2D7RA

Crystal structure of pp-galnac-t10 complexed with galnac-ser on lectin domain
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
536
structure length
536
Chain Sequence
b'GQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 10
publication title Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 155
structure length 536
sequence length 536
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2d7rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2d7rA01
3FJ9A 4I4SA 4EKXB 4HO8A 4E1KA 4J2SA 1FRWA 3SXCA 4GP3A 3POLA 3FJKA 3SNVA 4B3UA 4I4VA 5CMHA 3FFZA 3IM5A 1FWVA 1PWAA 3F1RA 1AVAC 4H04A 2WVLA 2X60A 4HO3A 4B4MA 1BFFA 3IOIA 3JRRA 1FGXA 1TP0A 2RITA 2AQZA 3BAHA 3USQA 4IRQA 1TWEA 2RQ9A 5C1GA 3RSJA 1QWJA 7I1BA 3I0CA 2X2SA 4PC4A 1K5VA 2XOAA 4II0A 2KI4A 5EG6C 3CKNA 3SPTA 2W0VA 2QGIA 2YQJA 3F1YA 3U0YA 1H7HA 3O4AA 3FJFA 3KIAA 1S0LA 2D20A 2I1BA 4Y7GA 2Y4JA 1V6UA 4HA2A 5FNWA 1JLYA 2Q9XA 1LZ0A 1QXMA 2XWLA 1OQLB 4HO4A 4EFQA 3K8DA 4B42A 1WT0A 1BA7A 2VUAA 4LO8B 6I1BA 1AVUA 1JY0A 3P6IA 4ECMA 1YF8B 2YC5A 2OI6A 4G3SA 1HWNB 5CQLX 3ZGFA 4ZDQA 1O0RA 2ICYA 2E8BA 3VSZA 2HZ9A 1H7LA 2FYBA 3VT1A 2VXLA 2RJ8A 5BXCA 1Q03A 1QG8A 2YQSA 4ZLBB 1S4NA 1V6WA 1FWUA 2RJ9A 4J18A 5EJ1A 1HCEA 4KEIA 1II4A 3UJ0A 5IFYA 3FJHA 3ZF8A 1G82A 3V79C 1V84A 1CE7B 3OH0A 4GP0A 1FZWA 1VH3A 1RMLA 3WINA 2F8XC 2X5ZA 4Q9PA 4ZFUB 3UJ4A 1LZJA 2MLLB 1WVCA 4WBCA 4JRAA 5BQUA 3AKFA 3E25A 4P0LA 5FNXA 3OGZA 1GQCA 2MIBA 2WAWA 1G95A 2JCLA 1HM9A 1HV9A 3CKQA 4I4QA 2D24A 3WINC 4KC4A 3CQAA 4KC3A 1ZI3A 1LL3A 5BQUC 5FTSA 1NUNA 1FO8A 1AF9A 5C1HA 4LO3A 1FQ9A 4A7ZA 3BCVA 1WBCA 3IM7A 3NGWA 3Q7WA 1IRPA 3PG0A 4F83A 3Q7UA 2D43A 3EF2A 5C1LA 1SR4A 2DRZA 4ENDA 4HCQA 3U0XA 4GBPA 4LO3C 4X38A 4XFTA 3WMUA 2PA4A 2V0KA 2XWNA 3ZLLA 4QKRA 4Y64A 3UDAA 2W0WA 2RJ1A 2X65A 2PGVA 1ZJ1A 1SR4C 2KKIA 2VSIA 4M2AA 1OQMB 1CVSA 3V8ZA 1SZ6B 1ISWA 5FYEA 3DJ4A 1G3LA 3N7LA 1V83A 4EEOA 2VS4A 3I29B 1IILA 4FRDA 3JUJA 3U2WA 1R7TA 3AKHA 2AM4A 3QR5A 3V0PA 4ASJA 3O49A 4KNXA 1INIA 3ZGGA 41BIA 4P02A 1JVGA 2I7BA 4KQLA 4Z9WB 1DQOA 4C2SA 1IIMA 4I0YA 1XZZA 1H3MA 3DUVA 4HOCA 4P0JA 5C4CA 5C49A 3O4DA 4JQ0A 4OUJA 2DS0A 1H5SA 2JCJA 2LIQA 2CU2A 2O1GA 3WO4A 3EE5A 3POKA 3I0HA 1V6XA 2MZBA 4BQHA 3BA4A 3SXGA 3AH2A 3OH2A 1SS9A 1EV2A 2MC2A 5DDVA 5FTVA 1H5SC 2D44A 2Z87A 3TC2A 4Q9GA 1G2VA 3V90A 1R80A 3D98A 4QALA 1S0DA 4FRQA 3K1XA 4FRPA 1VGZA 3OGGA 3OJVA 4HJJA 2VXTI 1FR9A 2M49A 4G6JA 1ZCUA 4OWKA 4GOVA 3ILAA 3Q80A 2ZU9A 4CVHA 5CQPA 1W77A 1DLLA 3CKJA 3AKIA 2FYAA 3SX7A 2AFGA 4CJ8A 5L6SA 1I1BA 3O3QA 1R7XA 3A22A 4NALA 3U2TA 1S0CA 1ZI5A 2FFVA 1ZI1A 4FROA 3N0KA 1DZCA 1IRAX 2HW9A 5D61A 2FYCB 1D0HA 5C3BA 1JTCA 1S0FA 3RTIB 1PUMB 3V0OA 1MP3A 5DUYA 2UX8A 2VSAA 3OH1A 3NBCA 4NAKA 3UD9A 1JVDA 4IY8A 1NMMB 5FUHA 1ZCTA 1GWWA 1T4QA 3O4OA 3USRA 4OWJA 1EVTA 1E0OA 4L4HA 3FUQA 1DFCA 1YP4A 1ZJ3A 4X3AA 3JUKA 1PZZA 4ZGRB 5GAQA 5EHAA 5CQMX 4IRPA 2AGDA 2WVKA 3CRIA 3WA1A 3VT2A 1R8NA 4D0ZA 2R9KB 1BLDA 4G6MA 1HJJA 4AN7B 3I0JA 4QBCA 1IINA 4CJMA 1FG5N 2Y9FA 1LL2A 5C38A 1I1EA 4KC1A 1R7UA 1O23B 4EVWA 1YXWA 2Y4LA 4JISA 4EB2B 3S8JA 1ON8A 4Y7FA 1VCLA 4I37A 4XKIA 3S8KA 1GWVA 2V0HA 2AM3A 4JD0A 4P0KA 2DREA 1WBAA 4AYLA 1VGWA 2Y6PA 5C8RA 3E8LC 4OEEA 1FMMS 3BAVA 4HO9A 3BA5A 4L4IA 1H5SD 2VFZA 1V82A 2IWTB 4ZBVB 4MNDA 2LIEA 2O1HA 3T7OA 5BOWA 3CA5A 4FRLA 4HO6A 1VM8A 4AYJA 4I8MA 4LO0A 1FR8A 2WVMA 5FU0A 1RY7A 2NTDA 2OEGA 4A7KA 2QKXA 1Z0HA 3SXEA 4ASYA 1TOOA 1DQGA 2D7RA 3H6RA 3HOMA 1FN0A 3RMXA 1NQIB 1W57A 3LLPA 2RJ7A 2YQCA 5FU8A 1S4PA 1ABRB 21BIA 4LO0C 2FY7A 4GOYA 4AN6A 5C48A 1Q04A 1FWYA 4FRAA 1O7OA 1DFQA 3H6RB 31BIA 1R8OA 2K43A 4ZA3B 3T8SA 5FZUA 3ZC9A 1MP5A 4KEKA 2O1FA 3BTAA 3I0FA 1YP3A 3F1CA 4CJBA 1HWMB 3O3PA 3V91A 2AECA 1YROB 1M2TB 2AH9A 2DPWA 2YC3A 3BX1C 2UUSA 1BFGA 2D0JA 4A7YA 1T9FA 1JYLA 1ZCYA 4B4BA 5L6VA 1JT7A 4OEFA 2P39A 1A8DA 4Z8SB 1H5TA 1ZCVA 2Y7AA 4DDZA 4KEJA 4HO2A 1HM0A 5DDTA 3N9WA 3JTJA 4EEMA 2RJ5A 4B4GA 4LO7B 1H5TB 4B2XA 4LO7C 4JKQA 1NZKA 1TW1A 3CU0A 4GAFA 4I4YA 3O5WB 2ERMA 4J2YA 1G23A 4ARWA 4ZFYB 2P23A 3CAHA 2X5SA 2NYYA 5D62A 1ZJ2A 2Q4JA 3PKQA 3N7KA 1VZXA 4UEGA 2VD4A 2RJ4A 3OAMA 5F8SA 5C3AA 4EEAA 1FO9A 4I4RA 3IM6A 1VGTA 2F2FA 1PZTA 3RMYA 4LO2A 1P63A 4K6RA 2VXMA 1ISXA 4YOLA 2BO7A 4P00A 3FJCA 1XZ6A 1XHBA 1W55A 2PGYA 1G9CA 1W3FA 4G87A 4NAIA 2K4AB 4ZFWB 1GGPB 2F2FC 3V0NA 1H7EA 3HALA 4LO2C 2Y9GA 1AVXB 2VXRA 4IY9A 4DECA 4LW6A 4JPZA 1YYNA 1H7FA 2QYIB 2Y9XE 3U2XA 1TIEA 1AFCA 3R2WA 5AJNA 3CKVA 1G9DA 2NXVA 1S0EA 1HCDA 3AZVA 4R7PA 4FRMA 2NZ9A 3A23A 3V0LA 3PUBA 4OEGA 3OH4A 4FREA 3FJJA 1FV2A 2KH2A 1JV1A 5F8WA 3I0LA 1JT4A 4AAWA 4M4KA 4Y6NA 2A8WA 3H6QA 1G93A 1OMXA 3B9UA 3JUTA 1NKHB 1G9RA 5B2HA 3O44A 3SX8A 1S0GA 3NJ5A 2Z86A 4XFUA 3CKOA 9ILBA 3SXBA 2FDBM 4B5BA 2NM1A 1W3GA 3WO2A 2BFHA 5EJZA 4Q91A 2Z49A 3AH1A 2WBCA 4IZXA 2ET2A 3AJ5A 2HWAA 4OWLA 4OW4A 4DCKC 4KXOA 4KRVA 1N4KA 1PC8B 1RG8A 1EPWA 1MP4A 2V0LA 3CA4A 4G9NA 1S4OA 2V0IA 2YQHA 4J2KA 3FOQA 4HO5A 1QGQA 1YTOA 2XMHA 3OJ2A 1G1LA 3TQDA 2FGFA 3HSMA 5C4FA 3RSBA 4CJCA 2IHOA 4D8HA 1W3AA 2ZU7A 2YESA 4Y7VA 2Y4KA 4P6AA 2I5EA 2OEFA 4KPXA 1FV3A 3HBWA 3LTQA 1TVYA 5CQNX 5CQOA 2VSHA 3H6SE 1BARA 2NP0A 2XWMA 2RJ0A 1ZDFA 2ZU8A 4KPZA 1ITBA 4IHZA 5EIYA 3MALA 3QYDA 4G9MA 1H4DA 1RZOB 1QGSA 2AESA 1MC3A 4L41C 1IJTA 1F31A 4LO1A 4AC3A 5E24E 5C3DA 2AE7A 2ZQOA 2BO8A 1TW5A 1BFBA 4EFPA 4JAWA 4I1EA 4B2WA 2KLLA 2Q3NB 4ISRA 3PMEA 3BAUA 3A07A 3BA7A 2PX7A 4BMAA 4LO1C 3WO3A 5BXSA 4KC2A 1ISYA 1JYKA 2P6WA 4Y6UA 3TZTA 4D0TA 3U2VA 2FFUA 1G8OA 4EE4A 4EEGA 1ISZA 5G00A 1PZYB 1HIBA 3T7MA 2E4MA 4ZKTB 1FGAA 2ZQNA 1R81A 2HWMA 3PNNA 1HWOB 5D63A 1Z4SA 3OGFA 1DJSB 2J3PA 4IQPA 1IOBA 4J23B 5BXTA 2RIXA 3V8YA 2ESUA 3E26A 1NHEB 1VGUA 1INJA 1ILR1 3VT0A 4EEEB 1G0RA 5DSSB 1NWGB 2RSTA 8I1BA 5JMCA 1FMZA 3K8EA 1K5UA 1BASA 1Z90A 3N7MA 1J0SA 3N7JA 3FJAA 1ZDGA 1MD6A 2JCKA 2BEAA 4IONA 1WT1A 3BAGA 5DVHA 1M16A 3VUOA 4JP0A 1LVWA 1L2HA 2D22A 3DK5A 5BP5A 5BVPI 3RMVA 5EC5A 1WD3A 5BXRA 1VZUA 1VH1A 2RIYA 3ST8A 3NBNA 3BAQA 4YS8A 3OKRA 4NANA 5C4BA 1JT3A 1H5RA 2YCMA 3CA6A 3PKPA 3OBRA 5BP5C 4Y7TA 2WE9A 1R7VA 3CA0A 4LW3A 3FJIA 3SX5A 1H7GA 2V0JA 3GUEA 4Y62A 4DEPA 1H5RB 2E3DA 3ZX7A 3AH4A 1WT2A 2RJ6A 4JKXB 5HPZA 2P72A 3HMYA 3D7WB 1YBIA 2WEEA 3U2UA 4EFRA 1ISVA 3O4BA 3D5NA 3I0DA 1BLAA 4KT7A 3KMVA 5C4EA 3VSFA 1AXMA 4QC4A 3OC9A 2K8RA 3AKGA 3R4SA 3I0EA 1E5KA 1Z2VA 3V0BA 4G1RA 1ZHJA 3FJEA 1JQZA 1FOAA 3FGMA 3BRFA 4XWIA 3VEQA 4R6UB 1EZIA 1BFCA 3D8VA 3I2AA 1NF5B 1VZTA 3HL3A 3CRGA 3ZC8A 3V0BB 3CA1A 3R3IA 1R7YA 4FGFA 3R4UA 2X2TA 2WGZA 5CMFX 3P53A 3AJ6A 2D7IA 3FJ8A 1ZJ0A 4I4PA 1ON6A 5IDTA 3FJDA 2KI6B 1FXOA 4GAIA 4I6IA 3OH3A 4IZEA 1JV3A 1TFMB 1HKNA 1FGGA 1JLXA 5I1BA 2BEBA 1IHKA 4X39A 1LL0A 4QD2B 2VS5A 4M28A 4Y7UA 5F90A 1V6VA 1GX0A 4QD2C 3VWCA 3UD8A 3CGXA 5F8YA 1WT3A 1JT5A 3SX3A 1YP2A 2D1ZA 4KBBA 3IOHA 3I0KA 3BRKX 4TLPA 3HN1A 4EE5A 3W9TA 3RTJB 2AAIB 2FO1A 1PUUB 2VSEA 1H4CA 3I0GA 5FV9A 3NBDA 2VS3A 1LZ7A 4USPA 4HO0A 5I1FA 3CRHA 3FWWA 4FCEA 3NBEA 1LZIA 3IOJA 3C9ZA 4QBVA 1GX4A 5J49A 4I2SA 3IIRA 1TWMA 3ZLKA 3PHZA 3Q7XA 3UD7A 2GGQA 3SXAA 4USOA 2A8UA 2Y4MA 1ZJOA 4I4XA 1GQ9A 2XMEA 1AVWB 2QH5A 2L5XA 3A21A 3BRGC 2YUGA 1GA8A 4M2BA 3I0IX 2QN4A 1EYLA 5C4DA 2RG9B 2OI7A 4I1BA 2GZBA 1QQKA 1TZFA 3IAGC 1FXJA 2WRYA 1UPSA 1G97A 4KNRA 1IT0A 2I5KA 1WSZA 5DZUA 4I4OA 4XFSA 3ZXGA 1O7QA 3LW6A 1I52A 1TTUA 1HWPB 4I4UA 3WMVA 4IYBA 4G3PA 2BO4A 5IDSA 4QO3A 3Q7YA 2GGOA 4ZOTA 3SXDA 1H5SB 3MPPG 2P73A 1DIWA 3QVBA 2ZR1B 1ZJPA 1OMZA 3BB2A 2Y9WC 4HR6C 4Y63A 5CMGX 1H7TA 2APCA 3V0MA 3BRDA 5HS2A 1ZI4A 2BO6A 1WD4A 1G9AA 2D23A 2ICXA 1XYFA 3V0AA 4FRBA 5CMIA 5AJPA 4G3QA 1K4VA 3ZXDA 3OJMA 1EYRA 4I7IA 4EE3A 1VICA 4D11A 1H4EA 1KNMA 4FRHA 2DRYA 3V0AB 1MC9A 3CU1B 3Q4SA 1ONKB 3CA3A 1R82A 5C47A 2JCOA 5JQQA 3I2XA 5BXPA 2OI5A 3OBTA 4D11C 1G9BA 4D48A 4H9WA 2VU9A 3BAOA 1KWSA 2Z48A 4FCUA 1HJLA 4ISQA 3FJBA 1DZDA 5FZZA 1VPAA 3RMWA 1S0BA 1HM8A 3O4CA 2AXMA 5FZYA 4Y9XA 3V0QA 3AZWA 5CMJA 2VLCA 4FQWA 5AJOA 4DE7A 4DENA 1XG6A 3FUOA 2NVHA 3BADA 4F34A 1ZIZA 2AM5A 2RIZA 2FYDB 5C36A 4HG6A 4MYBA 2E4MC 4J2XA 1QQLA 4FVVA 4I96A 3P6JA 2GO2A 5JLVA 1Q1UA 3F62B 4QKSA 4I3NA 3T7NA 1H7QA 4X37A
chains in the Genus database with same CATH superfamily
3FJ9A 4I4SA 4EKXB 4HO8A 4E1KA 4J2SA 4MZFB 1FRWA 3SXCA 4GP3A 3POLA 3FJKA 3SNVA 4B3UA 4I4VA 5CMHA 3FFZA 3IM5A 1FWVA 1PWAA 3F1RA 1AVAC 4H04A 2WVLA 2X60A 4HO3A 4B4MA 1BFFA 3IOIA 3JRRA 1FGXA 1TP0A 2RITA 2AQZA 3BAHA 3USQA 4IRQA 1TWEA 2RQ9A 5C1GA 3RSJA 1QWJA 7I1BA 3I0CA 2X2SA 4PC4A 1K5VA 2XOAA 4II0A 2KI4A 5EG6C 3CKNA 3SPTA 2W0VA 2QGIA 2YQJA 3F1YA 3U0YA 1H7HA 3O4AA 3FJFA 3KIAA 1S0LA 2D20A 2I1BA 4Y7GA 2Y4JA 1V6UA 4HA2A 5FNWA 1JLYA 2Q9XA 1LZ0A 1QXMA 2XWLA 1OQLB 4HO4A 4EFQA 3K8DA 4B42A 1WT0A 1BA7A 2VUAA 4LO8B 6I1BA 1AVUA 1JY0A 3P6IA 4ECMA 1YF8B 2YC5A 2OI6A 4G3SA 1HWNB 5CQLX 3ZGFA 4ZDQA 1O0RA 4H75A 2E8BA 3VSZA 2HZ9A 2ICYA 1H7LA 2FYBA 3VT1A 2VXLA 2RJ8A 5BXCA 1Q03A 1QG8A 2YQSA 4ZLBB 1S4NA 1V6WA 1FWUA 2RJ9A 4J18A 5EJ1A 1HCEA 4KEIA 1II4A 4FIYA 3UJ0A 5IFYA 3FJHA 3ZF8A 1G82A 3V79C 1V84A 1CE7B 3OH0A 4GP0A 1FZWA 1VH3A 1RMLA 3WINA 2F8XC 2X5ZA 4Q9PA 4ZFUB 3UJ4A 1LZJA 2MLLB 1WVCA 4WBCA 4JRAA 5BQUA 3AKFA 3E25A 4P0LA 5FNXA 3OGZA 1GQCA 2MIBA 2WAWA 1G95A 2JCLA 1HM9A 4MZGB 1HV9A 3CKQA 4I4QA 2D24A 3WINC 4KC4A 3CQAA 4KC3A 1ZI3A 1LL3A 5BQUC 5FTSA 4O6NA 1NUNA 1FO8A 1AF9A 5C1HA 4LO3A 1FQ9A 4A7ZA 3BCVA 1WBCA 3IM7A 3NGWA 3Q7WA 1IRPA 3PG0A 4F83A 3Q7UA 2D43A 3EF2A 5C1LA 1SR4A 2DRZA 4ENDA 4HCQA 3U0XA 4GBPA 4LO3C 4X38A 4XFTA 3WMUA 2PA4A 2V0KA 2XWNA 3ZLLA 4QKRA 4Y64A 3UDAA 2W0WA 2RJ1A 2X65A 2PGVA 1ZJ1A 1SR4C 2KKIA 2VSIA 4M2AA 1OQMB 1CVSA 2C0NA 3V8ZA 1SZ6B 1ISWA 5FYEA 3DJ4A 1G3LA 3N7LA 1V83A 4EEOA 2VS4A 3I29B 1IILA 4FRDA 3JUJA 3U2WA 1R7TA 3AKHA 2AM4A 3QR5A 3V0PA 4ASJA 3O49A 4KNXA 1INIA 3ZGGA 41BIA 4P02A 1JVGA 2I7BA 4KQLA 4Z9WB 1DQOA 4C2SA 1IIMA 4I0YA 1XZZA 1H3MA 3DUVA 4HOCA 4P0JA 5C4CA 5C49A 3O4DA 4JQ0A 4OUJA 2DS0A 1H5SA 2JCJA 2LIQA 2CU2A 2O1GA 3WO4A 3EE5A 3POKA 3I0HA 1V6XA 2MZBA 4BQHA 3BA4A 3SXGA 3AH2A 3OH2A 4O6MA 1SS9A 1EV2A 2MC2A 5DDVA 5FTVA 1H5SC 2D44A 2Z87A 3TC2A 4Q9GA 1G2VA 3V90A 1R80A 3D98A 4QALA 1S0DA 4FRQA 3K1XA 4FRPA 1VGZA 3OGGA 3OJVA 4HJJA 2VXTI 1FR9A 2M49A 4G6JA 1ZCUA 4OWKA 4GOVA 3ILAA 3Q80A 2ZU9A 4FIXA 4CVHA 5CQPA 1W77A 1DLLA 3CKJA 3AKIA 2FYAA 3SX7A 2AFGA 4CJ8A 5L6SA 1I1BA 3O3QA 1R7XA 3A22A 4NALA 3U2TA 1S0CA 1ZI5A 2FFVA 1ZI1A 4FROA 3N0KA 1DZCA 1IRAX 2HW9A 5D61A 2FYCB 1D0HA 5C3BA 1JTCA 1S0FA 3RTIB 1PUMB 3V0OA 1MP3A 5DUYA 2UX8A 2VSAA 3OH1A 3NBCA 4NAKA 3UD9A 1JVDA 4IY8A 1NMMB 2J0BA 1ZCTA 5FUHA 1GWWA 1T4QA 3O4OA 3USRA 4OWJA 1EVTA 1E0OA 4L4HA 3FUQA 1DFCA 1YP4A 1ZJ3A 4X3AA 3JUKA 1PZZA 4ZGRB 5GAQA 5EHAA 5CQMX 4IRPA 2AGDA 2WVKA 3CRIA 3WA1A 3VT2A 1R8NA 4D0ZA 2R9KB 1BLDA 4G6MA 1HJJA 4AN7B 3I0JA 4QBCA 1IINA 4CJMA 1FG5N 2Y9FA 1LL2A 5C38A 1I1EA 4KC1A 1R7UA 1O23B 4EVWA 1YXWA 2Y4LA 4JISA 4EB2B 3S8JA 1ON8A 4Y7FA 1VCLA 4I37A 4XKIA 3S8KA 1GWVA 2V0HA 4MIXA 2AM3A 4MZHA 4P0KA 2DREA 1WBAA 4JD0A 4AYLA 1VGWA 2Y6PA 5C8RA 3E8LC 4OEEA 1FMMS 3BAVA 4HO9A 3BA5A 4L4IA 1H5SD 2VFZA 1V82A 2IWTB 4ZBVB 4MNDA 2LIEA 2O1HA 3T7OA 5BOWA 3CA5A 4FRLA 4HO6A 1VM8A 4AYJA 4I8MA 4LO0A 1FR8A 2WVMA 5FU0A 1RY7A 2NTDA 2OEGA 4A7KA 2QKXA 1Z0HA 3SXEA 4ASYA 1TOOA 1DQGA 2D7RA 3H6RA 3HOMA 1FN0A 3RMXA 1NQIB 1W57A 3LLPA 2RJ7A 2YQCA 5FU8A 1S4PA 1ABRB 21BIA 4LO0C 2FY7A 4GOYA 4UY4A 4AN6A 5C48A 1Q04A 1FWYA 4FRAA 1O7OA 1DFQA 3H6RB 31BIA 1R8OA 2K43A 4ZA3B 3T8SA 5FZUA 3ZC9A 1MP5A 4KEKA 2O1FA 3BTAA 3I0FA 1YP3A 3F1CA 4CJBA 1HWMB 3O3PA 3V91A 2AECA 1YROB 1M2TB 2AH9A 2DPWA 2YC3A 3BX1C 2UUSA 1BFGA 2D0JA 4A7YA 1T9FA 1JYLA 1ZCYA 4B4BA 5L6VA 1JT7A 4OEFA 2P39A 1A8DA 4Z8SB 1H5TA 1ZCVA 2Y7AA 4DDZA 4KEJA 4HO2A 1HM0A 5DDTA 3N9WA 3JTJA 4EEMA 2RJ5A 4B4GA 4LO7B 1H5TB 4B2XA 4LO7C 4JKQA 1NZKA 1TW1A 3CU0A 4GAFA 4I4YA 3O5WB 2ERMA 4J2YA 1G23A 4ARWA 4ZFYB 2P23A 3CAHA 2X5SA 2NYYA 5D62A 1ZJ2A 2Q4JA 3PKQA 3N7KA 1VZXA 4UEGA 2VD4A 2RJ4A 3OAMA 5F8SA 5C3AA 4EEAA 1FO9A 4I4RA 3IM6A 1VGTA 2F2FA 1PZTA 3RMYA 4LO2A 1P63A 4K6RA 2VXMA 1ISXA 4YOLA 2BO7A 4P00A 3FJCA 1XZ6A 1XHBA 1W55A 2PGYA 1G9CA 1W3FA 4G87A 4NAIA 2K4AB 4ZFWB 1GGPB 2F2FC 3V0NA 1H7EA 3HALA 4LO2C 2Y9GA 1AVXB 2VXRA 4IY9A 4DECA 4LW6A 4JPZA 1YYNA 1H7FA 2QYIB 2Y9XE 5D92A 3U2XA 1TIEA 1AFCA 3R2WA 5AJNA 3CKVA 1G9DA 2NXVA 1S0EA 1HCDA 3AZVA 4R7PA 4FRMA 2NZ9A 3A23A 3V0LA 3PUBA 4OEGA 3OH4A 4FREA 3FJJA 1FV2A 2KH2A 1JV1A 5F8WA 3I0LA 1JT4A 4AAWA 4M4KA 4Y6NA 2A8WA 3H6QA 1G93A 1OMXA 3B9UA 3JUTA 1NKHB 1G9RA 5B2HA 3O44A 3SX8A 1S0GA 3NJ5A 2J0AA 2Z86A 4XFUA 3CKOA 9ILBA 3SXBA 2FDBM 4B5BA 2NM1A 1W3GA 3WO2A 2BFHA 5EJZA 4Q91A 2Z49A 3AH1A 2WBCA 4IZXA 2ET2A 3AJ5A 2HWAA 4OWLA 4OW4A 4DCKC 4KXOA 4KRVA 1N4KA 1PC8B 1RG8A 1EPWA 1MP4A 2V0LA 3CA4A 4G9NA 1S4OA 2V0IA 2YQHA 4J2KA 3FOQA 4HO5A 1QGQA 1YTOA 2XMHA 3OJ2A 1G1LA 3TQDA 2FGFA 3HSMA 5C4FA 3RSBA 4CJCA 2IHOA 4D8HA 1W3AA 2ZU7A 2YESA 4Y7VA 2Y4KA 4P6AA 2I5EA 2OEFA 4KPXA 1FV3A 3HBWA 3LTQA 1TVYA 5CQNX 5CQOA 2VSHA 3H6SE 1BARA 2NP0A 2XWMA 2RJ0A 1ZDFA 2ZU8A 4KPZA 1ITBA 4IHZA 5EIYA 3MALA 3QYDA 4G9MA 1H4DA 1RZOB 1QGSA 2AESA 1MC3A 4L41C 1IJTA 1F31A 4LO1A 4AC3A 5E24E 5C3DA 2AE7A 2ZQOA 2BO8A 1TW5A 1BFBA 4EFPA 4JAWA 4I1EA 4B2WA 4Q7CA 2KLLA 2Q3NB 4ISRA 3PMEA 3BAUA 3A07A 3BA7A 2PX7A 4BMAA 4LO1C 3WO3A 5BXSA 4KC2A 1ISYA 1JYKA 2P6WA 4Y6UA 3TZTA 4D0TA 3U2VA 2FFUA 1G8OA 4EE4A 4EEGA 1ISZA 5G00A 1PZYB 1HIBA 3T7MA 2E4MA 4ZKTB 1FGAA 2ZQNA 1R81A 2HWMA 3PNNA 1HWOB 5D63A 1Z4SA 3OGFA 1DJSB 2J3PA 4IQPA 1IOBA 4J23B 5BXTA 2RIXA 3V8YA 2ESUA 3E26A 1NHEB 1VGUA 1INJA 1ILR1 3VT0A 4EEEB 1G0RA 5DSSB 1NWGB 2RSTA 8I1BA 5JMCA 1FMZA 3K8EA 1K5UA 1BASA 1Z90A 3N7MA 1J0SA 3N7JA 3FJAA 1ZDGA 1MD6A 2JCKA 2BEAA 4IONA 1WT1A 3BAGA 5DVHA 1M16A 3VUOA 4JP0A 1LVWA 1L2HA 2D22A 3DK5A 5BP5A 5BVPI 3RMVA 5EC5A 1WD3A 5BXRA 1VZUA 1VH1A 2RIYA 3ST8A 3NBNA 3BAQA 4YS8A 3OKRA 4NANA 5C4BA 1JT3A 1H5RA 2YCMA 3CA6A 3PKPA 3OBRA 5BP5C 4Y7TA 2WE9A 1R7VA 3CA0A 4LW3A 3FJIA 3SX5A 1H7GA 2V0JA 3GUEA 4Y62A 4DEPA 1H5RB 2E3DA 3ZX7A 3AH4A 1WT2A 2RJ6A 4JKXB 5HPZA 2P72A 3HMYA 3D7WB 1YBIA 2WEEA 3U2UA 4EFRA 1ISVA 3O4BA 3D5NA 3I0DA 1BLAA 4KT7A 3KMVA 5C4EA 3VSFA 1AXMA 4QC4A 3OC9A 2K8RA 3AKGA 3R4SA 3I0EA 1E5KA 1Z2VA 3V0BA 4G1RA 1ZHJA 3FJEA 1JQZA 1FOAA 3FGMA 3BRFA 4XWIA 3VEQA 4R6UB 1EZIA 1BFCA 3D8VA 3I2AA 1NF5B 1VZTA 3HL3A 3CRGA 3ZC8A 3V0BB 3CA1A 3R3IA 1R7YA 4FGFA 3R4UA 2X2TA 2WGZA 5CMFX 3P53A 3AJ6A 2D7IA 3FJ8A 1ZJ0A 2NS2A 4I4PA 1ON6A 3FJDA 5IDTA 2KI6B 1FXOA 4GAIA 4I6IA 3OH3A 4IZEA 1JV3A 1TFMB 1HKNA 1FGGA 1JLXA 5I1BA 2BEBA 1IHKA 4X39A 1LL0A 4QD2B 2VS5A 4M28A 4Y7UA 5F90A 1V6VA 1GX0A 4QD2C 3VWCA 3UD8A 3CGXA 5F8YA 1WT3A 1JT5A 3SX3A 1YP2A 2D1ZA 4KBBA 3IOHA 3I0KA 3BRKX 4TLPA 3HN1A 4EE5A 3W9TA 3RTJB 2AAIB 2FO1A 1PUUB 2VSEA 1H4CA 3I0GA 5FV9A 3NBDA 2VS3A 1LZ7A 4USPA 4HO0A 5I1FA 3CRHA 3FWWA 4FCEA 3NBEA 1LZIA 3IOJA 3C9ZA 4QBVA 1GX4A 5J49A 4I2SA 3IIRA 1TWMA 3ZLKA 3PHZA 3Q7XA 3UD7A 2GGQA 3SXAA 4USOA 2A8UA 2Y4MA 5D91A 1ZJOA 4I4XA 1GQ9A 2XMEA 1AVWB 2QH5A 2L5XA 3A21A 3BRGC 2YUGA 1GA8A 4M2BA 3I0IX 2QN4A 1EYLA 5C4DA 2VK9A 2RG9B 2OI7A 4I1BA 2GZBA 1QQKA 1TZFA 3IAGC 1FXJA 2WRYA 1UPSA 1G97A 4KNRA 1IT0A 2I5KA 1WSZA 5DZUA 4I4OA 4XFSA 3ZXGA 1O7QA 3LW6A 1I52A 1TTUA 1HWPB 4I4UA 3WMVA 4IYBA 4G3PA 2BO4A 5IDSA 4QO3A 3Q7YA 2GGOA 4ZOTA 3SXDA 1H5SB 3MPPG 2P73A 1DIWA 3QVBA 2ZR1B 1ZJPA 1OMZA 3BB2A 2Y9WC 4HR6C 4Y63A 5CMGX 1H7TA 2APCA 3V0MA 3BRDA 5HS2A 1ZI4A 2BO6A 1WD4A 1G9AA 2D23A 2ICXA 1XYFA 3V0AA 4FRBA 5CMIA 5AJPA 4G3QA 1K4VA 3ZXDA 3OJMA 1EYRA 4I7IA 4EE3A 1VICA 4D11A 1H4EA 1KNMA 4FRHA 2DRYA 3V0AB 1MC9A 3CU1B 3Q4SA 1ONKB 3CA3A 1R82A 5C47A 2JCOA 5JQQA 3I2XA 5BXPA 2OI5A 3OBTA 4D11C 1G9BA 4D48A 4H9WA 2VU9A 3BAOA 1KWSA 2Z48A 4FCUA 1HJLA 4ISQA 3FJBA 1DZDA 5FZZA 1VPAA 3RMWA 1S0BA 1HM8A 3O4CA 2AXMA 5FZYA 4Y9XA 3V0QA 3AZWA 5CMJA 2VLCA 4FQWA 5AJOA 4DE7A 4DENA 1XG6A 3FUOA 2NVHA 3BADA 4F34A 1ZIZA 2AM5A 2RIZA 2FYDB 5C36A 4HG6A 4MYBA 2E4MC 4J2XA 1QQLA 4FVVA 4I96A 3P6JA 2GO2A 5JLVA 1Q1UA 3F62B 4QKSA 4I3NA 3T7NA 1H7QA 4X37A
chains in the Genus database with same CATH topology
3FJ9A 4I4SA 4EKXB 4HO8A 4E1KA 4J2SA 4MZFB 1FRWA 3SXCA 4GP3A 3POLA 3FJKA 3SNVA 4B3UA 4I4VA 5CMHA 3FFZA 3IM5A 1FWVA 1PWAA 3F1RA 1AVAC 4H04A 2WVLA 2X60A 4HO3A 4B4MA 1BFFA 3IOIA 3JRRA 1FGXA 1TP0A 2RITA 2AQZA 3BAHA 3USQA 4IRQA 1TWEA 2RQ9A 5C1GA 3RSJA 1QWJA 7I1BA 3I0CA 2X2SA 4PC4A 1K5VA 2XOAA 4II0A 2KI4A 5EG6C 3CKNA 3SPTA 2W0VA 2QGIA 2YQJA 3F1YA 3U0YA 1H7HA 3O4AA 3FJFA 3KIAA 1S0LA 2D20A 2I1BA 4Y7GA 2Y4JA 1V6UA 4HA2A 5FNWA 1JLYA 2Q9XA 1LZ0A 1QXMA 2XWLA 1OQLB 4HO4A 4EFQA 3K8DA 4B42A 1WT0A 1BA7A 2VUAA 4LO8B 6I1BA 1AVUA 1JY0A 3P6IA 4ECMA 1YF8B 2YC5A 2OI6A 4G3SA 1HWNB 5CQLX 3ZGFA 4ZDQA 1O0RA 4H75A 2E8BA 3VSZA 2HZ9A 2ICYA 1H7LA 2FYBA 3VT1A 2VXLA 2RJ8A 5BXCA 1Q03A 1QG8A 2YQSA 4ZLBB 1S4NA 1V6WA 1FWUA 2RJ9A 4J18A 5EJ1A 1HCEA 4KEIA 1II4A 4FIYA 3UJ0A 5IFYA 3FJHA 3ZF8A 1G82A 3V79C 1V84A 1CE7B 3OH0A 4GP0A 1FZWA 1VH3A 1RMLA 3WINA 2F8XC 2X5ZA 4Q9PA 4ZFUB 3UJ4A 1LZJA 2MLLB 1WVCA 4WBCA 4JRAA 5BQUA 3AKFA 3E25A 4P0LA 5FNXA 3OGZA 1GQCA 2MIBA 2WAWA 1G95A 2JCLA 1HM9A 4MZGB 1HV9A 3CKQA 4I4QA 2D24A 3WINC 4KC4A 3CQAA 4KC3A 1ZI3A 1LL3A 5BQUC 5FTSA 4O6NA 1NUNA 1FO8A 1AF9A 5C1HA 4LO3A 1FQ9A 4A7ZA 3BCVA 1WBCA 3IM7A 3NGWA 3Q7WA 1IRPA 3PG0A 4F83A 3Q7UA 2D43A 3EF2A 5C1LA 1SR4A 2DRZA 4ENDA 4HCQA 3U0XA 4GBPA 4LO3C 4X38A 4XFTA 3WMUA 2PA4A 2V0KA 2XWNA 3ZLLA 4QKRA 4Y64A 3UDAA 2W0WA 2RJ1A 2X65A 2PGVA 1ZJ1A 1SR4C 2KKIA 2VSIA 4M2AA 1OQMB 1CVSA 2C0NA 3V8ZA 1SZ6B 1ISWA 5FYEA 3DJ4A 1G3LA 3N7LA 1V83A 4EEOA 2VS4A 3I29B 1IILA 4FRDA 3JUJA 3U2WA 1R7TA 3AKHA 2AM4A 3QR5A 3V0PA 4ASJA 3O49A 4KNXA 1INIA 3ZGGA 41BIA 4P02A 1JVGA 2I7BA 4KQLA 4Z9WB 1DQOA 4C2SA 1IIMA 4I0YA 1XZZA 1H3MA 3DUVA 4HOCA 4P0JA 5C4CA 5C49A 3O4DA 4JQ0A 4OUJA 2DS0A 1H5SA 2JCJA 2LIQA 2CU2A 2O1GA 3WO4A 3EE5A 3POKA 3I0HA 1V6XA 2MZBA 4BQHA 3BA4A 3SXGA 3AH2A 3OH2A 4O6MA 1SS9A 1EV2A 2MC2A 5DDVA 5FTVA 1H5SC 2D44A 2Z87A 3TC2A 4Q9GA 1G2VA 3V90A 1R80A 3D98A 4QALA 1S0DA 4FRQA 3K1XA 4FRPA 1VGZA 3OGGA 3OJVA 4HJJA 2VXTI 1FR9A 2M49A 4G6JA 1ZCUA 4OWKA 4GOVA 3ILAA 3Q80A 2ZU9A 4FIXA 4CVHA 5CQPA 1W77A 1DLLA 3CKJA 3AKIA 2FYAA 3SX7A 2AFGA 4CJ8A 5L6SA 1I1BA 3O3QA 1R7XA 3A22A 4NALA 3U2TA 1S0CA 1ZI5A 2FFVA 1ZI1A 4FROA 3N0KA 1DZCA 1IRAX 2HW9A 5D61A 2FYCB 1D0HA 5C3BA 1JTCA 1S0FA 3RTIB 1PUMB 3V0OA 1MP3A 5DUYA 2UX8A 2VSAA 3OH1A 3NBCA 4NAKA 3UD9A 1JVDA 4IY8A 1NMMB 2J0BA 1ZCTA 5FUHA 1GWWA 1T4QA 3O4OA 3USRA 4OWJA 1EVTA 1E0OA 4L4HA 3FUQA 1DFCA 1YP4A 1ZJ3A 4X3AA 3JUKA 1PZZA 4ZGRB 5GAQA 5EHAA 5CQMX 4IRPA 2AGDA 2WVKA 3CRIA 3WA1A 3VT2A 1R8NA 4D0ZA 2R9KB 1BLDA 4G6MA 1HJJA 4AN7B 3I0JA 4QBCA 1IINA 4CJMA 1FG5N 2Y9FA 1LL2A 5C38A 1I1EA 4KC1A 1R7UA 1O23B 4EVWA 1YXWA 2Y4LA 4JISA 4EB2B 3S8JA 1ON8A 4Y7FA 1VCLA 4I37A 4XKIA 3S8KA 1GWVA 2V0HA 4MIXA 2AM3A 4MZHA 4P0KA 2DREA 1WBAA 4JD0A 4AYLA 1VGWA 2Y6PA 5C8RA 3E8LC 4OEEA 1FMMS 3BAVA 4HO9A 3BA5A 4L4IA 1H5SD 2VFZA 1V82A 2IWTB 4ZBVB 4MNDA 2LIEA 2O1HA 3T7OA 5BOWA 3CA5A 4FRLA 4HO6A 1VM8A 4AYJA 4I8MA 4LO0A 1FR8A 2WVMA 5FU0A 1RY7A 2NTDA 2OEGA 4A7KA 2QKXA 1Z0HA 3SXEA 4ASYA 1TOOA 1DQGA 2D7RA 3H6RA 3HOMA 1FN0A 3RMXA 1NQIB 1W57A 3LLPA 2RJ7A 2YQCA 5FU8A 1S4PA 1ABRB 21BIA 4LO0C 2FY7A 4GOYA 4UY4A 4AN6A 5C48A 1Q04A 1FWYA 4FRAA 1O7OA 1DFQA 3H6RB 31BIA 1R8OA 2K43A 4ZA3B 3T8SA 5FZUA 3ZC9A 1MP5A 4KEKA 2O1FA 3BTAA 3I0FA 1YP3A 3F1CA 4CJBA 1HWMB 3O3PA 3V91A 2AECA 1YROB 1M2TB 2AH9A 2DPWA 2YC3A 3BX1C 2UUSA 1BFGA 2D0JA 4A7YA 1T9FA 1JYLA 1ZCYA 4B4BA 5L6VA 1JT7A 4OEFA 2P39A 1A8DA 4Z8SB 1H5TA 1ZCVA 2Y7AA 4DDZA 4KEJA 4HO2A 1HM0A 5DDTA 3N9WA 3JTJA 4EEMA 2RJ5A 4B4GA 4LO7B 1H5TB 4B2XA 4LO7C 4JKQA 1NZKA 1TW1A 3CU0A 4GAFA 4I4YA 3O5WB 2ERMA 4J2YA 1G23A 4ARWA 4ZFYB 2P23A 3CAHA 2X5SA 2NYYA 5D62A 1ZJ2A 2Q4JA 3PKQA 3N7KA 1VZXA 4UEGA 2VD4A 2RJ4A 3OAMA 5F8SA 5C3AA 4EEAA 1FO9A 4I4RA 3IM6A 1VGTA 2F2FA 1PZTA 3RMYA 4LO2A 1P63A 4K6RA 2VXMA 1ISXA 4YOLA 2BO7A 4P00A 3FJCA 1XZ6A 1XHBA 1W55A 2PGYA 1G9CA 1W3FA 4G87A 4NAIA 2K4AB 4ZFWB 1GGPB 2F2FC 3V0NA 1H7EA 3HALA 4LO2C 2Y9GA 1AVXB 2VXRA 4IY9A 4DECA 4LW6A 4JPZA 1YYNA 1H7FA 2QYIB 2Y9XE 5D92A 3U2XA 1TIEA 1AFCA 3R2WA 5AJNA 3CKVA 1G9DA 2NXVA 1S0EA 1HCDA 3AZVA 4R7PA 4FRMA 2NZ9A 3A23A 3V0LA 3PUBA 4OEGA 3OH4A 4FREA 3FJJA 1FV2A 2KH2A 1JV1A 5F8WA 3I0LA 1JT4A 4AAWA 4M4KA 4Y6NA 2A8WA 3H6QA 1G93A 1OMXA 3B9UA 3JUTA 1NKHB 1G9RA 5B2HA 3O44A 3SX8A 1S0GA 3NJ5A 2J0AA 2Z86A 4XFUA 3CKOA 9ILBA 3SXBA 2FDBM 4B5BA 2NM1A 1W3GA 3WO2A 2BFHA 5EJZA 4Q91A 2Z49A 3AH1A 2WBCA 4IZXA 2ET2A 3AJ5A 2HWAA 4OWLA 4OW4A 4DCKC 4KXOA 4KRVA 1N4KA 1PC8B 1RG8A 1EPWA 1MP4A 2V0LA 3CA4A 4G9NA 1S4OA 2V0IA 2YQHA 4J2KA 3FOQA 4HO5A 1QGQA 1YTOA 2XMHA 3OJ2A 1G1LA 3TQDA 2FGFA 3HSMA 5C4FA 3RSBA 4CJCA 2IHOA 4D8HA 1W3AA 2ZU7A 2YESA 4Y7VA 2Y4KA 4P6AA 2I5EA 2OEFA 4KPXA 1FV3A 3HBWA 3LTQA 1TVYA 5CQNX 5CQOA 2VSHA 3H6SE 1BARA 2NP0A 2XWMA 2RJ0A 1ZDFA 2ZU8A 4KPZA 1ITBA 4IHZA 5EIYA 3MALA 3QYDA 4G9MA 1H4DA 1RZOB 1QGSA 2AESA 1MC3A 4L41C 1IJTA 1F31A 4LO1A 4AC3A 5E24E 5C3DA 2AE7A 2ZQOA 2BO8A 1TW5A 1BFBA 4EFPA 4JAWA 4I1EA 4B2WA 4Q7CA 2KLLA 2Q3NB 4ISRA 3PMEA 3BAUA 3A07A 3BA7A 2PX7A 4BMAA 4LO1C 3WO3A 5BXSA 4KC2A 1ISYA 1JYKA 2P6WA 4Y6UA 3TZTA 4D0TA 3U2VA 2FFUA 1G8OA 4EE4A 4EEGA 1ISZA 5G00A 1PZYB 1HIBA 3T7MA 2E4MA 4ZKTB 1FGAA 2ZQNA 1R81A 2HWMA 3PNNA 1HWOB 5D63A 1Z4SA 3OGFA 1DJSB 2J3PA 4IQPA 1IOBA 4J23B 5BXTA 2RIXA 3V8YA 2ESUA 3E26A 1NHEB 1VGUA 1INJA 1ILR1 3VT0A 4EEEB 1G0RA 5DSSB 1NWGB 2RSTA 8I1BA 5JMCA 1FMZA 3K8EA 1K5UA 1BASA 1Z90A 3N7MA 1J0SA 3N7JA 3FJAA 1ZDGA 1MD6A 2JCKA 2BEAA 4IONA 1WT1A 3BAGA 5DVHA 1M16A 3VUOA 4JP0A 1LVWA 1L2HA 2D22A 3DK5A 5BP5A 5BVPI 3RMVA 5EC5A 1WD3A 5BXRA 1VZUA 1VH1A 2RIYA 3ST8A 3NBNA 3BAQA 4YS8A 3OKRA 4NANA 5C4BA 1JT3A 1H5RA 2YCMA 3CA6A 3PKPA 3OBRA 5BP5C 4Y7TA 2WE9A 1R7VA 3CA0A 4LW3A 3FJIA 3SX5A 1H7GA 2V0JA 3GUEA 4Y62A 4DEPA 1H5RB 2E3DA 3ZX7A 3AH4A 1WT2A 2RJ6A 4JKXB 5HPZA 2P72A 3HMYA 3D7WB 1YBIA 2WEEA 3U2UA 4EFRA 1ISVA 3O4BA 3D5NA 3I0DA 1BLAA 4KT7A 3KMVA 5C4EA 3VSFA 1AXMA 4QC4A 3OC9A 2K8RA 3AKGA 3R4SA 3I0EA 1E5KA 1Z2VA 3V0BA 4G1RA 1ZHJA 3FJEA 1JQZA 1FOAA 3FGMA 3BRFA 4XWIA 3VEQA 4R6UB 1EZIA 1BFCA 3D8VA 3I2AA 1NF5B 1VZTA 3HL3A 3CRGA 3ZC8A 3V0BB 3CA1A 3R3IA 1R7YA 4FGFA 3R4UA 2X2TA 2WGZA 5CMFX 3P53A 3AJ6A 2D7IA 3FJ8A 1ZJ0A 2NS2A 4I4PA 1ON6A 3FJDA 5IDTA 2KI6B 1FXOA 4GAIA 4I6IA 3OH3A 4IZEA 1JV3A 1TFMB 1HKNA 1FGGA 1JLXA 5I1BA 2BEBA 1IHKA 4X39A 1LL0A 4QD2B 2VS5A 4M28A 4Y7UA 5F90A 1V6VA 1GX0A 4QD2C 3VWCA 3UD8A 3CGXA 5F8YA 1WT3A 1JT5A 3SX3A 1YP2A 2D1ZA 4KBBA 3IOHA 3I0KA 3BRKX 4TLPA 3HN1A 4EE5A 3W9TA 3RTJB 2AAIB 2FO1A 1PUUB 2VSEA 1H4CA 3I0GA 5FV9A 3NBDA 2VS3A 1LZ7A 4USPA 4HO0A 5I1FA 3CRHA 3FWWA 4FCEA 3NBEA 1LZIA 3IOJA 3C9ZA 4QBVA 1GX4A 5J49A 4I2SA 3IIRA 1TWMA 3ZLKA 3PHZA 3Q7XA 3UD7A 2GGQA 3SXAA 4USOA 2A8UA 2Y4MA 5D91A 1ZJOA 4I4XA 1GQ9A 2XMEA 1AVWB 2QH5A 2L5XA 3A21A 3BRGC 2YUGA 1GA8A 4M2BA 3I0IX 2QN4A 1EYLA 5C4DA 2VK9A 2RG9B 2OI7A 4I1BA 2GZBA 1QQKA 1TZFA 3IAGC 1FXJA 2WRYA 1UPSA 1G97A 4KNRA 1IT0A 2I5KA 1WSZA 5DZUA 4I4OA 4XFSA 3ZXGA 1O7QA 3LW6A 1I52A 1TTUA 1HWPB 4I4UA 3WMVA 4IYBA 4G3PA 2BO4A 5IDSA 4QO3A 3Q7YA 2GGOA 4ZOTA 3SXDA 1H5SB 3MPPG 2P73A 1DIWA 3QVBA 2ZR1B 1ZJPA 1OMZA 3BB2A 2Y9WC 4HR6C 4Y63A 5CMGX 1H7TA 2APCA 3V0MA 3BRDA 5HS2A 1ZI4A 2BO6A 1WD4A 1G9AA 2D23A 2ICXA 1XYFA 3V0AA 4FRBA 5CMIA 5AJPA 4G3QA 1K4VA 3ZXDA 3OJMA 1EYRA 4I7IA 4EE3A 1VICA 4D11A 1H4EA 1KNMA 4FRHA 2DRYA 3V0AB 1MC9A 3CU1B 3Q4SA 1ONKB 3CA3A 1R82A 5C47A 2JCOA 5JQQA 3I2XA 5BXPA 2OI5A 3OBTA 4D11C 1G9BA 4D48A 4H9WA 2VU9A 3BAOA 1KWSA 2Z48A 4FCUA 1HJLA 4ISQA 3FJBA 1DZDA 5FZZA 1VPAA 3RMWA 1S0BA 1HM8A 3O4CA 2AXMA 5FZYA 4Y9XA 3V0QA 3AZWA 5CMJA 2VLCA 4FQWA 5AJOA 4DE7A 4DENA 1XG6A 3FUOA 2NVHA 3BADA 4F34A 1ZIZA 2AM5A 2RIZA 2FYDB 5C36A 4HG6A 4MYBA 2E4MC 4J2XA 1QQLA 4FVVA 4I96A 3P6JA 2GO2A 5JLVA 1Q1UA 3F62B 4QKSA 4I3NA 3T7NA 1H7QA 4X37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJ9 A;  4I4S A;  4EKX B;  4HO8 A;  4E1K A;  4J2S A;  1FRW A;  3SXC A;  4GP3 A;  3POL A;  3FJK A;  3SNV A;  4B3U A;  4I4V A;  5CMH A;  3FFZ A;  3IM5 A;  1FWV A;  1PWA A;  3F1R A;  1AVA C;  4H04 A;  2WVL A;  2X60 A;  4HO3 A;  4B4M A;  1BFF A;  3IOI A;  3JRR A;  1FGX A;  1TP0 A;  2RIT A;  2AQZ A;  3BAH A;  3USQ A;  4IRQ A;  1TWE A;  2RQ9 A;  5C1G A;  3RSJ A;  1QWJ A;  7I1B A;  3I0C A;  2X2S A;  4PC4 A;  1K5V A;  2XOA A;  4II0 A;  2KI4 A;  5EG6 C;  3CKN A;  3SPT A;  2W0V A;  2QGI A;  2YQJ A;  3F1Y A;  3U0Y A;  1H7H A;  3O4A A;  3FJF A;  3KIA A;  1S0L A;  2D20 A;  2I1B A;  4Y7G A;  2Y4J A;  1V6U A;  4HA2 A;  5FNW A;  1JLY A;  2Q9X A;  1LZ0 A;  1QXM A;  2XWL A;  1OQL B;  4HO4 A;  4EFQ A;  3K8D A;  4B42 A;  1WT0 A;  1BA7 A;  2VUA A;  4LO8 B;  6I1B A;  1AVU A;  1JY0 A;  3P6I A;  4ECM A;  1YF8 B;  2YC5 A;  2OI6 A;  4G3S A;  1HWN B;  5CQL X;  3ZGF A;  4ZDQ A;  1O0R A;  2ICY A;  2E8B A;  3VSZ A;  2HZ9 A;  1H7L A;  2FYB A;  3VT1 A;  2VXL A;  2RJ8 A;  5BXC A;  1Q03 A;  1QG8 A;  2YQS A;  4ZLB B;  1S4N A;  1V6W A;  1FWU A;  2RJ9 A;  4J18 A;  5EJ1 A;  1HCE A;  4KEI A;  1II4 A;  3UJ0 A;  5IFY A;  3FJH A;  3ZF8 A;  1G82 A;  3V79 C;  1V84 A;  1CE7 B;  3OH0 A;  4GP0 A;  1FZW A;  1VH3 A;  1RML A;  3WIN A;  2F8X C;  2X5Z A;  4Q9P A;  4ZFU B;  3UJ4 A;  1LZJ A;  2MLL B;  1WVC A;  4WBC A;  4JRA A;  5BQU A;  3AKF A;  3E25 A;  4P0L A;  5FNX A;  3OGZ A;  1GQC A;  2MIB A;  2WAW A;  1G95 A;  2JCL A;  1HM9 A;  1HV9 A;  3CKQ A;  4I4Q A;  2D24 A;  3WIN C;  4KC4 A;  3CQA A;  4KC3 A;  1ZI3 A;  1LL3 A;  5BQU C;  5FTS A;  1NUN A;  1FO8 A;  1AF9 A;  5C1H A;  4LO3 A;  1FQ9 A;  4A7Z A;  3BCV A;  1WBC A;  3IM7 A;  3NGW A;  3Q7W A;  1IRP A;  3PG0 A;  4F83 A;  3Q7U A;  2D43 A;  3EF2 A;  5C1L A;  1SR4 A;  2DRZ A;  4END A;  4HCQ A;  3U0X A;  4GBP A;  4LO3 C;  4X38 A;  4XFT A;  3WMU A;  2PA4 A;  2V0K A;  2XWN A;  3ZLL A;  4QKR A;  4Y64 A;  3UDA A;  2W0W A;  2RJ1 A;  2X65 A;  2PGV A;  1ZJ1 A;  1SR4 C;  2KKI A;  2VSI A;  4M2A A;  1OQM B;  1CVS A;  3V8Z A;  1SZ6 B;  1ISW A;  5FYE A;  3DJ4 A;  1G3L A;  3N7L A;  1V83 A;  4EEO A;  2VS4 A;  3I29 B;  1IIL A;  4FRD A;  3JUJ A;  3U2W A;  1R7T A;  3AKH A;  2AM4 A;  3QR5 A;  3V0P A;  4ASJ A;  3O49 A;  4KNX A;  1INI A;  3ZGG A;  41BI A;  4P02 A;  1JVG A;  2I7B A;  4KQL A;  4Z9W B;  1DQO A;  4C2S A;  1IIM A;  4I0Y A;  1XZZ A;  1H3M A;  3DUV A;  4HOC A;  4P0J A;  5C4C A;  5C49 A;  3O4D A;  4JQ0 A;  4OUJ A;  2DS0 A;  1H5S A;  2JCJ A;  2LIQ A;  2CU2 A;  2O1G A;  3WO4 A;  3EE5 A;  3POK A;  3I0H A;  1V6X A;  2MZB A;  4BQH A;  3BA4 A;  3SXG A;  3AH2 A;  3OH2 A;  1SS9 A;  1EV2 A;  2MC2 A;  5DDV A;  5FTV A;  1H5S C;  2D44 A;  2Z87 A;  3TC2 A;  4Q9G A;  1G2V A;  3V90 A;  1R80 A;  3D98 A;  4QAL A;  1S0D A;  4FRQ A;  3K1X A;  4FRP A;  1VGZ A;  3OGG A;  3OJV A;  4HJJ A;  2VXT I;  1FR9 A;  2M49 A;  4G6J A;  1ZCU A;  4OWK A;  4GOV A;  3ILA A;  3Q80 A;  2ZU9 A;  4CVH A;  5CQP A;  1W77 A;  1DLL A;  3CKJ A;  3AKI A;  2FYA A;  3SX7 A;  2AFG A;  4CJ8 A;  5L6S A;  1I1B A;  3O3Q A;  1R7X A;  3A22 A;  4NAL A;  3U2T A;  1S0C A;  1ZI5 A;  2FFV A;  1ZI1 A;  4FRO A;  3N0K A;  1DZC A;  1IRA X;  2HW9 A;  5D61 A;  2FYC B;  1D0H A;  5C3B A;  1JTC A;  1S0F A;  3RTI B;  1PUM B;  3V0O A;  1MP3 A;  5DUY A;  2UX8 A;  2VSA A;  3OH1 A;  3NBC A;  4NAK A;  3UD9 A;  1JVD A;  4IY8 A;  1NMM B;  5FUH A;  1ZCT A;  1GWW A;  1T4Q A;  3O4O A;  3USR A;  4OWJ A;  1EVT A;  1E0O A;  4L4H A;  3FUQ A;  1DFC A;  1YP4 A;  1ZJ3 A;  4X3A A;  3JUK A;  1PZZ A;  4ZGR B;  5GAQ A;  5EHA A;  5CQM X;  4IRP A;  2AGD A;  2WVK A;  3CRI A;  3WA1 A;  3VT2 A;  1R8N A;  4D0Z A;  2R9K B;  1BLD A;  4G6M A;  1HJJ A;  4AN7 B;  3I0J A;  4QBC A;  1IIN A;  4CJM A;  1FG5 N;  2Y9F A;  1LL2 A;  5C38 A;  1I1E A;  4KC1 A;  1R7U A;  1O23 B;  4EVW A;  1YXW A;  2Y4L A;  4JIS A;  4EB2 B;  3S8J A;  1ON8 A;  4Y7F A;  1VCL A;  4I37 A;  4XKI A;  3S8K A;  1GWV A;  2V0H A;  2AM3 A;  4JD0 A;  4P0K A;  2DRE A;  1WBA A;  4AYL A;  1VGW A;  2Y6P A;  5C8R A;  3E8L C;  4OEE A;  1FMM S;  3BAV A;  4HO9 A;  3BA5 A;  4L4I A;  1H5S D;  2VFZ A;  1V82 A;  2IWT B;  4ZBV B;  4MND A;  2LIE A;  2O1H A;  3T7O A;  5BOW A;  3CA5 A;  4FRL A;  4HO6 A;  1VM8 A;  4AYJ A;  4I8M A;  4LO0 A;  1FR8 A;  2WVM A;  5FU0 A;  1RY7 A;  2NTD A;  2OEG A;  4A7K A;  2QKX A;  1Z0H A;  3SXE A;  4ASY A;  1TOO A;  1DQG A;  2D7R A;  3H6R A;  3HOM A;  1FN0 A;  3RMX A;  1NQI B;  1W57 A;  3LLP A;  2RJ7 A;  2YQC A;  5FU8 A;  1S4P A;  1ABR B;  21BI A;  4LO0 C;  2FY7 A;  4GOY A;  4AN6 A;  5C48 A;  1Q04 A;  1FWY A;  4FRA A;  1O7O A;  1DFQ A;  3H6R B;  31BI A;  1R8O A;  2K43 A;  4ZA3 B;  3T8S A;  5FZU A;  3ZC9 A;  1MP5 A;  4KEK A;  2O1F A;  3BTA A;  3I0F A;  1YP3 A;  3F1C A;  4CJB A;  1HWM B;  3O3P A;  3V91 A;  2AEC A;  1YRO B;  1M2T B;  2AH9 A;  2DPW A;  2YC3 A;  3BX1 C;  2UUS A;  1BFG A;  2D0J A;  4A7Y A;  1T9F A;  1JYL A;  1ZCY A;  4B4B A;  5L6V A;  1JT7 A;  4OEF A;  2P39 A;  1A8D A;  4Z8S B;  1H5T A;  1ZCV A;  2Y7A A;  4DDZ A;  4KEJ A;  4HO2 A;  1HM0 A;  5DDT A;  3N9W A;  3JTJ A;  4EEM A;  2RJ5 A;  4B4G A;  4LO7 B;  1H5T B;  4B2X A;  4LO7 C;  4JKQ A;  1NZK A;  1TW1 A;  3CU0 A;  4GAF A;  4I4Y A;  3O5W B;  2ERM A;  4J2Y A;  1G23 A;  4ARW A;  4ZFY B;  2P23 A;  3CAH A;  2X5S A;  2NYY A;  5D62 A;  1ZJ2 A;  2Q4J A;  3PKQ A;  3N7K A;  1VZX A;  4UEG A;  2VD4 A;  2RJ4 A;  3OAM A;  5F8S A;  5C3A A;  4EEA A;  1FO9 A;  4I4R A;  3IM6 A;  1VGT A;  2F2F A;  1PZT A;  3RMY A;  4LO2 A;  1P63 A;  4K6R A;  2VXM A;  1ISX A;  4YOL A;  2BO7 A;  4P00 A;  3FJC A;  1XZ6 A;  1XHB A;  1W55 A;  2PGY A;  1G9C A;  1W3F A;  4G87 A;  4NAI A;  2K4A B;  4ZFW B;  1GGP B;  2F2F C;  3V0N A;  1H7E A;  3HAL A;  4LO2 C;  2Y9G A;  1AVX B;  2VXR A;  4IY9 A;  4DEC A;  4LW6 A;  4JPZ A;  1YYN A;  1H7F A;  2QYI B;  2Y9X E;  3U2X A;  1TIE A;  1AFC A;  3R2W A;  5AJN A;  3CKV A;  1G9D A;  2NXV A;  1S0E A;  1HCD A;  3AZV A;  4R7P A;  4FRM A;  2NZ9 A;  3A23 A;  3V0L A;  3PUB A;  4OEG A;  3OH4 A;  4FRE A;  3FJJ A;  1FV2 A;  2KH2 A;  1JV1 A;  5F8W A;  3I0L A;  1JT4 A;  4AAW A;  4M4K A;  4Y6N A;  2A8W A;  3H6Q A;  1G93 A;  1OMX A;  3B9U A;  3JUT A;  1NKH B;  1G9R A;  5B2H A;  3O44 A;  3SX8 A;  1S0G A;  3NJ5 A;  2Z86 A;  4XFU A;  3CKO A;  9ILB A;  3SXB A;  2FDB M;  4B5B A;  2NM1 A;  1W3G A;  3WO2 A;  2BFH A;  5EJZ A;  4Q91 A;  2Z49 A;  3AH1 A;  2WBC A;  4IZX A;  2ET2 A;  3AJ5 A;  2HWA A;  4OWL A;  4OW4 A;  4DCK C;  4KXO A;  4KRV A;  1N4K A;  1PC8 B;  1RG8 A;  1EPW A;  1MP4 A;  2V0L A;  3CA4 A;  4G9N A;  1S4O A;  2V0I A;  2YQH A;  4J2K A;  3FOQ A;  4HO5 A;  1QGQ A;  1YTO A;  2XMH A;  3OJ2 A;  1G1L A;  3TQD A;  2FGF A;  3HSM A;  5C4F A;  3RSB A;  4CJC A;  2IHO A;  4D8H A;  1W3A A;  2ZU7 A;  2YES A;  4Y7V A;  2Y4K A;  4P6A A;  2I5E A;  2OEF A;  4KPX A;  1FV3 A;  3HBW A;  3LTQ A;  1TVY A;  5CQN X;  5CQO A;  2VSH A;  3H6S E;  1BAR A;  2NP0 A;  2XWM A;  2RJ0 A;  1ZDF A;  2ZU8 A;  4KPZ A;  1ITB A;  4IHZ A;  5EIY A;  3MAL A;  3QYD A;  4G9M A;  1H4D A;  1RZO B;  1QGS A;  2AES A;  1MC3 A;  4L41 C;  1IJT A;  1F31 A;  4LO1 A;  4AC3 A;  5E24 E;  5C3D A;  2AE7 A;  2ZQO A;  2BO8 A;  1TW5 A;  1BFB A;  4EFP A;  4JAW A;  4I1E A;  4B2W A;  2KLL A;  2Q3N B;  4ISR A;  3PME A;  3BAU A;  3A07 A;  3BA7 A;  2PX7 A;  4BMA A;  4LO1 C;  3WO3 A;  5BXS A;  4KC2 A;  1ISY A;  1JYK A;  2P6W A;  4Y6U A;  3TZT A;  4D0T A;  3U2V A;  2FFU A;  1G8O A;  4EE4 A;  4EEG A;  1ISZ A;  5G00 A;  1PZY B;  1HIB A;  3T7M A;  2E4M A;  4ZKT B;  1FGA A;  2ZQN A;  1R81 A;  2HWM A;  3PNN A;  1HWO B;  5D63 A;  1Z4S A;  3OGF A;  1DJS B;  2J3P A;  4IQP A;  1IOB A;  4J23 B;  5BXT A;  2RIX A;  3V8Y A;  2ESU A;  3E26 A;  1NHE B;  1VGU A;  1INJ A;  1ILR 1;  3VT0 A;  4EEE B;  1G0R A;  5DSS B;  1NWG B;  2RST A;  8I1B A;  5JMC A;  1FMZ A;  3K8E A;  1K5U A;  1BAS A;  1Z90 A;  3N7M A;  1J0S A;  3N7J A;  3FJA A;  1ZDG A;  1MD6 A;  2JCK A;  2BEA A;  4ION A;  1WT1 A;  3BAG A;  5DVH A;  1M16 A;  3VUO A;  4JP0 A;  1LVW A;  1L2H A;  2D22 A;  3DK5 A;  5BP5 A;  5BVP I;  3RMV A;  5EC5 A;  1WD3 A;  5BXR A;  1VZU A;  1VH1 A;  2RIY A;  3ST8 A;  3NBN A;  3BAQ A;  4YS8 A;  3OKR A;  4NAN A;  5C4B A;  1JT3 A;  1H5R A;  2YCM A;  3CA6 A;  3PKP A;  3OBR A;  5BP5 C;  4Y7T A;  2WE9 A;  1R7V A;  3CA0 A;  4LW3 A;  3FJI A;  3SX5 A;  1H7G A;  2V0J A;  3GUE A;  4Y62 A;  4DEP A;  1H5R B;  2E3D A;  3ZX7 A;  3AH4 A;  1WT2 A;  2RJ6 A;  4JKX B;  5HPZ A;  2P72 A;  3HMY A;  3D7W B;  1YBI A;  2WEE A;  3U2U A;  4EFR A;  1ISV A;  3O4B A;  3D5N A;  3I0D A;  1BLA A;  4KT7 A;  3KMV A;  5C4E A;  3VSF A;  1AXM A;  4QC4 A;  3OC9 A;  2K8R A;  3AKG A;  3R4S A;  3I0E A;  1E5K A;  1Z2V A;  3V0B A;  4G1R A;  1ZHJ A;  3FJE A;  1JQZ A;  1FOA A;  3FGM A;  3BRF A;  4XWI A;  3VEQ A;  4R6U B;  1EZI A;  1BFC A;  3D8V A;  3I2A A;  1NF5 B;  1VZT A;  3HL3 A;  3CRG A;  3ZC8 A;  3V0B B;  3CA1 A;  3R3I A;  1R7Y A;  4FGF A;  3R4U A;  2X2T A;  2WGZ A;  5CMF X;  3P53 A;  3AJ6 A;  2D7I A;  3FJ8 A;  1ZJ0 A;  4I4P A;  1ON6 A;  5IDT A;  3FJD A;  2KI6 B;  1FXO A;  4GAI A;  4I6I A;  3OH3 A;  4IZE A;  1JV3 A;  1TFM B;  1HKN A;  1FGG A;  1JLX A;  5I1B A;  2BEB A;  1IHK A;  4X39 A;  1LL0 A;  4QD2 B;  2VS5 A;  4M28 A;  4Y7U A;  5F90 A;  1V6V A;  1GX0 A;  4QD2 C;  3VWC A;  3UD8 A;  3CGX A;  5F8Y A;  1WT3 A;  1JT5 A;  3SX3 A;  1YP2 A;  2D1Z A;  4KBB A;  3IOH A;  3I0K A;  3BRK X;  4TLP A;  3HN1 A;  4EE5 A;  3W9T A;  3RTJ B;  2AAI B;  2FO1 A;  1PUU B;  2VSE A;  1H4C A;  3I0G A;  5FV9 A;  3NBD A;  2VS3 A;  1LZ7 A;  4USP A;  4HO0 A;  5I1F A;  3CRH A;  3FWW A;  4FCE A;  3NBE A;  1LZI A;  3IOJ A;  3C9Z A;  4QBV A;  1GX4 A;  5J49 A;  4I2S A;  3IIR A;  1TWM A;  3ZLK A;  3PHZ A;  3Q7X A;  3UD7 A;  2GGQ A;  3SXA A;  4USO A;  2A8U A;  2Y4M A;  1ZJO A;  4I4X A;  1GQ9 A;  2XME A;  1AVW B;  2QH5 A;  2L5X A;  3A21 A;  3BRG C;  2YUG A;  1GA8 A;  4M2B A;  3I0I X;  2QN4 A;  1EYL A;  5C4D A;  2RG9 B;  2OI7 A;  4I1B A;  2GZB A;  1QQK A;  1TZF A;  3IAG C;  1FXJ A;  2WRY A;  1UPS A;  1G97 A;  4KNR A;  1IT0 A;  2I5K A;  1WSZ A;  5DZU A;  4I4O A;  4XFS A;  3ZXG A;  1O7Q A;  3LW6 A;  1I52 A;  1TTU A;  1HWP B;  4I4U A;  3WMV A;  4IYB A;  4G3P A;  2BO4 A;  5IDS A;  4QO3 A;  3Q7Y A;  2GGO A;  4ZOT A;  3SXD A;  1H5S B;  3MPP G;  2P73 A;  1DIW A;  3QVB A;  2ZR1 B;  1ZJP A;  1OMZ A;  3BB2 A;  2Y9W C;  4HR6 C;  4Y63 A;  5CMG X;  1H7T A;  2APC A;  3V0M A;  3BRD A;  5HS2 A;  1ZI4 A;  2BO6 A;  1WD4 A;  1G9A A;  2D23 A;  2ICX A;  1XYF A;  3V0A A;  4FRB A;  5CMI A;  5AJP A;  4G3Q A;  1K4V A;  3ZXD A;  3OJM A;  1EYR A;  4I7I A;  4EE3 A;  1VIC A;  4D11 A;  1H4E A;  1KNM A;  4FRH A;  2DRY A;  3V0A B;  1MC9 A;  3CU1 B;  3Q4S A;  1ONK B;  3CA3 A;  1R82 A;  5C47 A;  2JCO A;  5JQQ A;  3I2X A;  5BXP A;  2OI5 A;  3OBT A;  4D11 C;  1G9B A;  4D48 A;  4H9W A;  2VU9 A;  3BAO A;  1KWS A;  2Z48 A;  4FCU A;  1HJL A;  4ISQ A;  3FJB A;  1DZD A;  5FZZ A;  1VPA A;  3RMW A;  1S0B A;  1HM8 A;  3O4C A;  2AXM A;  5FZY A;  4Y9X A;  3V0Q A;  3AZW A;  5CMJ A;  2VLC A;  4FQW A;  5AJO A;  4DE7 A;  4DEN A;  1XG6 A;  3FUO A;  2NVH A;  3BAD A;  4F34 A;  1ZIZ A;  2AM5 A;  2RIZ A;  2FYD B;  5C36 A;  4HG6 A;  4MYB A;  2E4M C;  4J2X A;  1QQL A;  4FVV A;  4I96 A;  3P6J A;  2GO2 A;  5JLV A;  1Q1U A;  3F62 B;  4QKS A;  4I3N A;  3T7N A;  1H7Q A;  4X37 A; 
#chains in the Genus database with same CATH topology
 3FJ9 A;  4I4S A;  4EKX B;  4HO8 A;  4E1K A;  4J2S A;  4MZF B;  1FRW A;  3SXC A;  4GP3 A;  3POL A;  3FJK A;  3SNV A;  4B3U A;  4I4V A;  5CMH A;  3FFZ A;  3IM5 A;  1FWV A;  1PWA A;  3F1R A;  1AVA C;  4H04 A;  2WVL A;  2X60 A;  4HO3 A;  4B4M A;  1BFF A;  3IOI A;  3JRR A;  1FGX A;  1TP0 A;  2RIT A;  2AQZ A;  3BAH A;  3USQ A;  4IRQ A;  1TWE A;  2RQ9 A;  5C1G A;  3RSJ A;  1QWJ A;  7I1B A;  3I0C A;  2X2S A;  4PC4 A;  1K5V A;  2XOA A;  4II0 A;  2KI4 A;  5EG6 C;  3CKN A;  3SPT A;  2W0V A;  2QGI A;  2YQJ A;  3F1Y A;  3U0Y A;  1H7H A;  3O4A A;  3FJF A;  3KIA A;  1S0L A;  2D20 A;  2I1B A;  4Y7G A;  2Y4J A;  1V6U A;  4HA2 A;  5FNW A;  1JLY A;  2Q9X A;  1LZ0 A;  1QXM A;  2XWL A;  1OQL B;  4HO4 A;  4EFQ A;  3K8D A;  4B42 A;  1WT0 A;  1BA7 A;  2VUA A;  4LO8 B;  6I1B A;  1AVU A;  1JY0 A;  3P6I A;  4ECM A;  1YF8 B;  2YC5 A;  2OI6 A;  4G3S A;  1HWN B;  5CQL X;  3ZGF A;  4ZDQ A;  1O0R A;  4H75 A;  2E8B A;  3VSZ A;  2HZ9 A;  2ICY A;  1H7L A;  2FYB A;  3VT1 A;  2VXL A;  2RJ8 A;  5BXC A;  1Q03 A;  1QG8 A;  2YQS A;  4ZLB B;  1S4N A;  1V6W A;  1FWU A;  2RJ9 A;  4J18 A;  5EJ1 A;  1HCE A;  4KEI A;  1II4 A;  4FIY A;  3UJ0 A;  5IFY A;  3FJH A;  3ZF8 A;  1G82 A;  3V79 C;  1V84 A;  1CE7 B;  3OH0 A;  4GP0 A;  1FZW A;  1VH3 A;  1RML A;  3WIN A;  2F8X C;  2X5Z A;  4Q9P A;  4ZFU B;  3UJ4 A;  1LZJ A;  2MLL B;  1WVC A;  4WBC A;  4JRA A;  5BQU A;  3AKF A;  3E25 A;  4P0L A;  5FNX A;  3OGZ A;  1GQC A;  2MIB A;  2WAW A;  1G95 A;  2JCL A;  1HM9 A;  4MZG B;  1HV9 A;  3CKQ A;  4I4Q A;  2D24 A;  3WIN C;  4KC4 A;  3CQA A;  4KC3 A;  1ZI3 A;  1LL3 A;  5BQU C;  5FTS A;  4O6N A;  1NUN A;  1FO8 A;  1AF9 A;  5C1H A;  4LO3 A;  1FQ9 A;  4A7Z A;  3BCV A;  1WBC A;  3IM7 A;  3NGW A;  3Q7W A;  1IRP A;  3PG0 A;  4F83 A;  3Q7U A;  2D43 A;  3EF2 A;  5C1L A;  1SR4 A;  2DRZ A;  4END A;  4HCQ A;  3U0X A;  4GBP A;  4LO3 C;  4X38 A;  4XFT A;  3WMU A;  2PA4 A;  2V0K A;  2XWN A;  3ZLL A;  4QKR A;  4Y64 A;  3UDA A;  2W0W A;  2RJ1 A;  2X65 A;  2PGV A;  1ZJ1 A;  1SR4 C;  2KKI A;  2VSI A;  4M2A A;  1OQM B;  1CVS A;  2C0N A;  3V8Z A;  1SZ6 B;  1ISW A;  5FYE A;  3DJ4 A;  1G3L A;  3N7L A;  1V83 A;  4EEO A;  2VS4 A;  3I29 B;  1IIL A;  4FRD A;  3JUJ A;  3U2W A;  1R7T A;  3AKH A;  2AM4 A;  3QR5 A;  3V0P A;  4ASJ A;  3O49 A;  4KNX A;  1INI A;  3ZGG A;  41BI A;  4P02 A;  1JVG A;  2I7B A;  4KQL A;  4Z9W B;  1DQO A;  4C2S A;  1IIM A;  4I0Y A;  1XZZ A;  1H3M A;  3DUV A;  4HOC A;  4P0J A;  5C4C A;  5C49 A;  3O4D A;  4JQ0 A;  4OUJ A;  2DS0 A;  1H5S A;  2JCJ A;  2LIQ A;  2CU2 A;  2O1G A;  3WO4 A;  3EE5 A;  3POK A;  3I0H A;  1V6X A;  2MZB A;  4BQH A;  3BA4 A;  3SXG A;  3AH2 A;  3OH2 A;  4O6M A;  1SS9 A;  1EV2 A;  2MC2 A;  5DDV A;  5FTV A;  1H5S C;  2D44 A;  2Z87 A;  3TC2 A;  4Q9G A;  1G2V A;  3V90 A;  1R80 A;  3D98 A;  4QAL A;  1S0D A;  4FRQ A;  3K1X A;  4FRP A;  1VGZ A;  3OGG A;  3OJV A;  4HJJ A;  2VXT I;  1FR9 A;  2M49 A;  4G6J A;  1ZCU A;  4OWK A;  4GOV A;  3ILA A;  3Q80 A;  2ZU9 A;  4FIX A;  4CVH A;  5CQP A;  1W77 A;  1DLL A;  3CKJ A;  3AKI A;  2FYA A;  3SX7 A;  2AFG A;  4CJ8 A;  5L6S A;  1I1B A;  3O3Q A;  1R7X A;  3A22 A;  4NAL A;  3U2T A;  1S0C A;  1ZI5 A;  2FFV A;  1ZI1 A;  4FRO A;  3N0K A;  1DZC A;  1IRA X;  2HW9 A;  5D61 A;  2FYC B;  1D0H A;  5C3B A;  1JTC A;  1S0F A;  3RTI B;  1PUM B;  3V0O A;  1MP3 A;  5DUY A;  2UX8 A;  2VSA A;  3OH1 A;  3NBC A;  4NAK A;  3UD9 A;  1JVD A;  4IY8 A;  1NMM B;  2J0B A;  1ZCT A;  5FUH A;  1GWW A;  1T4Q A;  3O4O A;  3USR A;  4OWJ A;  1EVT A;  1E0O A;  4L4H A;  3FUQ A;  1DFC A;  1YP4 A;  1ZJ3 A;  4X3A A;  3JUK A;  1PZZ A;  4ZGR B;  5GAQ A;  5EHA A;  5CQM X;  4IRP A;  2AGD A;  2WVK A;  3CRI A;  3WA1 A;  3VT2 A;  1R8N A;  4D0Z A;  2R9K B;  1BLD A;  4G6M A;  1HJJ A;  4AN7 B;  3I0J A;  4QBC A;  1IIN A;  4CJM A;  1FG5 N;  2Y9F A;  1LL2 A;  5C38 A;  1I1E A;  4KC1 A;  1R7U A;  1O23 B;  4EVW A;  1YXW A;  2Y4L A;  4JIS A;  4EB2 B;  3S8J A;  1ON8 A;  4Y7F A;  1VCL A;  4I37 A;  4XKI A;  3S8K A;  1GWV A;  2V0H A;  4MIX A;  2AM3 A;  4MZH A;  4P0K A;  2DRE A;  1WBA A;  4JD0 A;  4AYL A;  1VGW A;  2Y6P A;  5C8R A;  3E8L C;  4OEE A;  1FMM S;  3BAV A;  4HO9 A;  3BA5 A;  4L4I A;  1H5S D;  2VFZ A;  1V82 A;  2IWT B;  4ZBV B;  4MND A;  2LIE A;  2O1H A;  3T7O A;  5BOW A;  3CA5 A;  4FRL A;  4HO6 A;  1VM8 A;  4AYJ A;  4I8M A;  4LO0 A;  1FR8 A;  2WVM A;  5FU0 A;  1RY7 A;  2NTD A;  2OEG A;  4A7K A;  2QKX A;  1Z0H A;  3SXE A;  4ASY A;  1TOO A;  1DQG A;  2D7R A;  3H6R A;  3HOM A;  1FN0 A;  3RMX A;  1NQI B;  1W57 A;  3LLP A;  2RJ7 A;  2YQC A;  5FU8 A;  1S4P A;  1ABR B;  21BI A;  4LO0 C;  2FY7 A;  4GOY A;  4UY4 A;  4AN6 A;  5C48 A;  1Q04 A;  1FWY A;  4FRA A;  1O7O A;  1DFQ A;  3H6R B;  31BI A;  1R8O A;  2K43 A;  4ZA3 B;  3T8S A;  5FZU A;  3ZC9 A;  1MP5 A;  4KEK A;  2O1F A;  3BTA A;  3I0F A;  1YP3 A;  3F1C A;  4CJB A;  1HWM B;  3O3P A;  3V91 A;  2AEC A;  1YRO B;  1M2T B;  2AH9 A;  2DPW A;  2YC3 A;  3BX1 C;  2UUS A;  1BFG A;  2D0J A;  4A7Y A;  1T9F A;  1JYL A;  1ZCY A;  4B4B A;  5L6V A;  1JT7 A;  4OEF A;  2P39 A;  1A8D A;  4Z8S B;  1H5T A;  1ZCV A;  2Y7A A;  4DDZ A;  4KEJ A;  4HO2 A;  1HM0 A;  5DDT A;  3N9W A;  3JTJ A;  4EEM A;  2RJ5 A;  4B4G A;  4LO7 B;  1H5T B;  4B2X A;  4LO7 C;  4JKQ A;  1NZK A;  1TW1 A;  3CU0 A;  4GAF A;  4I4Y A;  3O5W B;  2ERM A;  4J2Y A;  1G23 A;  4ARW A;  4ZFY B;  2P23 A;  3CAH A;  2X5S A;  2NYY A;  5D62 A;  1ZJ2 A;  2Q4J A;  3PKQ A;  3N7K A;  1VZX A;  4UEG A;  2VD4 A;  2RJ4 A;  3OAM A;  5F8S A;  5C3A A;  4EEA A;  1FO9 A;  4I4R A;  3IM6 A;  1VGT A;  2F2F A;  1PZT A;  3RMY A;  4LO2 A;  1P63 A;  4K6R A;  2VXM A;  1ISX A;  4YOL A;  2BO7 A;  4P00 A;  3FJC A;  1XZ6 A;  1XHB A;  1W55 A;  2PGY A;  1G9C A;  1W3F A;  4G87 A;  4NAI A;  2K4A B;  4ZFW B;  1GGP B;  2F2F C;  3V0N A;  1H7E A;  3HAL A;  4LO2 C;  2Y9G A;  1AVX B;  2VXR A;  4IY9 A;  4DEC A;  4LW6 A;  4JPZ A;  1YYN A;  1H7F A;  2QYI B;  2Y9X E;  5D92 A;  3U2X A;  1TIE A;  1AFC A;  3R2W A;  5AJN A;  3CKV A;  1G9D A;  2NXV A;  1S0E A;  1HCD A;  3AZV A;  4R7P A;  4FRM A;  2NZ9 A;  3A23 A;  3V0L A;  3PUB A;  4OEG A;  3OH4 A;  4FRE A;  3FJJ A;  1FV2 A;  2KH2 A;  1JV1 A;  5F8W A;  3I0L A;  1JT4 A;  4AAW A;  4M4K A;  4Y6N A;  2A8W A;  3H6Q A;  1G93 A;  1OMX A;  3B9U A;  3JUT A;  1NKH B;  1G9R A;  5B2H A;  3O44 A;  3SX8 A;  1S0G A;  3NJ5 A;  2J0A A;  2Z86 A;  4XFU A;  3CKO A;  9ILB A;  3SXB A;  2FDB M;  4B5B A;  2NM1 A;  1W3G A;  3WO2 A;  2BFH A;  5EJZ A;  4Q91 A;  2Z49 A;  3AH1 A;  2WBC A;  4IZX A;  2ET2 A;  3AJ5 A;  2HWA A;  4OWL A;  4OW4 A;  4DCK C;  4KXO A;  4KRV A;  1N4K A;  1PC8 B;  1RG8 A;  1EPW A;  1MP4 A;  2V0L A;  3CA4 A;  4G9N A;  1S4O A;  2V0I A;  2YQH A;  4J2K A;  3FOQ A;  4HO5 A;  1QGQ A;  1YTO A;  2XMH A;  3OJ2 A;  1G1L A;  3TQD A;  2FGF A;  3HSM A;  5C4F A;  3RSB A;  4CJC A;  2IHO A;  4D8H A;  1W3A A;  2ZU7 A;  2YES A;  4Y7V A;  2Y4K A;  4P6A A;  2I5E A;  2OEF A;  4KPX A;  1FV3 A;  3HBW A;  3LTQ A;  1TVY A;  5CQN X;  5CQO A;  2VSH A;  3H6S E;  1BAR A;  2NP0 A;  2XWM A;  2RJ0 A;  1ZDF A;  2ZU8 A;  4KPZ A;  1ITB A;  4IHZ A;  5EIY A;  3MAL A;  3QYD A;  4G9M A;  1H4D A;  1RZO B;  1QGS A;  2AES A;  1MC3 A;  4L41 C;  1IJT A;  1F31 A;  4LO1 A;  4AC3 A;  5E24 E;  5C3D A;  2AE7 A;  2ZQO A;  2BO8 A;  1TW5 A;  1BFB A;  4EFP A;  4JAW A;  4I1E A;  4B2W A;  4Q7C A;  2KLL A;  2Q3N B;  4ISR A;  3PME A;  3BAU A;  3A07 A;  3BA7 A;  2PX7 A;  4BMA A;  4LO1 C;  3WO3 A;  5BXS A;  4KC2 A;  1ISY A;  1JYK A;  2P6W A;  4Y6U A;  3TZT A;  4D0T A;  3U2V A;  2FFU A;  1G8O A;  4EE4 A;  4EEG A;  1ISZ A;  5G00 A;  1PZY B;  1HIB A;  3T7M A;  2E4M A;  4ZKT B;  1FGA A;  2ZQN A;  1R81 A;  2HWM A;  3PNN A;  1HWO B;  5D63 A;  1Z4S A;  3OGF A;  1DJS B;  2J3P A;  4IQP A;  1IOB A;  4J23 B;  5BXT A;  2RIX A;  3V8Y A;  2ESU A;  3E26 A;  1NHE B;  1VGU A;  1INJ A;  1ILR 1;  3VT0 A;  4EEE B;  1G0R A;  5DSS B;  1NWG B;  2RST A;  8I1B A;  5JMC A;  1FMZ A;  3K8E A;  1K5U A;  1BAS A;  1Z90 A;  3N7M A;  1J0S A;  3N7J A;  3FJA A;  1ZDG A;  1MD6 A;  2JCK A;  2BEA A;  4ION A;  1WT1 A;  3BAG A;  5DVH A;  1M16 A;  3VUO A;  4JP0 A;  1LVW A;  1L2H A;  2D22 A;  3DK5 A;  5BP5 A;  5BVP I;  3RMV A;  5EC5 A;  1WD3 A;  5BXR A;  1VZU A;  1VH1 A;  2RIY A;  3ST8 A;  3NBN A;  3BAQ A;  4YS8 A;  3OKR A;  4NAN A;  5C4B A;  1JT3 A;  1H5R A;  2YCM A;  3CA6 A;  3PKP A;  3OBR A;  5BP5 C;  4Y7T A;  2WE9 A;  1R7V A;  3CA0 A;  4LW3 A;  3FJI A;  3SX5 A;  1H7G A;  2V0J A;  3GUE A;  4Y62 A;  4DEP A;  1H5R B;  2E3D A;  3ZX7 A;  3AH4 A;  1WT2 A;  2RJ6 A;  4JKX B;  5HPZ A;  2P72 A;  3HMY A;  3D7W B;  1YBI A;  2WEE A;  3U2U A;  4EFR A;  1ISV A;  3O4B A;  3D5N A;  3I0D A;  1BLA A;  4KT7 A;  3KMV A;  5C4E A;  3VSF A;  1AXM A;  4QC4 A;  3OC9 A;  2K8R A;  3AKG A;  3R4S A;  3I0E A;  1E5K A;  1Z2V A;  3V0B A;  4G1R A;  1ZHJ A;  3FJE A;  1JQZ A;  1FOA A;  3FGM A;  3BRF A;  4XWI A;  3VEQ A;  4R6U B;  1EZI A;  1BFC A;  3D8V A;  3I2A A;  1NF5 B;  1VZT A;  3HL3 A;  3CRG A;  3ZC8 A;  3V0B B;  3CA1 A;  3R3I A;  1R7Y A;  4FGF A;  3R4U A;  2X2T A;  2WGZ A;  5CMF X;  3P53 A;  3AJ6 A;  2D7I A;  3FJ8 A;  1ZJ0 A;  2NS2 A;  4I4P A;  1ON6 A;  3FJD A;  5IDT A;  2KI6 B;  1FXO A;  4GAI A;  4I6I A;  3OH3 A;  4IZE A;  1JV3 A;  1TFM B;  1HKN A;  1FGG A;  1JLX A;  5I1B A;  2BEB A;  1IHK A;  4X39 A;  1LL0 A;  4QD2 B;  2VS5 A;  4M28 A;  4Y7U A;  5F90 A;  1V6V A;  1GX0 A;  4QD2 C;  3VWC A;  3UD8 A;  3CGX A;  5F8Y A;  1WT3 A;  1JT5 A;  3SX3 A;  1YP2 A;  2D1Z A;  4KBB A;  3IOH A;  3I0K A;  3BRK X;  4TLP A;  3HN1 A;  4EE5 A;  3W9T A;  3RTJ B;  2AAI B;  2FO1 A;  1PUU B;  2VSE A;  1H4C A;  3I0G A;  5FV9 A;  3NBD A;  2VS3 A;  1LZ7 A;  4USP A;  4HO0 A;  5I1F A;  3CRH A;  3FWW A;  4FCE A;  3NBE A;  1LZI A;  3IOJ A;  3C9Z A;  4QBV A;  1GX4 A;  5J49 A;  4I2S A;  3IIR A;  1TWM A;  3ZLK A;  3PHZ A;  3Q7X A;  3UD7 A;  2GGQ A;  3SXA A;  4USO A;  2A8U A;  2Y4M A;  5D91 A;  1ZJO A;  4I4X A;  1GQ9 A;  2XME A;  1AVW B;  2QH5 A;  2L5X A;  3A21 A;  3BRG C;  2YUG A;  1GA8 A;  4M2B A;  3I0I X;  2QN4 A;  1EYL A;  5C4D A;  2VK9 A;  2RG9 B;  2OI7 A;  4I1B A;  2GZB A;  1QQK A;  1TZF A;  3IAG C;  1FXJ A;  2WRY A;  1UPS A;  1G97 A;  4KNR A;  1IT0 A;  2I5K A;  1WSZ A;  5DZU A;  4I4O A;  4XFS A;  3ZXG A;  1O7Q A;  3LW6 A;  1I52 A;  1TTU A;  1HWP B;  4I4U A;  3WMV A;  4IYB A;  4G3P A;  2BO4 A;  5IDS A;  4QO3 A;  3Q7Y A;  2GGO A;  4ZOT A;  3SXD A;  1H5S B;  3MPP G;  2P73 A;  1DIW A;  3QVB A;  2ZR1 B;  1ZJP A;  1OMZ A;  3BB2 A;  2Y9W C;  4HR6 C;  4Y63 A;  5CMG X;  1H7T A;  2APC A;  3V0M A;  3BRD A;  5HS2 A;  1ZI4 A;  2BO6 A;  1WD4 A;  1G9A A;  2D23 A;  2ICX A;  1XYF A;  3V0A A;  4FRB A;  5CMI A;  5AJP A;  4G3Q A;  1K4V A;  3ZXD A;  3OJM A;  1EYR A;  4I7I A;  4EE3 A;  1VIC A;  4D11 A;  1H4E A;  1KNM A;  4FRH A;  2DRY A;  3V0A B;  1MC9 A;  3CU1 B;  3Q4S A;  1ONK B;  3CA3 A;  1R82 A;  5C47 A;  2JCO A;  5JQQ A;  3I2X A;  5BXP A;  2OI5 A;  3OBT A;  4D11 C;  1G9B A;  4D48 A;  4H9W A;  2VU9 A;  3BAO A;  1KWS A;  2Z48 A;  4FCU A;  1HJL A;  4ISQ A;  3FJB A;  1DZD A;  5FZZ A;  1VPA A;  3RMW A;  1S0B A;  1HM8 A;  3O4C A;  2AXM A;  5FZY A;  4Y9X A;  3V0Q A;  3AZW A;  5CMJ A;  2VLC A;  4FQW A;  5AJO A;  4DE7 A;  4DEN A;  1XG6 A;  3FUO A;  2NVH A;  3BAD A;  4F34 A;  1ZIZ A;  2AM5 A;  2RIZ A;  2FYD B;  5C36 A;  4HG6 A;  4MYB A;  2E4M C;  4J2X A;  1QQL A;  4FVV A;  4I96 A;  3P6J A;  2GO2 A;  5JLV A;  1Q1U A;  3F62 B;  4QKS A;  4I3N A;  3T7N A;  1H7Q A;  4X37 A; 
#chains in the Genus database with same CATH homology
 3FJ9 A;  4I4S A;  4EKX B;  4HO8 A;  4E1K A;  4J2S A;  4MZF B;  1FRW A;  3SXC A;  4GP3 A;  3POL A;  3FJK A;  3SNV A;  4B3U A;  4I4V A;  5CMH A;  3FFZ A;  3IM5 A;  1FWV A;  1PWA A;  3F1R A;  1AVA C;  4H04 A;  2WVL A;  2X60 A;  4HO3 A;  4B4M A;  1BFF A;  3IOI A;  3JRR A;  1FGX A;  1TP0 A;  2RIT A;  2AQZ A;  3BAH A;  3USQ A;  4IRQ A;  1TWE A;  2RQ9 A;  5C1G A;  3RSJ A;  1QWJ A;  7I1B A;  3I0C A;  2X2S A;  4PC4 A;  1K5V A;  2XOA A;  4II0 A;  2KI4 A;  5EG6 C;  3CKN A;  3SPT A;  2W0V A;  2QGI A;  2YQJ A;  3F1Y A;  3U0Y A;  1H7H A;  3O4A A;  3FJF A;  3KIA A;  1S0L A;  2D20 A;  2I1B A;  4Y7G A;  2Y4J A;  1V6U A;  4HA2 A;  5FNW A;  1JLY A;  2Q9X A;  1LZ0 A;  1QXM A;  2XWL A;  1OQL B;  4HO4 A;  4EFQ A;  3K8D A;  4B42 A;  1WT0 A;  1BA7 A;  2VUA A;  4LO8 B;  6I1B A;  1AVU A;  1JY0 A;  3P6I A;  4ECM A;  1YF8 B;  2YC5 A;  2OI6 A;  4G3S A;  1HWN B;  5CQL X;  3ZGF A;  4ZDQ A;  1O0R A;  4H75 A;  2E8B A;  3VSZ A;  2HZ9 A;  2ICY A;  1H7L A;  2FYB A;  3VT1 A;  2VXL A;  2RJ8 A;  5BXC A;  1Q03 A;  1QG8 A;  2YQS A;  4ZLB B;  1S4N A;  1V6W A;  1FWU A;  2RJ9 A;  4J18 A;  5EJ1 A;  1HCE A;  4KEI A;  1II4 A;  4FIY A;  3UJ0 A;  5IFY A;  3FJH A;  3ZF8 A;  1G82 A;  3V79 C;  1V84 A;  1CE7 B;  3OH0 A;  4GP0 A;  1FZW A;  1VH3 A;  1RML A;  3WIN A;  2F8X C;  2X5Z A;  4Q9P A;  4ZFU B;  3UJ4 A;  1LZJ A;  2MLL B;  1WVC A;  4WBC A;  4JRA A;  5BQU A;  3AKF A;  3E25 A;  4P0L A;  5FNX A;  3OGZ A;  1GQC A;  2MIB A;  2WAW A;  1G95 A;  2JCL A;  1HM9 A;  4MZG B;  1HV9 A;  3CKQ A;  4I4Q A;  2D24 A;  3WIN C;  4KC4 A;  3CQA A;  4KC3 A;  1ZI3 A;  1LL3 A;  5BQU C;  5FTS A;  4O6N A;  1NUN A;  1FO8 A;  1AF9 A;  5C1H A;  4LO3 A;  1FQ9 A;  4A7Z A;  3BCV A;  1WBC A;  3IM7 A;  3NGW A;  3Q7W A;  1IRP A;  3PG0 A;  4F83 A;  3Q7U A;  2D43 A;  3EF2 A;  5C1L A;  1SR4 A;  2DRZ A;  4END A;  4HCQ A;  3U0X A;  4GBP A;  4LO3 C;  4X38 A;  4XFT A;  3WMU A;  2PA4 A;  2V0K A;  2XWN A;  3ZLL A;  4QKR A;  4Y64 A;  3UDA A;  2W0W A;  2RJ1 A;  2X65 A;  2PGV A;  1ZJ1 A;  1SR4 C;  2KKI A;  2VSI A;  4M2A A;  1OQM B;  1CVS A;  2C0N A;  3V8Z A;  1SZ6 B;  1ISW A;  5FYE A;  3DJ4 A;  1G3L A;  3N7L A;  1V83 A;  4EEO A;  2VS4 A;  3I29 B;  1IIL A;  4FRD A;  3JUJ A;  3U2W A;  1R7T A;  3AKH A;  2AM4 A;  3QR5 A;  3V0P A;  4ASJ A;  3O49 A;  4KNX A;  1INI A;  3ZGG A;  41BI A;  4P02 A;  1JVG A;  2I7B A;  4KQL A;  4Z9W B;  1DQO A;  4C2S A;  1IIM A;  4I0Y A;  1XZZ A;  1H3M A;  3DUV A;  4HOC A;  4P0J A;  5C4C A;  5C49 A;  3O4D A;  4JQ0 A;  4OUJ A;  2DS0 A;  1H5S A;  2JCJ A;  2LIQ A;  2CU2 A;  2O1G A;  3WO4 A;  3EE5 A;  3POK A;  3I0H A;  1V6X A;  2MZB A;  4BQH A;  3BA4 A;  3SXG A;  3AH2 A;  3OH2 A;  4O6M A;  1SS9 A;  1EV2 A;  2MC2 A;  5DDV A;  5FTV A;  1H5S C;  2D44 A;  2Z87 A;  3TC2 A;  4Q9G A;  1G2V A;  3V90 A;  1R80 A;  3D98 A;  4QAL A;  1S0D A;  4FRQ A;  3K1X A;  4FRP A;  1VGZ A;  3OGG A;  3OJV A;  4HJJ A;  2VXT I;  1FR9 A;  2M49 A;  4G6J A;  1ZCU A;  4OWK A;  4GOV A;  3ILA A;  3Q80 A;  2ZU9 A;  4FIX A;  4CVH A;  5CQP A;  1W77 A;  1DLL A;  3CKJ A;  3AKI A;  2FYA A;  3SX7 A;  2AFG A;  4CJ8 A;  5L6S A;  1I1B A;  3O3Q A;  1R7X A;  3A22 A;  4NAL A;  3U2T A;  1S0C A;  1ZI5 A;  2FFV A;  1ZI1 A;  4FRO A;  3N0K A;  1DZC A;  1IRA X;  2HW9 A;  5D61 A;  2FYC B;  1D0H A;  5C3B A;  1JTC A;  1S0F A;  3RTI B;  1PUM B;  3V0O A;  1MP3 A;  5DUY A;  2UX8 A;  2VSA A;  3OH1 A;  3NBC A;  4NAK A;  3UD9 A;  1JVD A;  4IY8 A;  1NMM B;  2J0B A;  1ZCT A;  5FUH A;  1GWW A;  1T4Q A;  3O4O A;  3USR A;  4OWJ A;  1EVT A;  1E0O A;  4L4H A;  3FUQ A;  1DFC A;  1YP4 A;  1ZJ3 A;  4X3A A;  3JUK A;  1PZZ A;  4ZGR B;  5GAQ A;  5EHA A;  5CQM X;  4IRP A;  2AGD A;  2WVK A;  3CRI A;  3WA1 A;  3VT2 A;  1R8N A;  4D0Z A;  2R9K B;  1BLD A;  4G6M A;  1HJJ A;  4AN7 B;  3I0J A;  4QBC A;  1IIN A;  4CJM A;  1FG5 N;  2Y9F A;  1LL2 A;  5C38 A;  1I1E A;  4KC1 A;  1R7U A;  1O23 B;  4EVW A;  1YXW A;  2Y4L A;  4JIS A;  4EB2 B;  3S8J A;  1ON8 A;  4Y7F A;  1VCL A;  4I37 A;  4XKI A;  3S8K A;  1GWV A;  2V0H A;  4MIX A;  2AM3 A;  4MZH A;  4P0K A;  2DRE A;  1WBA A;  4JD0 A;  4AYL A;  1VGW A;  2Y6P A;  5C8R A;  3E8L C;  4OEE A;  1FMM S;  3BAV A;  4HO9 A;  3BA5 A;  4L4I A;  1H5S D;  2VFZ A;  1V82 A;  2IWT B;  4ZBV B;  4MND A;  2LIE A;  2O1H A;  3T7O A;  5BOW A;  3CA5 A;  4FRL A;  4HO6 A;  1VM8 A;  4AYJ A;  4I8M A;  4LO0 A;  1FR8 A;  2WVM A;  5FU0 A;  1RY7 A;  2NTD A;  2OEG A;  4A7K A;  2QKX A;  1Z0H A;  3SXE A;  4ASY A;  1TOO A;  1DQG A;  2D7R A;  3H6R A;  3HOM A;  1FN0 A;  3RMX A;  1NQI B;  1W57 A;  3LLP A;  2RJ7 A;  2YQC A;  5FU8 A;  1S4P A;  1ABR B;  21BI A;  4LO0 C;  2FY7 A;  4GOY A;  4UY4 A;  4AN6 A;  5C48 A;  1Q04 A;  1FWY A;  4FRA A;  1O7O A;  1DFQ A;  3H6R B;  31BI A;  1R8O A;  2K43 A;  4ZA3 B;  3T8S A;  5FZU A;  3ZC9 A;  1MP5 A;  4KEK A;  2O1F A;  3BTA A;  3I0F A;  1YP3 A;  3F1C A;  4CJB A;  1HWM B;  3O3P A;  3V91 A;  2AEC A;  1YRO B;  1M2T B;  2AH9 A;  2DPW A;  2YC3 A;  3BX1 C;  2UUS A;  1BFG A;  2D0J A;  4A7Y A;  1T9F A;  1JYL A;  1ZCY A;  4B4B A;  5L6V A;  1JT7 A;  4OEF A;  2P39 A;  1A8D A;  4Z8S B;  1H5T A;  1ZCV A;  2Y7A A;  4DDZ A;  4KEJ A;  4HO2 A;  1HM0 A;  5DDT A;  3N9W A;  3JTJ A;  4EEM A;  2RJ5 A;  4B4G A;  4LO7 B;  1H5T B;  4B2X A;  4LO7 C;  4JKQ A;  1NZK A;  1TW1 A;  3CU0 A;  4GAF A;  4I4Y A;  3O5W B;  2ERM A;  4J2Y A;  1G23 A;  4ARW A;  4ZFY B;  2P23 A;  3CAH A;  2X5S A;  2NYY A;  5D62 A;  1ZJ2 A;  2Q4J A;  3PKQ A;  3N7K A;  1VZX A;  4UEG A;  2VD4 A;  2RJ4 A;  3OAM A;  5F8S A;  5C3A A;  4EEA A;  1FO9 A;  4I4R A;  3IM6 A;  1VGT A;  2F2F A;  1PZT A;  3RMY A;  4LO2 A;  1P63 A;  4K6R A;  2VXM A;  1ISX A;  4YOL A;  2BO7 A;  4P00 A;  3FJC A;  1XZ6 A;  1XHB A;  1W55 A;  2PGY A;  1G9C A;  1W3F A;  4G87 A;  4NAI A;  2K4A B;  4ZFW B;  1GGP B;  2F2F C;  3V0N A;  1H7E A;  3HAL A;  4LO2 C;  2Y9G A;  1AVX B;  2VXR A;  4IY9 A;  4DEC A;  4LW6 A;  4JPZ A;  1YYN A;  1H7F A;  2QYI B;  2Y9X E;  5D92 A;  3U2X A;  1TIE A;  1AFC A;  3R2W A;  5AJN A;  3CKV A;  1G9D A;  2NXV A;  1S0E A;  1HCD A;  3AZV A;  4R7P A;  4FRM A;  2NZ9 A;  3A23 A;  3V0L A;  3PUB A;  4OEG A;  3OH4 A;  4FRE A;  3FJJ A;  1FV2 A;  2KH2 A;  1JV1 A;  5F8W A;  3I0L A;  1JT4 A;  4AAW A;  4M4K A;  4Y6N A;  2A8W A;  3H6Q A;  1G93 A;  1OMX A;  3B9U A;  3JUT A;  1NKH B;  1G9R A;  5B2H A;  3O44 A;  3SX8 A;  1S0G A;  3NJ5 A;  2J0A A;  2Z86 A;  4XFU A;  3CKO A;  9ILB A;  3SXB A;  2FDB M;  4B5B A;  2NM1 A;  1W3G A;  3WO2 A;  2BFH A;  5EJZ A;  4Q91 A;  2Z49 A;  3AH1 A;  2WBC A;  4IZX A;  2ET2 A;  3AJ5 A;  2HWA A;  4OWL A;  4OW4 A;  4DCK C;  4KXO A;  4KRV A;  1N4K A;  1PC8 B;  1RG8 A;  1EPW A;  1MP4 A;  2V0L A;  3CA4 A;  4G9N A;  1S4O A;  2V0I A;  2YQH A;  4J2K A;  3FOQ A;  4HO5 A;  1QGQ A;  1YTO A;  2XMH A;  3OJ2 A;  1G1L A;  3TQD A;  2FGF A;  3HSM A;  5C4F A;  3RSB A;  4CJC A;  2IHO A;  4D8H A;  1W3A A;  2ZU7 A;  2YES A;  4Y7V A;  2Y4K A;  4P6A A;  2I5E A;  2OEF A;  4KPX A;  1FV3 A;  3HBW A;  3LTQ A;  1TVY A;  5CQN X;  5CQO A;  2VSH A;  3H6S E;  1BAR A;  2NP0 A;  2XWM A;  2RJ0 A;  1ZDF A;  2ZU8 A;  4KPZ A;  1ITB A;  4IHZ A;  5EIY A;  3MAL A;  3QYD A;  4G9M A;  1H4D A;  1RZO B;  1QGS A;  2AES A;  1MC3 A;  4L41 C;  1IJT A;  1F31 A;  4LO1 A;  4AC3 A;  5E24 E;  5C3D A;  2AE7 A;  2ZQO A;  2BO8 A;  1TW5 A;  1BFB A;  4EFP A;  4JAW A;  4I1E A;  4B2W A;  4Q7C A;  2KLL A;  2Q3N B;  4ISR A;  3PME A;  3BAU A;  3A07 A;  3BA7 A;  2PX7 A;  4BMA A;  4LO1 C;  3WO3 A;  5BXS A;  4KC2 A;  1ISY A;  1JYK A;  2P6W A;  4Y6U A;  3TZT A;  4D0T A;  3U2V A;  2FFU A;  1G8O A;  4EE4 A;  4EEG A;  1ISZ A;  5G00 A;  1PZY B;  1HIB A;  3T7M A;  2E4M A;  4ZKT B;  1FGA A;  2ZQN A;  1R81 A;  2HWM A;  3PNN A;  1HWO B;  5D63 A;  1Z4S A;  3OGF A;  1DJS B;  2J3P A;  4IQP A;  1IOB A;  4J23 B;  5BXT A;  2RIX A;  3V8Y A;  2ESU A;  3E26 A;  1NHE B;  1VGU A;  1INJ A;  1ILR 1;  3VT0 A;  4EEE B;  1G0R A;  5DSS B;  1NWG B;  2RST A;  8I1B A;  5JMC A;  1FMZ A;  3K8E A;  1K5U A;  1BAS A;  1Z90 A;  3N7M A;  1J0S A;  3N7J A;  3FJA A;  1ZDG A;  1MD6 A;  2JCK A;  2BEA A;  4ION A;  1WT1 A;  3BAG A;  5DVH A;  1M16 A;  3VUO A;  4JP0 A;  1LVW A;  1L2H A;  2D22 A;  3DK5 A;  5BP5 A;  5BVP I;  3RMV A;  5EC5 A;  1WD3 A;  5BXR A;  1VZU A;  1VH1 A;  2RIY A;  3ST8 A;  3NBN A;  3BAQ A;  4YS8 A;  3OKR A;  4NAN A;  5C4B A;  1JT3 A;  1H5R A;  2YCM A;  3CA6 A;  3PKP A;  3OBR A;  5BP5 C;  4Y7T A;  2WE9 A;  1R7V A;  3CA0 A;  4LW3 A;  3FJI A;  3SX5 A;  1H7G A;  2V0J A;  3GUE A;  4Y62 A;  4DEP A;  1H5R B;  2E3D A;  3ZX7 A;  3AH4 A;  1WT2 A;  2RJ6 A;  4JKX B;  5HPZ A;  2P72 A;  3HMY A;  3D7W B;  1YBI A;  2WEE A;  3U2U A;  4EFR A;  1ISV A;  3O4B A;  3D5N A;  3I0D A;  1BLA A;  4KT7 A;  3KMV A;  5C4E A;  3VSF A;  1AXM A;  4QC4 A;  3OC9 A;  2K8R A;  3AKG A;  3R4S A;  3I0E A;  1E5K A;  1Z2V A;  3V0B A;  4G1R A;  1ZHJ A;  3FJE A;  1JQZ A;  1FOA A;  3FGM A;  3BRF A;  4XWI A;  3VEQ A;  4R6U B;  1EZI A;  1BFC A;  3D8V A;  3I2A A;  1NF5 B;  1VZT A;  3HL3 A;  3CRG A;  3ZC8 A;  3V0B B;  3CA1 A;  3R3I A;  1R7Y A;  4FGF A;  3R4U A;  2X2T A;  2WGZ A;  5CMF X;  3P53 A;  3AJ6 A;  2D7I A;  3FJ8 A;  1ZJ0 A;  2NS2 A;  4I4P A;  1ON6 A;  3FJD A;  5IDT A;  2KI6 B;  1FXO A;  4GAI A;  4I6I A;  3OH3 A;  4IZE A;  1JV3 A;  1TFM B;  1HKN A;  1FGG A;  1JLX A;  5I1B A;  2BEB A;  1IHK A;  4X39 A;  1LL0 A;  4QD2 B;  2VS5 A;  4M28 A;  4Y7U A;  5F90 A;  1V6V A;  1GX0 A;  4QD2 C;  3VWC A;  3UD8 A;  3CGX A;  5F8Y A;  1WT3 A;  1JT5 A;  3SX3 A;  1YP2 A;  2D1Z A;  4KBB A;  3IOH A;  3I0K A;  3BRK X;  4TLP A;  3HN1 A;  4EE5 A;  3W9T A;  3RTJ B;  2AAI B;  2FO1 A;  1PUU B;  2VSE A;  1H4C A;  3I0G A;  5FV9 A;  3NBD A;  2VS3 A;  1LZ7 A;  4USP A;  4HO0 A;  5I1F A;  3CRH A;  3FWW A;  4FCE A;  3NBE A;  1LZI A;  3IOJ A;  3C9Z A;  4QBV A;  1GX4 A;  5J49 A;  4I2S A;  3IIR A;  1TWM A;  3ZLK A;  3PHZ A;  3Q7X A;  3UD7 A;  2GGQ A;  3SXA A;  4USO A;  2A8U A;  2Y4M A;  5D91 A;  1ZJO A;  4I4X A;  1GQ9 A;  2XME A;  1AVW B;  2QH5 A;  2L5X A;  3A21 A;  3BRG C;  2YUG A;  1GA8 A;  4M2B A;  3I0I X;  2QN4 A;  1EYL A;  5C4D A;  2VK9 A;  2RG9 B;  2OI7 A;  4I1B A;  2GZB A;  1QQK A;  1TZF A;  3IAG C;  1FXJ A;  2WRY A;  1UPS A;  1G97 A;  4KNR A;  1IT0 A;  2I5K A;  1WSZ A;  5DZU A;  4I4O A;  4XFS A;  3ZXG A;  1O7Q A;  3LW6 A;  1I52 A;  1TTU A;  1HWP B;  4I4U A;  3WMV A;  4IYB A;  4G3P A;  2BO4 A;  5IDS A;  4QO3 A;  3Q7Y A;  2GGO A;  4ZOT A;  3SXD A;  1H5S B;  3MPP G;  2P73 A;  1DIW A;  3QVB A;  2ZR1 B;  1ZJP A;  1OMZ A;  3BB2 A;  2Y9W C;  4HR6 C;  4Y63 A;  5CMG X;  1H7T A;  2APC A;  3V0M A;  3BRD A;  5HS2 A;  1ZI4 A;  2BO6 A;  1WD4 A;  1G9A A;  2D23 A;  2ICX A;  1XYF A;  3V0A A;  4FRB A;  5CMI A;  5AJP A;  4G3Q A;  1K4V A;  3ZXD A;  3OJM A;  1EYR A;  4I7I A;  4EE3 A;  1VIC A;  4D11 A;  1H4E A;  1KNM A;  4FRH A;  2DRY A;  3V0A B;  1MC9 A;  3CU1 B;  3Q4S A;  1ONK B;  3CA3 A;  1R82 A;  5C47 A;  2JCO A;  5JQQ A;  3I2X A;  5BXP A;  2OI5 A;  3OBT A;  4D11 C;  1G9B A;  4D48 A;  4H9W A;  2VU9 A;  3BAO A;  1KWS A;  2Z48 A;  4FCU A;  1HJL A;  4ISQ A;  3FJB A;  1DZD A;  5FZZ A;  1VPA A;  3RMW A;  1S0B A;  1HM8 A;  3O4C A;  2AXM A;  5FZY A;  4Y9X A;  3V0Q A;  3AZW A;  5CMJ A;  2VLC A;  4FQW A;  5AJO A;  4DE7 A;  4DEN A;  1XG6 A;  3FUO A;  2NVH A;  3BAD A;  4F34 A;  1ZIZ A;  2AM5 A;  2RIZ A;  2FYD B;  5C36 A;  4HG6 A;  4MYB A;  2E4M C;  4J2X A;  1QQL A;  4FVV A;  4I96 A;  3P6J A;  2GO2 A;  5JLV A;  1Q1U A;  3F62 B;  4QKS A;  4I3N A;  3T7N A;  1H7Q A;  4X37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...