  4XFU A;  1S0G A;  2R9K B;  2Z87 A;  3IOJ A;  3F1R A;  3JUJ A;  5C36 A;  4ZFU B;  1YXW A;  2BO8 A;  4GOY A;  3U2W A;  2BO4 A;  3SX5 A;  4EEG A;  2VUA A;  1YP3 A;  2RIY A;  2PX7 A;  3SX7 A;  3NBN A;  1PUM B;  1IIN A;  1JT3 A;  3PUB A;  1ZI3 A;  1FGA A;  3AZW A;  1V6W A;  4GOV A;  1MP3 A;  4EEA A;  1MC9 A;  1N4K A;  1R7U A;  5JMC A;  4FQW A;  2DRZ A;  4ION A;  3V79 C;  4I7I A;  3OH2 A;  1Q1U A;  3D98 A;  5AJO A;  5FU0 A;  3HOM A;  4HA2 A;  1TTU A;  5CMF X;  1R7T A;  3R3I A;  5HPZ A;  3SXG A;  1VH1 A;  1ONK B;  1OMZ A;  2P39 A;  1JLY A;  4I37 A;  1O7Q A;  4GP3 A;  4A7Z A;  3V0A B;  3K8E A;  2A8W A;  1NWG B;  2AEC A;  2V0J A;  3UJ4 A;  2VFZ A;  3T8S A;  1OMX A;  1O0R A;  5CQO A;  3FJ9 A;  4I8M A;  1HM9 A;  2D22 A;  3BAG A;  4I4X A;  4ZBV B;  1JTC A;  4HJJ A;  3RSJ A;  1ZJP A;  2YQC A;  4HCQ A;  3O4C A;  4I4U A;  4Q9G A;  3V8Y A;  4Y62 A;  2F8X C;  3V0M A;  1WT1 A;  1QGS A;  3CA0 A;  4A7K A;  1H7T A;  2NTD A;  1VGW A;  3UJ0 A;  2VSI A;  4JAW A;  1BFG A;  1TW1 A;  4J2K A;  4G1R A;  4O6N A;  5JQQ A;  4HO5 A;  4AYJ A;  2Y9X E;  4LO2 C;  5D92 A;  3RMV A;  5DUY A;  2D44 A;  3BAO A;  3QR5 A;  3O44 A;  4ISR A;  4JP0 A;  3E26 A;  2VS4 A;  3FWW A;  4CVH A;  4B5B A;  1L2H A;  3Q7W A;  4I1E A;  4JPZ A;  2I7B A;  4IY8 A;  2QN4 A;  2Y6P A;  2ZQO A;  3BAV A;  4UY4 A;  1W55 A;  3OC9 A;  41BI A;  1V83 A;  1BFB A;  5D62 A;  1JV3 A;  3ZGF A;  1T4Q A;  1Q04 A;  3CA4 A;  3V8Z A;  1IRA X;  1FV2 A;  4MYB A;  2VD4 A;  7I1B A;  2HW9 A;  3OBR A;  4QD2 B;  2I5E A;  3BAU A;  5F90 A;  2WRY A;  2XME A;  4OEF A;  1O23 B;  3ST8 A;  4AAW A;  1JVD A;  3CQA A;  1ISX A;  2RJ0 A;  5IDS A;  2NYY A;  2YQH A;  1HWO B;  2PGV A;  4IY9 A;  1GX0 A;  5G00 A;  1WBA A;  2WBC A;  4IHZ A;  3S8K A;  3UDA A;  4LO7 C;  3UD8 A;  1FO8 A;  1H5R A;  2A8U A;  3Q7U A;  3OGZ A;  1LVW A;  4GAI A;  2M49 A;  1FMZ A;  1AVA C;  1H7G A;  1VM8 A;  2Q4J A;  3CKV A;  4I4S A;  3F1Y A;  3I0K A;  1G9D A;  2JCO A;  4J2X A;  2P6W A;  2BO7 A;  4JD0 A;  1JYK A;  3HAL A;  4HO8 A;  2AES A;  1R8O A;  2AM5 A;  4LO7 B;  1W3G A;  3IM7 A;  1DFC A;  1S0D A;  3V90 A;  4D11 C;  1ZCY A;  2Y4K A;  5C4E A;  1IHK A;  3NJ5 A;  2WVM A;  3FJ8 A;  5FU8 A;  1R82 A;  3FJF A;  4L41 C;  4R7P A;  4HO0 A;  4QKS A;  4HG6 A;  3POL A;  5HS2 A;  2VK9 A;  3O4A A;  2O1G A;  5C3B A;  3CU1 B;  2Z49 A;  2GGQ A;  4MIX A;  1S0C A;  5C4D A;  3BAH A;  4KC4 A;  4KEI A;  3I2X A;  3NBE A;  1IJT A;  4KEK A;  1JQZ A;  4F83 A;  1EZI A;  4Y7G A;  4AN7 B;  3FJB A;  3SX3 A;  4FRL A;  4DEN A;  4ISQ A;  1TWE A;  1G0R A;  1EV2 A;  3USR A;  4DCK C;  4DE7 A;  4D0Z A;  3CKO A;  5BXS A;  1WD3 A;  3BRD A;  3POK A;  1DZD A;  2V0I A;  2V0H A;  1VCL A;  5L6V A;  3WO2 A;  2Y4L A;  3I0L A;  1INI A;  1JVG A;  1DIW A;  1AFC A;  1XZZ A;  4EEM A;  1NHE B;  1S0E A;  3PME A;  3WO3 A;  3CRI A;  3OAM A;  4G3Q A;  5FYE A;  1R80 A;  3AJ6 A;  2Z48 A;  2Q3N B;  5EHA A;  3Q7X A;  3S8J A;  2O1H A;  4B2W A;  5C1H A;  2RJ9 A;  4G9N A;  1JT5 A;  4P0K A;  4P6A A;  4AN6 A;  2X60 A;  1TFM B;  1I1E A;  1RML A;  1LL3 A;  5EIY A;  1FWU A;  1ISV A;  1H5S A;  4MZF B;  3IAG C;  1HCD A;  4IZE A;  3HMY A;  2RIX A;  3WIN A;  1M16 A;  2FYD B;  5BQU A;  1Z4S A;  2VSE A;  3CA5 A;  3LTQ A;  1W77 A;  4P02 A;  1S0F A;  2AQZ A;  2FO1 A;  1VGT A;  1ITB A;  2FY7 A;  2P23 A;  2RQ9 A;  1G93 A;  2F2F A;  2I5K A;  1NUN A;  3CA1 A;  3IM5 A;  1TOO A;  2GGO A;  4G3S A;  3C9Z A;  3SXE A;  1XG6 A;  1ZCV A;  3MAL A;  3AKG A;  5DDV A;  3USQ A;  4KT7 A;  2DRE A;  4FRQ A;  5EG6 C;  1ZI4 A;  4BQH A;  1ZJ0 A;  4M2B A;  1VH3 A;  4OWK A;  1YRO B;  1VIC A;  3BTA A; 
#chains in the Genus database with same CATH homology
 1LZI A;  2RJ4 A;  3E25 A;  4HO6 A;  4II0 A;  3ZGG A;  4ARW A;  4CJB A;  1XHB A;  2VLC A;  3CGX A;  4KPX A;  4DEC A;  4QO3 A;  1AVU A;  4MZH A;  5DVH A;  2WEE A;  3TZT A;  3O3Q A;  1GA8 A;  3EF2 A;  4QBC A;  3IOH A;  3BRK X;  3R2W A;  4FCU A;  4G87 A;  3RMW A;  4PC4 A;  2ZU7 A;  3I0C A;  3Q4S A;  2XWL A;  2NS2 A;  1IOB A;  1FGX A;  3A07 A;  2OEG A;  3SXA A;  4EE5 A;  4L4H A;  1QXM A;  3B9U A;  1HV9 A;  3P53 A;  2KI4 A;  4KC3 A;  2Y4J A;  1R81 A;  4G3P A;  1H5S D;  2AGD A;  4NAN A;  6I1B A;  4DDZ A;  4ZOT A;  1WT3 A;  5IDT A;  2D20 A;  1FGG A;  3FJJ A;  2E4M C;  3N7J A;  4OEG A;  1G97 A;  4M4K A;  1ILR 1;  1DLL A;  3JUT A;  1LL2 A;  5J49 A;  2CU2 A;  1YYN A;  3FUO A;  2WE9 A;  4I4P A;  1K5V A;  3I0D A;  5EJ1 A;  2AFG A;  2OI5 A;  2OI6 A;  3BX1 C;  1ISY A;  4NAK A;  1JLX A;  2BFH A;  3N7K A;  2OI7 A;  1M2T B;  4G6M A;  2XOA A;  4DEP A;  4FGF A;  1G8O A;  3FJK A;  4HR6 C;  4KC2 A;  1G23 A;  3WMV A;  1BLD A;  2RJ7 A;  5L6S A;  3FGM A;  4ZFY B;  1FXJ A;  4KQL A;  3SXD A;  1Q03 A;  3BRG C;  1S4N A;  8I1B A;  2ERM A;  3IIR A;  2VSH A;  4LO3 A;  2XWN A;  4JQ0 A;  3OH0 A;  2XWM A;  4KXO A;  4YS8 A;  3BAQ A;  3FJC A;  3DJ4 A;  1G82 A;  2D0J A;  1NZK A;  1GQC A;  1H5S C;  1HWP B;  1JYL A;  2RIT A;  2YES A;  1FXO A;  1R7X A;  4ZKT B;  2ESU A;  1KWS A;  2AH9 A;  3DUV A;  1HM8 A;  4JRA A;  1IRP A;  1P63 A;  4X39 A;  3WIN C;  1XZ6 A;  5EJZ A;  1INJ A;  3F1C A;  1FV3 A;  3SPT A;  3RMY A;  5C49 A;  5BQU C;  1H5S B;  3PNN A;  1LL0 A;  2ZU9 A;  1TWM A;  3H6R A;  1H5T B;  2DPW A;  2RIZ A;  1Z2V A;  3A21 A;  3VSF A;  2F2F C;  3ZC9 A;  3ILA A;  2VS5 A;  4FRH A;  4IRP A;  4J18 A;  4B4B A;  2FGF A;  5FTV A;  2Z86 A;  4J23 B;  5CQN X;  3UD9 A;  3V0B B;  4ASJ A;  1BFF A;  4IZX A;  1ISZ A;  3NBD A;  3O4D A;  1NKH B;  2FYC B;  2MC2 A;  4A7Y A;  3JTJ A;  2RJ1 A;  3I2A A;  4YOL A;  2D43 A;  1ZDG A;  4FIX A;  3AH4 A;  2HZ9 A;  2NZ9 A;  4ECM A;  1ZJ2 A;  4M28 A;  3U2X A;  1QQL A;  3QYD A;  1JT4 A;  3PG0 A;  5C4B A;  2APC A;  1VGZ A;  1IT0 A;  2Q9X A;  2D24 A;  4LO8 B;  3OGG A;  1FN0 A;  5BXT A;  1G9B A;  1FR9 A;  3E8L C;  3AJ5 A;  4LO0 A;  1BAR A;  5BP5 A;  2AM3 A;  5EC5 A;  1PZY B;  5C4F A;  1ZI1 A;  4TLP A;  1ABR B;  21BI A;  3KMV A;  2ICX A;  3ZLK A;  2ET2 A;  5E24 E;  3AH2 A;  2GZB A;  1G9C A;  3NBC A;  1PC8 B;  4I1B A;  2BEB A;  3IM6 A;  1G3L A;  2FYA A;  3HN1 A;  4LO1 A;  1ON8 A;  1Z90 A;  2O1F A;  2P72 A;  3ZLL A;  2Y7A A;  4EVW A;  4OWL A;  4FRD A;  1JY0 A;  3A23 A;  5FNX A;  2W0W A;  4AYL A;  4P0J A;  1YBI A;  1ZCU A;  2X5Z A;  3FJD A;  1TP0 A;  4GP0 A;  2VXR A;  1AXM A;  5F8Y A;  4QC4 A;  3SNV A;  4Y7F A;  1TW5 A;  5DSS B;  4G9M A;  4LO3 C;  3PKP A;  3I0J A;  1H7E A;  2QH5 A;  1YF8 B;  3BAD A;  3FJI A;  3KIA A;  4HOC A;  2ZU8 A;  3VUO A;  2HWA A;  4FIY A;  2L5X A;  1LZ7 A;  1WBC A;  2FDB M;  3P6J A;  3TQD A;  4HO2 A;  3IOI A;  3OJM A;  3VWC A;  4OEE A;  2DS0 A;  1FG5 N;  2W0V A;  3ZF8 A;  3V91 A;  2KI6 B;  1E5K A;  1W3F A;  4I3N A;  5AJN A;  3LLP A;  5C4C A;  1BLA A;  1GQ9 A;  2Y9W C;  4X38 A;  1R8N A;  1YP2 A;  3OJ2 A;  5D63 A;  3O3P A;  3T7N A;  3O4O A;  1FRW A;  5BXP A;  1ZI5 A;  1TIE A;  1TZF A;  3BA5 A;  4I4Q A;  1SR4 A;  4XFT A;  5FNW A;  2Y9F A;  1QQK A;  3BA4 A;  4EFR A;  2Y4M A;  1ZCT A;  1HJL A;  4KEJ A;  2YUG A;  3UD7 A;  1IIM A;  4H04 A;  1CVS A;  4I4V A;  3WA1 A;  4CJM A;  2AAI B;  2KLL A;  2UUS A;  1DJS B;  3SXB A;  3QVB A;  4Y9X A;  1H4E A;  2ICY A;  5B2H A;  2Y9G A;  4IYB A;  2MZB A;  3ZXG A;  4LO0 C;  4XFS A;  4ZGR B;  1H7F A;  1AF9 A;  3T7O A;  2C0N A;  2X2S A;  1H5R B;  1XYF A;  1EPW A;  3MPP G;  1FR8 A;  5JLV A;  2WVK A;  1QGQ A;  2YCM A;  3OH1 A;  4Y7V A;  1MP4 A;  4OUJ A;  4Y6U A;  5D61 A;  5I1F A;  2DRY A;  3AKH A;  4UEG A;  2K8R A;  4KC1 A;  4OW4 A;  3Q7Y A;  3RTI B;  4HO3 A;  3PHZ A;  4LO1 C;  5FZZ A;  1K4V A;  3HL3 A;  1LZJ A;  4FCE A;  1VZT A;  1I1B A;  31BI A;  1S4P A;  3AH1 A;  1G2V A;  1V84 A;  3RSB A;  4B2X A;  5C3D A;  2XMH A;  5FV9 A;  3RMX A;  4J2S A;  5CMI A;  3I0E A;  2V0K A;  3I0F A;  4EEO A;  3A22 A;  1OQL B;  3N7L A;  2JCK A;  4ZDQ A;  1H4C A;  3VT2 A;  2AXM A;  2E8B A;  3PKQ A;  3T7M A;  3DK5 A;  5F8W A;  1HM0 A;  1V6U A;  4F34 A;  4Q9P A;  3ZC8 A;  1ZIZ A;  1F31 A;  5CMJ A;  5IFY A;  2MIB A;  3HBW A;  4D8H A;  1H3M A;  1A8D A;  1BFC A;  1II4 A;  4KRV A;  5GAQ A;  1E0O A;  4XKI A;  1EYL A;  4QBV A;  4QKR A;  1G1L A;  1VPA A;  3OH3 A;  3U2T A;  1MD6 A;  1I52 A;  3GUE A;  1Z0H A;  3K8D A;  4D11 A;  3AKI A;  1FWY A;  1PZT A;  2P73 A;  3NGW A;  3CRG A;  4EFP A;  1QWJ A;  4M2A A;  4MZG B;  1G9A A;  1G95 A;  4I2S A;  2NXV A;  2PA4 A;  3Q80 A;  5CMG X;  3D7W B;  5DZU A;  2D7R A;  1V6V A;  5BXR A;  1FMM S;  3CA3 A;  1HWM B;  1GWV A;  3O4B A;  1SZ6 B;  2VU9 A;  1SR4 C;  1GWW A;  1K5U A;  3H6S E;  4OWJ A;  1ZJ3 A;  2IWT B;  4B4G A;  4ZFW B;  1AVX B;  4NAL A;  2NVH A;  5FZY A;  4END A;  4G6J A;  1JT7 A;  3CKJ A;  4J2Y A;  1ON6 A;  1NMM B;  5C3A A;  3OBT A;  2K43 A;  2GO2 A;  4P00 A;  3V0P A;  4H75 A;  3WO4 A;  1ISW A;  3U0X A;  4CJC A;  4NAI A;  4D48 A;  1RG8 A;  2FFU A;  3VEQ A;  1D0H A;  4P0L A;  1WVC A;  3CA6 A;  3OH4 A;  4JKQ A;  1T9F A;  3VT1 A;  1PUU B;  1PZZ A;  1VZX A;  3JRR A;  1S0B A;  2IHO A;  4GAF A;  4E1K A;  2D23 A;  1LZ0 A;  1VGU A;  3I29 B;  3FJE A;  4QAL A;  2RST A;  1OQM B;  4Y64 A;  5C47 A;  3OJV A;  4IQP A;  1H7H A;  3V0N A;  4H9W A;  4Z8S B;  1EYR A;  4HO4 A;  2LIE A;  4O6M A;  5C38 A;  1R7Y A;  4EFQ A;  1NF5 B;  3N9W A;  4LW6 A;  1RY7 A;  3P6I A;  4QD2 C;  5CQM X;  1FWV A;  4I4Y A;  3VSZ A;  3FJH A;  4LW3 A;  4KPZ A;  5AJP A;  4EE4 A;  5C8R A;  3RTJ B;  5F8S A;  4B4M A;  4EE3 A;  1R7V A;  3HSM A;  5DDT A;  2FFV A;  2VXT I;  1UPS A;  3TC2 A;  2WGZ A;  4AC3 A;  1MC3 A;  5D91 A;  1KNM A;  4FRO A;  2K4A B;  2OEF A;  1ZJO A;  2RJ5 A;  3AKF A;  4ZLB B;  1S0L A;  3N0K A;  1FO9 A;  1RZO B;  1H7L A;  2NP0 A;  2J0A A;  2QGI A;  1ZJ1 A;  1GGP B;  2YQJ A;  1J0S A;  3OKR A;  2J3P A;  3LW6 A;  3N7M A;  3AZV A;  1DQO A;  1V6X A;  2AM4 A;  3O5W B;  3BCV A;  1DZC A;  3I0I X;  4USO A;  3BB2 A;  3W9T A;  2YC3 A;  1HCE A;  4FRB A;  3JUK A;  2I1B A;  4I6I A;  4R6U B;  1FZW A;  2E3D A;  1EVT A;  1QG8 A;  1HKN A;  2MLL B;  2LIQ A;  3CKN A;  2WVL A;  5CQP A;  2VS3 A;  3SX8 A;  3FOQ A;  4JKX B;  2ZQN A;  4EEE B;  1H7Q A;  4Y6N A;  1DFQ A;  3I0H A;  1DQG A;  2VXL A;  5C1G A;  1BA7 A;  3V0O A;  4BMA A;  1PWA A;  3CAH A;  4I4O A;  4D0T A;  2X5S A;  5FUH A;  3U2V A;  4B3U A;  5BVP I;  4EKX B;  3ZX7 A;  3V0L A;  4Q91 A;  1H4D A;  2E4M A;  1W3A A;  1V82 A;  1WT0 A;  3V0A A;  1ZHJ A;  1FOA A;  4X37 A;  4WBC A;  2RJ8 A;  2UX8 A;  4Y63 A;  3SXC A;  2NM1 A;  4Q7C A;  4EB2 B;  2KKI A;  4X3A A;  2QKX A;  3R4U A;  5CMH A;  2HWM A;  1HJJ A;  3I0G A;  3H6R B;  2X65 A;  4B42 A;  4KNX A;  1HIB A;  4CJ8 A;  5FZU A;  1JV1 A;  3VT0 A;  2RJ6 A;  1CE7 B;  4XWI A;  4MND A;  4L4I A;  3EE5 A;  2WAW A;  4FRA A;  4GBP A;  2X2T A;  1W57 A;  2JCL A;  4FRP A;  2J0B A;  5I1B A;  2YQS A;  1AVW B;  3U2U A;  3K1X A;  3V0Q A;  5FTS A;  5BXC A;  2AE7 A;  3F62 B;  3OGF A;  2JCJ A;  2KH2 A;  2BO6 A;  2V0L A;  3ZXD A;  1YP4 A;  4FRM A;  5C1L A;  4JIS A;  2BEA A;  3FJA A;  3CRH A;  3FUQ A;  1H5T A;  4I4R A;  4ZA3 B;  4FVV A;  1MP5 A;  5BP5 C;  3BRF A;  4Y7T A;  5C48 A;  4C2S A;  3O49 A;  4I0Y A;  3H6Q A;  3CU0 A;  1ZDF A;  4IRQ A;  3WMU A;  4KBB A;  4LO2 A;  1HWN B;  5BOW A;  1WSZ A;  3U0Y A;  1FQ9 A;  1YTO A;  2ZR1 B;  2RG9 B;  4USP A;  4Z9W B;  3V0B A;  1TVY A;  4FRE A;  5CQL X;  4I96 A;  2VXM A;  3D5N A;  2D7I A;  1G9R A;  1S4O A;  1VZU A;  4KNR A;  2QYI B;  1WD4 A;  3BA7 A;  2YC5 A;  4HO9 A;  4ASY A;  4Y7U A;  3D8V A;  1GX4 A;  3R4S A;  1SS9 A;  3FFZ A;  4K6R A;  3CKQ A;  1O7O A;  1BAS A;  9ILB A;  1WT2 A;  2PGY A;  2FYB A;  1IIL A;  1NQI B;  2D1Z A;  2VSA A;  4XFU A;  1S0G A;  2R9K B;  2Z87 A;  3IOJ A;  3F1R A;  3JUJ A;  5C36 A;  4ZFU B;  1YXW A;  2BO8 A;  4GOY A;  3U2W A;  2BO4 A;  3SX5 A;  4EEG A;  2VUA A;  1YP3 A;  2RIY A;  2PX7 A;  3SX7 A;  3NBN A;  1PUM B;  1IIN A;  1JT3 A;  3PUB A;  1ZI3 A;  1FGA A;  3AZW A;  1V6W A;  4GOV A;  1MP3 A;  4EEA A;  1MC9 A;  1N4K A;  1R7U A;  5JMC A;  4FQW A;  2DRZ A;  4ION A;  3V79 C;  4I7I A;  3OH2 A;  1Q1U A;  3D98 A;  5AJO A;  5FU0 A;  3HOM A;  4HA2 A;  1TTU A;  5CMF X;  1R7T A;  3R3I A;  5HPZ A;  3SXG A;  1VH1 A;  1ONK B;  1OMZ A;  2P39 A;  1JLY A;  4I37 A;  1O7Q A;  4GP3 A;  4A7Z A;  3V0A B;  3K8E A;  2A8W A;  1NWG B;  2AEC A;  2V0J A;  3UJ4 A;  2VFZ A;  3T8S A;  1OMX A;  1O0R A;  5CQO A;  3FJ9 A;  4I8M A;  1HM9 A;  2D22 A;  3BAG A;  4I4X A;  4ZBV B;  1JTC A;  4HJJ A;  3RSJ A;  1ZJP A;  2YQC A;  4HCQ A;  3O4C A;  4I4U A;  4Q9G A;  3V8Y A;  4Y62 A;  2F8X C;  3V0M A;  1WT1 A;  1QGS A;  3CA0 A;  4A7K A;  1H7T A;  2NTD A;  1VGW A;  3UJ0 A;  2VSI A;  4JAW A;  1BFG A;  1TW1 A;  4J2K A;  4G1R A;  4O6N A;  5JQQ A;  4HO5 A;  4AYJ A;  2Y9X E;  4LO2 C;  5D92 A;  3RMV A;  5DUY A;  2D44 A;  3BAO A;  3QR5 A;  3O44 A;  4ISR A;  4JP0 A;  3E26 A;  2VS4 A;  3FWW A;  4CVH A;  4B5B A;  1L2H A;  3Q7W A;  4I1E A;  4JPZ A;  2I7B A;  4IY8 A;  2QN4 A;  2Y6P A;  2ZQO A;  3BAV A;  4UY4 A;  1W55 A;  3OC9 A;  41BI A;  1V83 A;  1BFB A;  5D62 A;  1JV3 A;  3ZGF A;  1T4Q A;  1Q04 A;  3CA4 A;  3V8Z A;  1IRA X;  1FV2 A;  4MYB A;  2VD4 A;  7I1B A;  2HW9 A;  3OBR A;  4QD2 B;  2I5E A;  3BAU A;  5F90 A;  2WRY A;  2XME A;  4OEF A;  1O23 B;  3ST8 A;  4AAW A;  1JVD A;  3CQA A;  1ISX A;  2RJ0 A;  5IDS A;  2NYY A;  2YQH A;  1HWO B;  2PGV A;  4IY9 A;  1GX0 A;  5G00 A;  1WBA A;  2WBC A;  4IHZ A;  3S8K A;  3UDA A;  4LO7 C;  3UD8 A;  1FO8 A;  1H5R A;  2A8U A;  3Q7U A;  3OGZ A;  1LVW A;  4GAI A;  2M49 A;  1FMZ A;  1AVA C;  1H7G A;  1VM8 A;  2Q4J A;  3CKV A;  4I4S A;  3F1Y A;  3I0K A;  1G9D A;  2JCO A;  4J2X A;  2P6W A;  2BO7 A;  4JD0 A;  1JYK A;  3HAL A;  4HO8 A;  2AES A;  1R8O A;  2AM5 A;  4LO7 B;  1W3G A;  3IM7 A;  1DFC A;  1S0D A;  3V90 A;  4D11 C;  1ZCY A;  2Y4K A;  5C4E A;  1IHK A;  3NJ5 A;  2WVM A;  3FJ8 A;  5FU8 A;  1R82 A;  3FJF A;  4L41 C;  4R7P A;  4HO0 A;  4QKS A;  4HG6 A;  3POL A;  5HS2 A;  2VK9 A;  3O4A A;  2O1G A;  5C3B A;  3CU1 B;  2Z49 A;  2GGQ A;  4MIX A;  1S0C A;  5C4D A;  3BAH A;  4KC4 A;  4KEI A;  3I2X A;  3NBE A;  1IJT A;  4KEK A;  1JQZ A;  4F83 A;  1EZI A;  4Y7G A;  4AN7 B;  3FJB A;  3SX3 A;  4FRL A;  4DEN A;  4ISQ A;  1TWE A;  1G0R A;  1EV2 A;  3USR A;  4DCK C;  4DE7 A;  4D0Z A;  3CKO A;  5BXS A;  1WD3 A;  3BRD A;  3POK A;  1DZD A;  2V0I A;  2V0H A;  1VCL A;  5L6V A;  3WO2 A;  2Y4L A;  3I0L A;  1INI A;  1JVG A;  1DIW A;  1AFC A;  1XZZ A;  4EEM A;  1NHE B;  1S0E A;  3PME A;  3WO3 A;  3CRI A;  3OAM A;  4G3Q A;  5FYE A;  1R80 A;  3AJ6 A;  2Z48 A;  2Q3N B;  5EHA A;  3Q7X A;  3S8J A;  2O1H A;  4B2W A;  5C1H A;  2RJ9 A;  4G9N A;  1JT5 A;  4P0K A;  4P6A A;  4AN6 A;  2X60 A;  1TFM B;  1I1E A;  1RML A;  1LL3 A;  5EIY A;  1FWU A;  1ISV A;  1H5S A;  4MZF B;  3IAG C;  1HCD A;  4IZE A;  3HMY A;  2RIX A;  3WIN A;  1M16 A;  2FYD B;  5BQU A;  1Z4S A;  2VSE A;  3CA5 A;  3LTQ A;  1W77 A;  4P02 A;  1S0F A;  2AQZ A;  2FO1 A;  1VGT A;  1ITB A;  2FY7 A;  2P23 A;  2RQ9 A;  1G93 A;  2F2F A;  2I5K A;  1NUN A;  3CA1 A;  3IM5 A;  1TOO A;  2GGO A;  4G3S A;  3C9Z A;  3SXE A;  1XG6 A;  1ZCV A;  3MAL A;  3AKG A;  5DDV A;  3USQ A;  4KT7 A;  2DRE A;  4FRQ A;  5EG6 C;  1ZI4 A;  4BQH A;  1ZJ0 A;  4M2B A;  1VH3 A;  4OWK A;  1YRO B;  1VIC A;  3BTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...