2D7RA

Crystal structure of pp-galnac-t10 complexed with galnac-ser on lectin domain
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
536
structure length
536
Chain Sequence
GQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Polypeptide N-acetylgalactosaminyltransferase 10
publication title Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
pubmed doi rcsb
source organism Homo sapiens
total genus 155
structure length 536
sequence length 536
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2d7rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2d7rA01
3USRA 3RTJB 1V6WA 1VGTA 4IY8A 4EEGA 4XFTA 4AYLA 1Q04A 2Z48A 5E24E 3Q4SA 1AVAC 1VH1A 1VCLA 4ECMA 1PZYB 1ISXA 2K8RA 4Q9PA 5EC5A 3HMYA 1LZ0A 2O1HA 1NZKA 1H4DA 4HO8A 2M49A 1H7QA 2PA4A 2P72A 3WINC 4HO0A 2IHOA 1ABRB 2X60A 1AVXB 1TIEA 5C47A 1FXOA 4HO3A 5C36A 3FFZA 3FJHA 1INJA 2PGYA 2YQHA 3FOQA 5EJZA 1BFBA 4KEJA 1O0RA 1DJSB 2LIQA 2NP0A 2I5EA 1ZCUA 3QYDA 4Y7UA 4BQHA 4H04A 2E4MC 1YP4A 3ZXDA 4KQLA 2F8XC 5EG6C 1G9AA 3FJ9A 1JLYA 2Q3NB 3CA5A 4I7IA 1WT0A 1ZI5A 2E3DA 5JQQA 2DRYA 1H5RB 1W3AA 3R4SA 2QKXA 4UEGA 4DCKC 4FGFA 4I4YA 1ONKB 3WMUA 1H5SC 3PG0A 1HCEA 5CQOA 2Y9GA 2UUSA 1JT3A 1H7LA 3CU1B 1NHEB 1R81A 2RJ5A 3CRHA 3OH1A 4QALA 1IIMA 2V0JA 1K5UA 1TFMB 1PWAA 1DFCA 2YUGA 3PMEA 2BEAA 3AKFA 4GP3A 4USPA 1SZ6B 2WBCA 4D8HA 1G1LA 1GA8A 1SS9A 3Q7XA 1YXWA 2RSTA 3FUOA 1RZOB 5DZUA 2O1GA 2FFVA 3BRDA 4KPZA 3IIRA 2KI6B 1HJLA 5C4EA 2Y7AA 1G95A 4CVHA 1MD6A 1QXMA 1R82A 1R8NA 4LO2A 1G23A 2F2FC 1QGSA 4JD0A 5FTVA 1JY0A 4QC4A 2QGIA 3SX5A 3HOMA 4ZKTB 4FRPA 3FJBA 2FFUA 3OBRA 1S0BA 4QBCA 1HWMB 2WRYA 1H5RA 1H4CA 1H4EA 4IONA 4OWKA 2X5ZA 3CKJA 4M4KA 5C4FA 5EIYA 4FREA 4KC3A 3D7WB 4ZOTA 1TOOA 1PZTA 4G3SA 4B3UA 3AKGA 5FNXA 4DEPA 2FYBA 4OW4A 4XKIA 1G9BA 3HL3A 5CQNX 4HR6C 4OWLA 2AECA 2K4AB 1H7TA 4CJ8A 3FJCA 1YP2A 3NJ5A 3Q7UA 5DDTA 4D11C 5BQUA 3K8EA 3PHZA 4IZEA 1JT4A 4LO8B 1V6VA 4I4UA 2RIZA 2JCLA 2D7IA 3FWWA 3WO3A 2HWAA 1FO9A 4I4SA 2WEEA 4ISRA 5FU0A 4FRAA 2ZR1B 4FQWA 4I1EA 4GOVA 4ZFWB 1ZJPA 5C4BA 3BB2A 3IM5A 3OJVA 4ZDQA 3SX8A 1XZZA 5L6SA 1ZDFA 2RITA 3KIAA 3SPTA 2I1BA 3LLPA 1G93A 3TQDA 3AH4A 3T8SA 3SXBA 3ZGFA 3SXAA 1V6UA 1AF9A 2VLCA 3CRGA 1GX0A 2ICXA 2YCMA 4Z9WB 4G1RA 2BFHA 2JCOA 1VZXA 2NM1A 1DZCA 5BOWA 4Y7VA 5FU8A 1GWVA 1MP3A 5EHAA 4ISQA 1R7YA 4FRQA 4XFUA 2VU9A 2KKIA 5IFYA 2D23A 3V0AB 1VICA 5JLVA 4IHZA 4B4BA 4OWJA 1XZ6A 5C49A 1G9DA 1GQ9A 1FWVA 4ASYA 2XWNA 3POKA 2ESUA 5DUYA 1V83A 3SXGA 1ISZA 3V8YA 1BA7A 5C1LA 4PC4A 2GGQA 5FV9A 3OJ2A 3CAHA 1WD4A 2AFGA 1FO8A 5BXSA 3BAUA 3I0IX 2DREA 5BXRA 3D5NA 2YQCA 3FJ8A 1BFFA 3BA4A 3HBWA 5D61A 31BIA 3AZVA 3HSMA 3O5WB 2AGDA 1RMLA 3N0KA 1MC9A 2E8BA 7I1BA 4P0JA 2Y4JA 3OKRA 3OH2A 4KC4A 1H7EA 1BFCA 4B4MA 3T7MA 3POLA 4KNRA 3V0QA 1RY7A 2X2SA 1FG5N 1ISYA 4FVVA 5AJPA 2DPWA 2ZU8A 4P00A 3BAHA 4D0ZA 1ISVA 4GOYA 1TW5A 1H5SB 3U2UA 2RIYA 3F1YA 1S0GA 3FJDA 3TC2A 2NYYA 5D63A 4I0YA 4J2YA 1R7TA 2QYIB 5BXPA 2RJ8A 3MALA 3UDAA 5BP5C 1VGUA 2WVMA 5CMIA 5DSSB 4KEKA 3UD7A 1ZIZA 4Y9XA 1GWWA 3U2VA 3V0PA 4CJMA 1T9FA 5CMJA 3I0LA 1S0DA 1KWSA 5BXCA 1VGWA 1A8DA 1S0CA 1ZI1A 1H3MA 2OEGA 2YC3A 2WAWA 3AJ6A 3MPPG 4F83A 4YS8A 3ZC8A 2L5XA 4ENDA 2FYDB 2P73A 1VM8A 2BO8A 2OI5A 3EE5A 1L2HA 3Q7YA 4LO1C 3I0FA 4DDZA 3U0XA 3R4UA 4EFRA 3I0EA 4A7ZA 3A07A 2FYAA 4ASJA 4E1KA 3BADA 5IDTA 1FMZA 1UPSA 5G00A 4G3QA 3WO4A 4BMAA 4KEIA 3BTAA 1IRAX 1TTUA 5C1GA 5J49A 1YP3A 1FGGA 1JT7A 4DENA 2QN4A 21BIA 3IAGC 1JV3A 2V0KA 3CKNA 4Y64A 3V0OA 2Y4LA 1EPWA 4X38A 1GQCA 1LVWA 1LZIA 2RJ7A 4JRAA 2W0VA 3CGXA 3RMVA 3V0NA 4I4PA 1JYLA 4LO3C 1FWYA 4G87A 3CA3A 4KT7A 4JISA 4QKRA 1I52A 3ZLLA 1LL2A 1N4KA 4ZGRB 2MLLB 2VFZA 4FCEA 3V91A 1DQOA 2FY7A 3P6JA 2ZU7A 2VSEA 4NAIA 4KRVA 3ILAA 4HO2A 2J3PA 2OI7A 1G82A 1O23B 3CA1A 4C2SA 1GX4A 2DS0A 4J18A 1WBCA 1P63A 3FJFA 4KBBA 3AKIA 2VUAA 4Q9GA 1OMZA 4HG6A 3I0GA 3H6SE 2OI6A 3RMXA 2AM3A 4JPZA 3VSFA 3BRFA 4ZFUB 3I2AA 1W55A 1JQZA 1JTCA 4II0A 2Y6PA 4AN7B 4Y7TA 2WE9A 3SNVA 4B4GA 3R2WA 4IRQA 3I2XA 3QR5A 1ZDGA 4Y6UA 5FYEA 1JLXA 2BO6A 4I37A 2MIBA 5FZUA 1TW1A 2XWLA 3AKHA 1HM0A 1LL0A 1TP0A 2GGOA 5F90A 1HKNA 3RMYA 4WBCA 2YESA 1S0FA 3D8VA 3OH0A 3U2WA 5HPZA 4G9MA 4OEGA 2QH5A 4IZXA 1ON8A 3BAGA 3K1XA 5C3AA 4Q91A 5C1HA 3DK5A 1LZ7A 3V0BB 2BO7A 1G2VA 2XMHA 4B2XA 1TVYA 1ZJ3A 5FZYA 2Y9XE 3F1RA 4HA2A 3WO2A 4I4QA 4EVWA 3AJ5A 4DE7A 1OMXA 4ZBVB 5HS2A 3BAQA 4TLPA 4X39A 1DQGA 2HW9A 4L4IA 2V0LA 4EEAA 3ZLKA 1II4A 1O7QA 3GUEA 3FJIA 3H6QA 4R7PA 1ILR1 5CQMX 1EVTA 4LO0A 1Q03A 1MC3A 4HO6A 3BRGC 1R7VA 1I1EA 4NAKA 1FRWA 5CMGX 2AH9A 4KNXA 1IILA 3JTJA 2WGZA 3AZWA 3BA7A 3KMVA 2JCKA 5FTSA 4A7KA 3V90A 3DJ4A 2KH2A 3O4BA 1G97A 1D0HA 1JT5A 2I5KA 2AAIB 2RJ1A 1IHKA 2BEBA 3BRKX 3I0KA 3N9WA 4HO5A 5CQLX 2NZ9A 1H7FA 3D98A 1FQ9A 1W3FA 4QKSA 3VT1A 3WA1A 1FZWA 1O7OA 1H5TB 2Z86A 4NANA 4JQ0A 1HWOB 4LO2C 4G6JA 1HJJA 1OQMB 1VZUA 4GAIA 2RJ9A 3ZXGA 1ZI4A 3A23A 2AM5A 3O4CA 2MZBA 1E0OA 4JAWA 3CQAA 1DFQA 2VXTI 1ZJ2A 4I2SA 2I7BA 3F1CA 4IRPA 4MNDA 4P02A 1WT3A 3UD8A 4I4RA 4M2AA 3V79C 2JCJA 3DUVA 3CRIA 1HIBA 4J2KA 5BQUC 4I4VA 4KPXA 4J23B 5GAQA 3VUOA 4ARWA 4LO7C 5C3DA 3BAOA 1AVUA 2DRZA 2O1FA 3ZF8A 5CMFX 3A22A 2D24A 2PGVA 3NBCA 1QG8A 1V84A 3P6IA 1AVWB 4ZFYB 1QWJA 2PX7A 3CKOA 3OH3A 4EEOA 1VH3A 4EB2B 1IINA 9ILBA 1HWPB 4I1BA 5FNWA 5AJNA 1BARA 3V0AA 3IOHA 3VT0A 2AQZA 5I1BA 1IRPA 3LW6A 4DECA 3FJEA 2GO2A 5CQPA 1NUNA 3W9TA 4D0TA 4I96A 1OQLB 3UD9A 2P23A 5F8WA 3WINA 1PUUB 3AH2A 1LZJA 1NQIB 1VPAA 3H6RB 2YC5A 4M2BA 3RMWA 2RIXA 3CA4A 1WD3A 1YBIA 3BCVA 4NALA 4FCUA 1FR9A 3I0DA 1INIA 2VXRA 3VWCA 4JKQA 3PKPA 2RQ9A 4KXOA 1HWNB 1YROB 4CJCA 1K5VA 3AH1A 2E4MA 3OJMA 1V6XA 4KC1A 1YF8B 5AJOA 1KNMA 1R80A 3N7LA 4I6IA 3S8KA 1BFGA 1QQKA 1QGQA 3LTQA 1T4QA 1VGZA 3Q80A 4AC3A 1CVSA 3I29B 4X37A 3P53A 5F8SA 4EKXB 4P0KA 4QD2C 2A8UA 2AXMA 1H5SA 1ISWA 1NMMB 2D22A 2P6WA 2UX8A 4IY9A 3IM7A 3S8JA 1XHBA 2D1ZA 3N7MA 1JVDA 3O4AA 3OAMA 4FRLA 4P6AA 2AM4A 5L6VA 1PC8B 3ZX7A 4CJBA 1FMMS 2D44A 1FOAA 1M16A 4X3AA 4JP0A 4EEMA 1ZJ0A 2VS5A 1SR4C 3OBTA 4ZA3B 4L41C 5C3BA 1FGAA 2V0IA 2APCA 2F2FA 1XG6A 1H5SD 4KC2A 3ZGGA 3BAVA 3B9UA 3VSZA 4AN6A 3VT2A 1NF5B 4FRDA 3NBNA 3IOJA 4HO4A 1FWUA 1PUMB 3N7JA 3O4OA 2WVLA 4FRMA 3O44A 4EFQA 4GAFA 2ZU9A 4P0LA 2A8WA 2D7RA 4QO3A 2VSIA 2FDBM 4OEFA 3CKQA 1EYLA 2FGFA 1S4PA 3R3IA 2YQSA 5DVHA 5FUHA 1PZZA 1G9CA 2X5SA 3PNNA 2VXMA 4Y62A 2XOAA 3USQA 4D11A 2R9KB 2VSAA 1K4VA 2MC2A 2FO1A 2V0HA 4ZLBB 4XWIA 3FJJA 1W57A 3U2TA 5C38A 5I1FA 1R7UA 1AXMA 3NBDA 3EF2A 3I0JA 4Y7GA 4EE3A 4G3PA 4EE4A 1Z90A 1WVCA 1DIWA 1AFCA 2ZQNA 2ICYA 2IWTB 4HJJA 1QQLA 2YQJA 1S4OA 2RG9B 3N7KA 5D62A 3I0CA 4EE5A 5EJ1A 2P39A 3K8DA 1HM8A 2FYCB 2NTDA 2VSHA 1G9RA 5C48A 3OH4A 4HCQA 1ZJOA 3NBEA 4LW6A 1CE7B 1DZDA 3NGWA 3IOIA 2XWMA 1M2TB 4HO9A 3A21A 4Y63A 4I4OA 4LO7B 1WT2A 2Y4MA 4M28A 2Y4KA 3SXCA 1JV1A 3V0MA 2X2TA 1HM9A 2K43A 1WSZA 3E8LC 1ON6A 4EEEB 2RJ0A 2WVKA 1IJTA 3OGZA 3T7OA 3WMVA 4AAWA 4QBVA 1R8OA 5BXTA 2NVHA 1ZI3A 1W3GA 2D0JA 3PKQA 5C8RA 4I4XA 3V0BA 3UJ4A 4YOLA 1FXJA 4B5BA 1BLAA 4FROA 2RJ6A 4H9WA 3SX7A 4B2WA 3U2XA 4D48A 3O49A 2D20A 4HOCA 4LW3A 1WBAA 3Q7WA 1MP5A 2X65A 5FZZA 1YYNA 3FUQA 1JYKA 2RJ4A 3OC9A 1XYFA 1F31A 2KI4A 4I3NA 3RTIB 1WT1A 1IT0A 1TWEA 2ET2A 4R6UB 1RG8A 2GZBA 1LL3A 3ST8A 3CA0A 3BA5A 4G6MA 4F34A 3C9ZA 4GBPA 3FGMA 1EV2A 6I1BA 41BIA 1G8OA 2Z49A 2AE7A 4AYJA 3JUJA 5C4DA 4MYBA 4OEEA 5BVPI 1EZIA 1Q1UA 2VXLA 3HALA 3JUTA 1S4NA 1Z2VA 5B2HA 3HN1A 4QD2B 3SX3A 5DDVA 1ITBA 4USOA 1ZJ1A 3VEQA 5JMCA 1HV9A 1G0RA 1ZHJA 1GGPB 1W77A 1H5TA 3SXEA 2HZ9A 4LO0C 5BP5A 3OGFA 3CKVA 1E5KA 4IYBA 3T7NA 1BLDA 2LIEA 4J2XA 2AESA 5F8YA 1BASA 2KLLA 1I1BA 4FRBA 1IOBA 2VS3A 2CU2A 1Z0HA 1TWMA 4Z8SB 1H7HA 2D43A 2Q9XA 1HCDA 2ERMA 1Z4SA 4EFPA 4LO1A 3CA6A 4Y6NA 1FR8A 4B42A 3O4DA 3V8ZA 1DLLA 2OEFA 3OGGA 3CU0A 3QVBA 1FV2A 4A7YA 1S0LA 3ZC9A 4J2SA 8I1BA 1NKHB 3BX1C 1ZCTA 3JRRA 3O3PA 3F62B 1NWGB 3I0HA 3IM6A 5C4CA 1G3LA 1MP4A 2W0WA 4GP0A 4K6RA 2XMEA 3TZTA 1FGXA 1ZCYA 2Z87A 4LO3A 2Y9FA 3FJAA 4JKXB 1EYRA 1YTOA 1SR4A 1FN0A 2Y9WC 1ZCVA 1FV3A 2NXVA 4IQPA 4XFSA 3UJ0A 1JVGA 2VD4A 2ZQOA 3E25A 4Y7FA 3U0YA 1R7XA 3RSBA 3PUBA 2Q4JA 2VS4A 4FRHA 3E26A 3FJKA 1V82A 3JUKA 5IDSA 3O3QA 4OUJA 2BO4A 3RSJA 4G9NA 1TZFA 3V0LA 5CMHA 2HWMA 4I8MA 1H7GA 1VZTA 1J0SA 3SXDA 4L4HA 3H6RA 1S0EA
chains in the Genus database with same CATH superfamily
3USRA 3RTJB 1V6WA 1VGTA 4IY8A 4EEGA 4XFTA 4AYLA 1Q04A 2Z48A 5E24E 3Q4SA 1AVAC 1VH1A 1VCLA 4ECMA 1PZYB 1ISXA 2K8RA 4Q9PA 5EC5A 3HMYA 1LZ0A 2O1HA 1NZKA 1H4DA 4HO8A 2M49A 4O6NA 1H7QA 2PA4A 2P72A 3WINC 4HO0A 2IHOA 1ABRB 2X60A 1AVXB 1TIEA 5C47A 1FXOA 4HO3A 5C36A 3FFZA 3FJHA 1INJA 2PGYA 2YQHA 3FOQA 5EJZA 1BFBA 4KEJA 1O0RA 1DJSB 2LIQA 2NP0A 2I5EA 1ZCUA 3QYDA 4Y7UA 4BQHA 4H04A 2E4MC 1YP4A 3ZXDA 4KQLA 2F8XC 5EG6C 1G9AA 3FJ9A 1JLYA 2Q3NB 3CA5A 4I7IA 1WT0A 1ZI5A 2E3DA 5JQQA 2DRYA 1H5RB 1W3AA 3R4SA 2QKXA 4UEGA 4DCKC 4FGFA 4I4YA 1ONKB 3WMUA 1H5SC 3PG0A 1HCEA 5CQOA 2Y9GA 2UUSA 1JT3A 1H7LA 3CU1B 1NHEB 1R81A 2RJ5A 3CRHA 3OH1A 4QALA 1IIMA 2V0JA 1K5UA 1TFMB 1PWAA 1DFCA 2YUGA 3PMEA 2BEAA 3AKFA 4GP3A 4USPA 1SZ6B 2WBCA 4D8HA 1G1LA 1GA8A 1SS9A 3Q7XA 1YXWA 2RSTA 3FUOA 1RZOB 5DZUA 2O1GA 2FFVA 3BRDA 4KPZA 3IIRA 2KI6B 1HJLA 5C4EA 2Y7AA 1G95A 4CVHA 1MD6A 1QXMA 1R82A 1R8NA 4LO2A 1G23A 2F2FC 1QGSA 4JD0A 5FTVA 1JY0A 4QC4A 2QGIA 3SX5A 3HOMA 4ZKTB 4FRPA 3FJBA 2FFUA 3OBRA 1S0BA 4QBCA 1HWMB 2WRYA 1H5RA 1H4CA 1H4EA 4IONA 4OWKA 2X5ZA 3CKJA 4M4KA 5C4FA 5EIYA 4FREA 4KC3A 3D7WB 4ZOTA 1TOOA 1PZTA 4G3SA 4B3UA 3AKGA 5FNXA 4DEPA 2FYBA 4OW4A 4XKIA 1G9BA 3HL3A 5CQNX 4HR6C 4OWLA 2AECA 2K4AB 1H7TA 4CJ8A 3FJCA 1YP2A 3NJ5A 3Q7UA 4O6MA 5DDTA 5BQUA 3K8EA 4D11C 3PHZA 4IZEA 1JT4A 4LO8B 1V6VA 4I4UA 2RIZA 2JCLA 4FIYA 2D7IA 3FWWA 3WO3A 2HWAA 1FO9A 4I4SA 2WEEA 4ISRA 5FU0A 4FRAA 2ZR1B 4FQWA 4I1EA 4GOVA 4ZFWB 1ZJPA 5C4BA 3BB2A 3IM5A 2J0AA 3OJVA 4ZDQA 3SX8A 1XZZA 5L6SA 1ZDFA 2RITA 3KIAA 3SPTA 2I1BA 3LLPA 1G93A 3TQDA 3AH4A 3T8SA 3SXBA 2VK9A 3SXAA 1V6UA 1AF9A 2VLCA 3CRGA 1GX0A 2ICXA 2YCMA 4Z9WB 4G1RA 2BFHA 2JCOA 1VZXA 2NM1A 1DZCA 5BOWA 4Y7VA 5FU8A 1GWVA 1MP3A 5EHAA 4ISQA 1R7YA 4FRQA 4XFUA 2VU9A 2KKIA 5IFYA 2D23A 3V0AB 1VICA 5JLVA 4IHZA 4B4BA 4OWJA 1XZ6A 5C49A 1G9DA 1GQ9A 1FWVA 4ASYA 2XWNA 3POKA 2ESUA 5DUYA 1V83A 3SXGA 1ISZA 3V8YA 1BA7A 5C1LA 4PC4A 2GGQA 5FV9A 3OJ2A 3CAHA 1WD4A 2AFGA 1FO8A 5BXSA 3BAUA 3I0IX 2DREA 5BXRA 3D5NA 2YQCA 3FJ8A 1BFFA 3BA4A 3HBWA 5D61A 31BIA 3AZVA 3HSMA 3O5WB 2AGDA 1RMLA 3N0KA 1MC9A 2E8BA 7I1BA 4P0JA 2Y4JA 3OKRA 3OH2A 4KC4A 1H7EA 1BFCA 4B4MA 3T7MA 3POLA 4KNRA 3V0QA 1RY7A 2X2SA 1FG5N 1ISYA 4FVVA 5AJPA 2DPWA 2ZU8A 4P00A 3BAHA 4D0ZA 1ISVA 4GOYA 1TW5A 1H5SB 3U2UA 2RIYA 3F1YA 1S0GA 3FJDA 3TC2A 2NYYA 5D63A 4I0YA 4J2YA 1R7TA 2QYIB 5BXPA 2RJ8A 3MALA 3UDAA 5BP5C 1VGUA 2WVMA 5CMIA 5DSSB 4KEKA 3UD7A 1ZIZA 4Y9XA 1GWWA 3U2VA 3V0PA 4CJMA 1T9FA 5CMJA 3I0LA 1S0DA 1KWSA 5BXCA 1VGWA 1A8DA 1S0CA 1ZI1A 1H3MA 2OEGA 2YC3A 2WAWA 3AJ6A 3MPPG 4F83A 4YS8A 3ZC8A 2L5XA 4ENDA 2FYDB 2P73A 1VM8A 2BO8A 2OI5A 3EE5A 1L2HA 3Q7YA 4LO1C 3I0FA 4DDZA 3U0XA 3R4UA 4EFRA 3I0EA 4A7ZA 3A07A 2FYAA 4ASJA 4E1KA 3BADA 5IDTA 1FMZA 1UPSA 5G00A 4G3QA 3WO4A 4BMAA 4KEIA 3BTAA 1IRAX 1TTUA 5C1GA 5J49A 1YP3A 1FGGA 1JT7A 4DENA 2QN4A 21BIA 3IAGC 1JV3A 2V0KA 3CKNA 4Y64A 3V0OA 2Y4LA 1EPWA 4X38A 1GQCA 1LVWA 1LZIA 2RJ7A 4JRAA 2W0VA 3CGXA 3RMVA 3V0NA 4I4PA 1JYLA 4LO3C 1FWYA 4G87A 3CA3A 4KT7A 4JISA 4QKRA 1I52A 3ZLLA 1LL2A 1N4KA 4ZGRB 2MLLB 4UY4A 2VFZA 4FCEA 3V91A 4EEOA 1DQOA 2FY7A 3P6JA 2ZU7A 2VSEA 4NAIA 4KRVA 3ILAA 4HO2A 2J3PA 2OI7A 1G82A 1O23B 3CA1A 4C2SA 1GX4A 2DS0A 4J18A 1WBCA 1P63A 3FJFA 4KBBA 3AKIA 2VUAA 4Q9GA 1OMZA 4HG6A 3I0GA 3H6SE 2OI6A 3RMXA 2AM3A 4JPZA 3VSFA 3BRFA 4ZFUB 3I2AA 1W55A 1JQZA 1JTCA 4II0A 2Y6PA 4AN7B 4Y7TA 2WE9A 3SNVA 4B4GA 3R2WA 4IRQA 3I2XA 3QR5A 1ZDGA 4Y6UA 5FYEA 1JLXA 2BO6A 4I37A 2MIBA 5FZUA 1TW1A 2XWLA 3AKHA 1HM0A 1LL0A 1TP0A 2GGOA 5F90A 1HKNA 3RMYA 4WBCA 2YESA 1S0FA 3D8VA 3OH0A 3U2WA 5HPZA 4G9MA 4OEGA 2QH5A 4IZXA 1ON8A 3BAGA 3K1XA 5C3AA 4Q91A 5C1HA 3DK5A 1LZ7A 3V0BB 2BO7A 1G2VA 2XMHA 4B2XA 1TVYA 1ZJ3A 5FZYA 2Y9XE 3F1RA 4HA2A 3WO2A 4I4QA 4EVWA 3AJ5A 4DE7A 1OMXA 4ZBVB 5HS2A 3BAQA 4TLPA 4X39A 1DQGA 2HW9A 4L4IA 2V0LA 4EEAA 3ZLKA 1II4A 1O7QA 3GUEA 3FJIA 3H6QA 4R7PA 1ILR1 5CQMX 1EVTA 4LO0A 1Q03A 1MC3A 4HO6A 3BRGC 1R7VA 1I1EA 4NAKA 1FRWA 5CMGX 2AH9A 4KNXA 1IILA 3JTJA 2WGZA 3AZWA 3BA7A 3KMVA 2JCKA 5FTSA 4A7KA 3V90A 3DJ4A 2KH2A 3O4BA 1G97A 1D0HA 1JT5A 2I5KA 2AAIB 2RJ1A 1IHKA 2BEBA 3BRKX 3I0KA 3N9WA 4HO5A 5CQLX 2NZ9A 1H7FA 3D98A 1FQ9A 1W3FA 4QKSA 3VT1A 3WA1A 1FZWA 1O7OA 1H5TB 2Z86A 4NANA 4JQ0A 1HWOB 4LO2C 4G6JA 2NS2A 1HJJA 1OQMB 4GAIA 1VZUA 2RJ9A 3ZXGA 1ZI4A 3A23A 2AM5A 5C4DA 3O4CA 2MZBA 1E0OA 4JAWA 3CQAA 1DFQA 2VXTI 1ZJ2A 4I2SA 2I7BA 3F1CA 4IRPA 4MNDA 4P02A 1WT3A 3UD8A 4I4RA 3ZGFA 4M2AA 3V79C 2JCJA 3DUVA 3CRIA 1HIBA 4J2KA 5BQUC 4I4VA 4KPXA 4J23B 5GAQA 3VUOA 4ARWA 4LO7C 5C3DA 3BAOA 1AVUA 2DRZA 2O1FA 3ZF8A 5CMFX 3A22A 2D24A 2PGVA 3NBCA 1QG8A 1V84A 3P6IA 1AVWB 4H75A 4ZFYB 1QWJA 2PX7A 3CKOA 3OH3A 1VH3A 4EB2B 1IINA 9ILBA 1HWPB 4I1BA 5FNWA 5AJNA 1BARA 3V0AA 3IOHA 3VT0A 2AQZA 5I1BA 1IRPA 3LW6A 4DECA 3FJEA 2GO2A 5CQPA 1NUNA 3W9TA 4D0TA 4I96A 1OQLB 3UD9A 2P23A 5F8WA 3WINA 1PUUB 3AH2A 1LZJA 1NQIB 1VPAA 3H6RB 2YC5A 4M2BA 3RMWA 2RIXA 3CA4A 1WD3A 1YBIA 3BCVA 4NALA 4FCUA 1FR9A 3I0DA 1INIA 2VXRA 3VWCA 4JKQA 3PKPA 2RQ9A 4KXOA 1HWNB 1YROB 4CJCA 1K5VA 3AH1A 2E4MA 3OJMA 1V6XA 4KC1A 1YF8B 5AJOA 1KNMA 1R80A 3N7LA 4I6IA 3S8KA 1BFGA 1QQKA 1QGQA 3LTQA 1T4QA 1VGZA 3Q80A 5D91A 4AC3A 1CVSA 3I29B 4X37A 3P53A 5F8SA 4EKXB 4P0KA 4QD2C 2A8UA 2AXMA 1H5SA 1ISWA 1NMMB 2D22A 2P6WA 2UX8A 4IY9A 3IM7A 3S8JA 1XHBA 2D1ZA 3N7MA 1JVDA 3O4AA 3OAMA 4FRLA 4P6AA 2AM4A 5L6VA 1PC8B 3ZX7A 4CJBA 1FMMS 2D44A 1FOAA 1M16A 4X3AA 4JP0A 4EEMA 1ZJ0A 2VS5A 1SR4C 3OBTA 4ZA3B 4L41C 5C3BA 4Q7CA 1FGAA 2V0IA 2APCA 2F2FA 1XG6A 1H5SD 4KC2A 3ZGGA 3BAVA 3B9UA 3VSZA 4AN6A 3VT2A 1NF5B 4FRDA 3NBNA 3IOJA 4HO4A 1FWUA 1PUMB 3N7JA 3O4OA 2WVLA 4FRMA 3O44A 4EFQA 4GAFA 2ZU9A 4P0LA 2A8WA 2D7RA 4QO3A 2VSIA 2FDBM 4OEFA 3CKQA 1EYLA 2FGFA 1S4PA 3R3IA 2YQSA 5DVHA 5FUHA 1PZZA 1G9CA 2X5SA 3PNNA 2VXMA 4Y62A 2XOAA 3USQA 4D11A 2R9KB 2VSAA 1K4VA 2MC2A 2FO1A 2V0HA 4ZLBB 4XWIA 3FJJA 1W57A 3U2TA 5C38A 4AYJA 5I1FA 1R7UA 1AXMA 3NBDA 3EF2A 3I0JA 4Y7GA 4EE3A 4G3PA 4EE4A 1Z90A 5D92A 1WVCA 1DIWA 1AFCA 2ZQNA 2ICYA 2IWTB 4HJJA 1QQLA 2YQJA 1S4OA 2RG9B 3N7KA 5D62A 3I0CA 4EE5A 5EJ1A 2P39A 3K8DA 1HM8A 2FYCB 2NTDA 2VSHA 1G9RA 5C48A 3OH4A 4HCQA 1ZJOA 3NBEA 4LW6A 1CE7B 1DZDA 3NGWA 3IOIA 2XWMA 1M2TB 4HO9A 3A21A 4Y63A 4I4OA 4LO7B 1WT2A 2Y4MA 4M28A 2Y4KA 3SXCA 1JV1A 3V0MA 2X2TA 1HM9A 2K43A 1WSZA 2J0BA 3E8LC 1ON6A 4EEEB 2RJ0A 2WVKA 1IJTA 3OGZA 3T7OA 3WMVA 4AAWA 4QBVA 1R8OA 5BXTA 2NVHA 1ZI3A 1W3GA 2D0JA 3PKQA 5C8RA 4FIXA 4I4XA 3V0BA 3UJ4A 4YOLA 1FXJA 4B5BA 1BLAA 4FROA 2RJ6A 4H9WA 3SX7A 4B2WA 3U2XA 4D48A 3O49A 2D20A 4HOCA 4LW3A 1WBAA 3Q7WA 1MP5A 2X65A 5FZZA 1YYNA 3FUQA 1JYKA 2RJ4A 3OC9A 1XYFA 1F31A 2KI4A 4I3NA 3RTIB 1WT1A 1IT0A 1TWEA 2ET2A 4R6UB 1RG8A 2GZBA 1LL3A 2C0NA 3ST8A 3CA0A 3BA5A 4G6MA 4F34A 3C9ZA 4GBPA 3FGMA 1EV2A 6I1BA 4MZHA 41BIA 2Z49A 1G8OA 2AE7A 4MZFB 3JUJA 4MYBA 4OEEA 5BVPI 1EZIA 1Q1UA 2VXLA 3HALA 3JUTA 1S4NA 1Z2VA 5B2HA 3HN1A 4QD2B 3SX3A 5DDVA 1ITBA 4USOA 1ZJ1A 3VEQA 5JMCA 1HV9A 1G0RA 1ZHJA 1GGPB 1W77A 1H5TA 3SXEA 2HZ9A 4LO0C 5BP5A 3OGFA 3CKVA 1E5KA 4IYBA 3T7NA 1BLDA 2LIEA 4J2XA 2AESA 5F8YA 1BASA 2KLLA 1I1BA 4FRBA 1IOBA 2VS3A 2CU2A 1Z0HA 1TWMA 4Z8SB 1H7HA 2D43A 2Q9XA 4MZGB 1HCDA 2ERMA 1Z4SA 4EFPA 4LO1A 3CA6A 4Y6NA 1FR8A 4B42A 3O4DA 3V8ZA 1DLLA 2OEFA 3OGGA 3CU0A 3QVBA 1FV2A 4A7YA 1S0LA 3ZC9A 4J2SA 8I1BA 1NKHB 3BX1C 1ZCTA 3JRRA 3O3PA 3F62B 1NWGB 3I0HA 3IM6A 5C4CA 1G3LA 1MP4A 2W0WA 4GP0A 4K6RA 2XMEA 3TZTA 1FGXA 1ZCYA 2Z87A 4LO3A 2Y9FA 3FJAA 4JKXB 1EYRA 1YTOA 1SR4A 1FN0A 2Y9WC 1ZCVA 1FV3A 2NXVA 4IQPA 4XFSA 3UJ0A 1JVGA 2VD4A 2ZQOA 3E25A 4Y7FA 3U0YA 1R7XA 4MIXA 3RSBA 3PUBA 2Q4JA 2VS4A 4FRHA 3E26A 3FJKA 1V82A 3JUKA 5IDSA 3O3QA 4OUJA 2BO4A 3RSJA 4G9NA 1TZFA 3V0LA 5CMHA 2HWMA 4I8MA 1H7GA 1VZTA 1J0SA 3SXDA 4L4HA 3H6RA 1S0EA
chains in the Genus database with same CATH topology
3USRA 3RTJB 1V6WA 1VGTA 4IY8A 4EEGA 4XFTA 4AYLA 1Q04A 2Z48A 5E24E 3Q4SA 1AVAC 1VH1A 1VCLA 4ECMA 1PZYB 1ISXA 2K8RA 4Q9PA 5EC5A 3HMYA 1LZ0A 2O1HA 1NZKA 1H4DA 4HO8A 2M49A 4O6NA 1H7QA 2PA4A 2P72A 3WINC 4HO0A 2IHOA 1ABRB 2X60A 1AVXB 1TIEA 5C47A 1FXOA 4HO3A 5C36A 3FFZA 3FJHA 1INJA 2PGYA 2YQHA 3FOQA 5EJZA 1BFBA 4KEJA 1O0RA 1DJSB 2LIQA 2NP0A 2I5EA 1ZCUA 3QYDA 4Y7UA 4BQHA 4H04A 2E4MC 1YP4A 3ZXDA 4KQLA 2F8XC 5EG6C 1G9AA 3FJ9A 1JLYA 2Q3NB 3CA5A 4I7IA 1WT0A 1ZI5A 2E3DA 5JQQA 2DRYA 1H5RB 1W3AA 3R4SA 2QKXA 4UEGA 4DCKC 4FGFA 4I4YA 1ONKB 3WMUA 1H5SC 3PG0A 1HCEA 5CQOA 2Y9GA 2UUSA 1JT3A 1H7LA 3CU1B 1NHEB 1R81A 2RJ5A 3CRHA 3OH1A 4QALA 1IIMA 2V0JA 1K5UA 1TFMB 1PWAA 1DFCA 2YUGA 3PMEA 2BEAA 3AKFA 4GP3A 4USPA 1SZ6B 2WBCA 4D8HA 1G1LA 1GA8A 1SS9A 3Q7XA 1YXWA 2RSTA 3FUOA 1RZOB 5DZUA 2O1GA 2FFVA 3BRDA 4KPZA 3IIRA 2KI6B 1HJLA 5C4EA 2Y7AA 1G95A 4CVHA 1MD6A 1QXMA 1R82A 1R8NA 4LO2A 1G23A 2F2FC 1QGSA 4JD0A 5FTVA 1JY0A 4QC4A 2QGIA 3SX5A 3HOMA 4ZKTB 4FRPA 3FJBA 2FFUA 3OBRA 1S0BA 4QBCA 1HWMB 2WRYA 1H5RA 1H4CA 1H4EA 4IONA 4OWKA 2X5ZA 3CKJA 4M4KA 5C4FA 5EIYA 4FREA 4KC3A 3D7WB 4ZOTA 1TOOA 1PZTA 4G3SA 4B3UA 3AKGA 5FNXA 4DEPA 2FYBA 4OW4A 4XKIA 1G9BA 3HL3A 5CQNX 4HR6C 4OWLA 2AECA 2K4AB 1H7TA 4CJ8A 3FJCA 1YP2A 3NJ5A 3Q7UA 4O6MA 5DDTA 5BQUA 3K8EA 4D11C 3PHZA 4IZEA 1JT4A 4LO8B 1V6VA 4I4UA 2RIZA 2JCLA 4FIYA 2D7IA 3FWWA 3WO3A 2HWAA 1FO9A 4I4SA 2WEEA 4ISRA 5FU0A 4FRAA 2ZR1B 4FQWA 4I1EA 4GOVA 4ZFWB 1ZJPA 5C4BA 3BB2A 3IM5A 2J0AA 3OJVA 4ZDQA 3SX8A 1XZZA 5L6SA 1ZDFA 2RITA 3KIAA 3SPTA 2I1BA 3LLPA 1G93A 3TQDA 3AH4A 3T8SA 3SXBA 2VK9A 3SXAA 1V6UA 1AF9A 2VLCA 3CRGA 1GX0A 2ICXA 2YCMA 4Z9WB 4G1RA 2BFHA 2JCOA 1VZXA 2NM1A 1DZCA 5BOWA 4Y7VA 5FU8A 1GWVA 1MP3A 5EHAA 4ISQA 1R7YA 4FRQA 4XFUA 2VU9A 2KKIA 5IFYA 2D23A 3V0AB 1VICA 5JLVA 4IHZA 4B4BA 4OWJA 1XZ6A 5C49A 1G9DA 1GQ9A 1FWVA 4ASYA 2XWNA 3POKA 2ESUA 5DUYA 1V83A 3SXGA 1ISZA 3V8YA 1BA7A 5C1LA 4PC4A 2GGQA 5FV9A 3OJ2A 3CAHA 1WD4A 2AFGA 1FO8A 5BXSA 3BAUA 3I0IX 2DREA 5BXRA 3D5NA 2YQCA 3FJ8A 1BFFA 3BA4A 3HBWA 5D61A 31BIA 3AZVA 3HSMA 3O5WB 2AGDA 1RMLA 3N0KA 1MC9A 2E8BA 7I1BA 4P0JA 2Y4JA 3OKRA 3OH2A 4KC4A 1H7EA 1BFCA 4B4MA 3T7MA 3POLA 4KNRA 3V0QA 1RY7A 2X2SA 1FG5N 1ISYA 4FVVA 5AJPA 2DPWA 2ZU8A 4P00A 3BAHA 4D0ZA 1ISVA 4GOYA 1TW5A 1H5SB 3U2UA 2RIYA 3F1YA 1S0GA 3FJDA 3TC2A 2NYYA 5D63A 4I0YA 4J2YA 1R7TA 2QYIB 5BXPA 2RJ8A 3MALA 3UDAA 5BP5C 1VGUA 2WVMA 5CMIA 5DSSB 4KEKA 3UD7A 1ZIZA 4Y9XA 1GWWA 3U2VA 3V0PA 4CJMA 1T9FA 5CMJA 3I0LA 1S0DA 1KWSA 5BXCA 1VGWA 1A8DA 1S0CA 1ZI1A 1H3MA 2OEGA 2YC3A 2WAWA 3AJ6A 3MPPG 4F83A 4YS8A 3ZC8A 2L5XA 4ENDA 2FYDB 2P73A 1VM8A 2BO8A 2OI5A 3EE5A 1L2HA 3Q7YA 4LO1C 3I0FA 4DDZA 3U0XA 3R4UA 4EFRA 3I0EA 4A7ZA 3A07A 2FYAA 4ASJA 4E1KA 3BADA 5IDTA 1FMZA 1UPSA 5G00A 4G3QA 3WO4A 4BMAA 4KEIA 3BTAA 1IRAX 1TTUA 5C1GA 5J49A 1YP3A 1FGGA 1JT7A 4DENA 2QN4A 21BIA 3IAGC 1JV3A 2V0KA 3CKNA 4Y64A 3V0OA 2Y4LA 1EPWA 4X38A 1GQCA 1LVWA 1LZIA 2RJ7A 4JRAA 2W0VA 3CGXA 3RMVA 3V0NA 4I4PA 1JYLA 4LO3C 1FWYA 4G87A 3CA3A 4KT7A 4JISA 4QKRA 1I52A 3ZLLA 1LL2A 1N4KA 4ZGRB 2MLLB 4UY4A 2VFZA 4FCEA 3V91A 4EEOA 1DQOA 2FY7A 3P6JA 2ZU7A 2VSEA 4NAIA 4KRVA 3ILAA 4HO2A 2J3PA 2OI7A 1G82A 1O23B 3CA1A 4C2SA 1GX4A 2DS0A 4J18A 1WBCA 1P63A 3FJFA 4KBBA 3AKIA 2VUAA 4Q9GA 1OMZA 4HG6A 3I0GA 3H6SE 2OI6A 3RMXA 2AM3A 4JPZA 3VSFA 3BRFA 4ZFUB 3I2AA 1W55A 1JQZA 1JTCA 4II0A 2Y6PA 4AN7B 4Y7TA 2WE9A 3SNVA 4B4GA 3R2WA 4IRQA 3I2XA 3QR5A 1ZDGA 4Y6UA 5FYEA 1JLXA 2BO6A 4I37A 2MIBA 5FZUA 1TW1A 2XWLA 3AKHA 1HM0A 1LL0A 1TP0A 2GGOA 5F90A 1HKNA 3RMYA 4WBCA 2YESA 1S0FA 3D8VA 3OH0A 3U2WA 5HPZA 4G9MA 4OEGA 2QH5A 4IZXA 1ON8A 3BAGA 3K1XA 5C3AA 4Q91A 5C1HA 3DK5A 1LZ7A 3V0BB 2BO7A 1G2VA 2XMHA 4B2XA 1TVYA 1ZJ3A 5FZYA 2Y9XE 3F1RA 4HA2A 3WO2A 4I4QA 4EVWA 3AJ5A 4DE7A 1OMXA 4ZBVB 5HS2A 3BAQA 4TLPA 4X39A 1DQGA 2HW9A 4L4IA 2V0LA 4EEAA 3ZLKA 1II4A 1O7QA 3GUEA 3FJIA 3H6QA 4R7PA 1ILR1 5CQMX 1EVTA 4LO0A 1Q03A 1MC3A 4HO6A 3BRGC 1R7VA 1I1EA 4NAKA 1FRWA 5CMGX 2AH9A 4KNXA 1IILA 3JTJA 2WGZA 3AZWA 3BA7A 3KMVA 2JCKA 5FTSA 4A7KA 3V90A 3DJ4A 2KH2A 3O4BA 1G97A 1D0HA 1JT5A 2I5KA 2AAIB 2RJ1A 1IHKA 2BEBA 3BRKX 3I0KA 3N9WA 4HO5A 5CQLX 2NZ9A 1H7FA 3D98A 1FQ9A 1W3FA 4QKSA 3VT1A 3WA1A 1FZWA 1O7OA 1H5TB 2Z86A 4NANA 4JQ0A 1HWOB 4LO2C 4G6JA 2NS2A 1HJJA 1OQMB 4GAIA 1VZUA 2RJ9A 3ZXGA 1ZI4A 3A23A 2AM5A 5C4DA 3O4CA 2MZBA 1E0OA 4JAWA 3CQAA 1DFQA 2VXTI 1ZJ2A 4I2SA 2I7BA 3F1CA 4IRPA 4MNDA 4P02A 1WT3A 3UD8A 4I4RA 3ZGFA 4M2AA 3V79C 2JCJA 3DUVA 3CRIA 1HIBA 4J2KA 5BQUC 4I4VA 4KPXA 4J23B 5GAQA 3VUOA 4ARWA 4LO7C 5C3DA 3BAOA 1AVUA 2DRZA 2O1FA 3ZF8A 5CMFX 3A22A 2D24A 2PGVA 3NBCA 1QG8A 1V84A 3P6IA 1AVWB 4H75A 4ZFYB 1QWJA 2PX7A 3CKOA 3OH3A 1VH3A 4EB2B 1IINA 9ILBA 1HWPB 4I1BA 5FNWA 5AJNA 1BARA 3V0AA 3IOHA 3VT0A 2AQZA 5I1BA 1IRPA 3LW6A 4DECA 3FJEA 2GO2A 5CQPA 1NUNA 3W9TA 4D0TA 4I96A 1OQLB 3UD9A 2P23A 5F8WA 3WINA 1PUUB 3AH2A 1LZJA 1NQIB 1VPAA 3H6RB 2YC5A 4M2BA 3RMWA 2RIXA 3CA4A 1WD3A 1YBIA 3BCVA 4NALA 4FCUA 1FR9A 3I0DA 1INIA 2VXRA 3VWCA 4JKQA 3PKPA 2RQ9A 4KXOA 1HWNB 1YROB 4CJCA 1K5VA 3AH1A 2E4MA 3OJMA 1V6XA 4KC1A 1YF8B 5AJOA 1KNMA 1R80A 3N7LA 4I6IA 3S8KA 1BFGA 1QQKA 1QGQA 3LTQA 1T4QA 1VGZA 3Q80A 5D91A 4AC3A 1CVSA 3I29B 4X37A 3P53A 5F8SA 4EKXB 4P0KA 4QD2C 2A8UA 2AXMA 1H5SA 1ISWA 1NMMB 2D22A 2P6WA 2UX8A 4IY9A 3IM7A 3S8JA 1XHBA 2D1ZA 3N7MA 1JVDA 3O4AA 3OAMA 4FRLA 4P6AA 2AM4A 5L6VA 1PC8B 3ZX7A 4CJBA 1FMMS 2D44A 1FOAA 1M16A 4X3AA 4JP0A 4EEMA 1ZJ0A 2VS5A 1SR4C 3OBTA 4ZA3B 4L41C 5C3BA 4Q7CA 1FGAA 2V0IA 2APCA 2F2FA 1XG6A 1H5SD 4KC2A 3ZGGA 3BAVA 3B9UA 3VSZA 4AN6A 3VT2A 1NF5B 4FRDA 3NBNA 3IOJA 4HO4A 1FWUA 1PUMB 3N7JA 3O4OA 2WVLA 4FRMA 3O44A 4EFQA 4GAFA 2ZU9A 4P0LA 2A8WA 2D7RA 4QO3A 2VSIA 2FDBM 4OEFA 3CKQA 1EYLA 2FGFA 1S4PA 3R3IA 2YQSA 5DVHA 5FUHA 1PZZA 1G9CA 2X5SA 3PNNA 2VXMA 4Y62A 2XOAA 3USQA 4D11A 2R9KB 2VSAA 1K4VA 2MC2A 2FO1A 2V0HA 4ZLBB 4XWIA 3FJJA 1W57A 3U2TA 5C38A 4AYJA 5I1FA 1R7UA 1AXMA 3NBDA 3EF2A 3I0JA 4Y7GA 4EE3A 4G3PA 4EE4A 1Z90A 5D92A 1WVCA 1DIWA 1AFCA 2ZQNA 2ICYA 2IWTB 4HJJA 1QQLA 2YQJA 1S4OA 2RG9B 3N7KA 5D62A 3I0CA 4EE5A 5EJ1A 2P39A 3K8DA 1HM8A 2FYCB 2NTDA 2VSHA 1G9RA 5C48A 3OH4A 4HCQA 1ZJOA 3NBEA 4LW6A 1CE7B 1DZDA 3NGWA 3IOIA 2XWMA 1M2TB 4HO9A 3A21A 4Y63A 4I4OA 4LO7B 1WT2A 2Y4MA 4M28A 2Y4KA 3SXCA 1JV1A 3V0MA 2X2TA 1HM9A 2K43A 1WSZA 2J0BA 3E8LC 1ON6A 4EEEB 2RJ0A 2WVKA 1IJTA 3OGZA 3T7OA 3WMVA 4AAWA 4QBVA 1R8OA 5BXTA 2NVHA 1ZI3A 1W3GA 2D0JA 3PKQA 5C8RA 4FIXA 4I4XA 3V0BA 3UJ4A 4YOLA 1FXJA 4B5BA 1BLAA 4FROA 2RJ6A 4H9WA 3SX7A 4B2WA 3U2XA 4D48A 3O49A 2D20A 4HOCA 4LW3A 1WBAA 3Q7WA 1MP5A 2X65A 5FZZA 1YYNA 3FUQA 1JYKA 2RJ4A 3OC9A 1XYFA 1F31A 2KI4A 4I3NA 3RTIB 1WT1A 1IT0A 1TWEA 2ET2A 4R6UB 1RG8A 2GZBA 1LL3A 2C0NA 3ST8A 3CA0A 3BA5A 4G6MA 4F34A 3C9ZA 4GBPA 3FGMA 1EV2A 6I1BA 4MZHA 41BIA 2Z49A 1G8OA 2AE7A 4MZFB 3JUJA 4MYBA 4OEEA 5BVPI 1EZIA 1Q1UA 2VXLA 3HALA 3JUTA 1S4NA 1Z2VA 5B2HA 3HN1A 4QD2B 3SX3A 5DDVA 1ITBA 4USOA 1ZJ1A 3VEQA 5JMCA 1HV9A 1G0RA 1ZHJA 1GGPB 1W77A 1H5TA 3SXEA 2HZ9A 4LO0C 5BP5A 3OGFA 3CKVA 1E5KA 4IYBA 3T7NA 1BLDA 2LIEA 4J2XA 2AESA 5F8YA 1BASA 2KLLA 1I1BA 4FRBA 1IOBA 2VS3A 2CU2A 1Z0HA 1TWMA 4Z8SB 1H7HA 2D43A 2Q9XA 4MZGB 1HCDA 2ERMA 1Z4SA 4EFPA 4LO1A 3CA6A 4Y6NA 1FR8A 4B42A 3O4DA 3V8ZA 1DLLA 2OEFA 3OGGA 3CU0A 3QVBA 1FV2A 4A7YA 1S0LA 3ZC9A 4J2SA 8I1BA 1NKHB 3BX1C 1ZCTA 3JRRA 3O3PA 3F62B 1NWGB 3I0HA 3IM6A 5C4CA 1G3LA 1MP4A 2W0WA 4GP0A 4K6RA 2XMEA 3TZTA 1FGXA 1ZCYA 2Z87A 4LO3A 2Y9FA 3FJAA 4JKXB 1EYRA 1YTOA 1SR4A 1FN0A 2Y9WC 1ZCVA 1FV3A 2NXVA 4IQPA 4XFSA 3UJ0A 1JVGA 2VD4A 2ZQOA 3E25A 4Y7FA 3U0YA 1R7XA 4MIXA 3RSBA 3PUBA 2Q4JA 2VS4A 4FRHA 3E26A 3FJKA 1V82A 3JUKA 5IDSA 3O3QA 4OUJA 2BO4A 3RSJA 4G9NA 1TZFA 3V0LA 5CMHA 2HWMA 4I8MA 1H7GA 1VZTA 1J0SA 3SXDA 4L4HA 3H6RA 1S0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USR A;  3RTJ B;  1V6W A;  1VGT A;  4IY8 A;  4EEG A;  4XFT A;  4AYL A;  1Q04 A;  2Z48 A;  5E24 E;  3Q4S A;  1AVA C;  1VH1 A;  1VCL A;  4ECM A;  1PZY B;  1ISX A;  2K8R A;  4Q9P A;  5EC5 A;  3HMY A;  1LZ0 A;  2O1H A;  1NZK A;  1H4D A;  4HO8 A;  2M49 A;  1H7Q A;  2PA4 A;  2P72 A;  3WIN C;  4HO0 A;  2IHO A;  1ABR B;  2X60 A;  1AVX B;  1TIE A;  5C47 A;  1FXO A;  4HO3 A;  5C36 A;  3FFZ A;  3FJH A;  1INJ A;  2PGY A;  2YQH A;  3FOQ A;  5EJZ A;  1BFB A;  4KEJ A;  1O0R A;  1DJS B;  2LIQ A;  2NP0 A;  2I5E A;  1ZCU A;  3QYD A;  4Y7U A;  4BQH A;  4H04 A;  2E4M C;  1YP4 A;  3ZXD A;  4KQL A;  2F8X C;  5EG6 C;  1G9A A;  3FJ9 A;  1JLY A;  2Q3N B;  3CA5 A;  4I7I A;  1WT0 A;  1ZI5 A;  2E3D A;  5JQQ A;  2DRY A;  1H5R B;  1W3A A;  3R4S A;  2QKX A;  4UEG A;  4DCK C;  4FGF A;  4I4Y A;  1ONK B;  3WMU A;  1H5S C;  3PG0 A;  1HCE A;  5CQO A;  2Y9G A;  2UUS A;  1JT3 A;  1H7L A;  3CU1 B;  1NHE B;  1R81 A;  2RJ5 A;  3CRH A;  3OH1 A;  4QAL A;  1IIM A;  2V0J A;  1K5U A;  1TFM B;  1PWA A;  1DFC A;  2YUG A;  3PME A;  2BEA A;  3AKF A;  4GP3 A;  4USP A;  1SZ6 B;  2WBC A;  4D8H A;  1G1L A;  1GA8 A;  1SS9 A;  3Q7X A;  1YXW A;  2RST A;  3FUO A;  1RZO B;  5DZU A;  2O1G A;  2FFV A;  3BRD A;  4KPZ A;  3IIR A;  2KI6 B;  1HJL A;  5C4E A;  2Y7A A;  1G95 A;  4CVH A;  1MD6 A;  1QXM A;  1R82 A;  1R8N A;  4LO2 A;  1G23 A;  2F2F C;  1QGS A;  4JD0 A;  5FTV A;  1JY0 A;  4QC4 A;  2QGI A;  3SX5 A;  3HOM A;  4ZKT B;  4FRP A;  3FJB A;  2FFU A;  3OBR A;  1S0B A;  4QBC A;  1HWM B;  2WRY A;  1H5R A;  1H4C A;  1H4E A;  4ION A;  4OWK A;  2X5Z A;  3CKJ A;  4M4K A;  5C4F A;  5EIY A;  4FRE A;  4KC3 A;  3D7W B;  4ZOT A;  1TOO A;  1PZT A;  4G3S A;  4B3U A;  3AKG A;  5FNX A;  4DEP A;  2FYB A;  4OW4 A;  4XKI A;  1G9B A;  3HL3 A;  5CQN X;  4HR6 C;  4OWL A;  2AEC A;  2K4A B;  1H7T A;  4CJ8 A;  3FJC A;  1YP2 A;  3NJ5 A;  3Q7U A;  5DDT A;  4D11 C;  5BQU A;  3K8E A;  3PHZ A;  4IZE A;  1JT4 A;  4LO8 B;  1V6V A;  4I4U A;  2RIZ A;  2JCL A;  2D7I A;  3FWW A;  3WO3 A;  2HWA A;  1FO9 A;  4I4S A;  2WEE A;  4ISR A;  5FU0 A;  4FRA A;  2ZR1 B;  4FQW A;  4I1E A;  4GOV A;  4ZFW B;  1ZJP A;  5C4B A;  3BB2 A;  3IM5 A;  3OJV A;  4ZDQ A;  3SX8 A;  1XZZ A;  5L6S A;  1ZDF A;  2RIT A;  3KIA A;  3SPT A;  2I1B A;  3LLP A;  1G93 A;  3TQD A;  3AH4 A;  3T8S A;  3SXB A;  3ZGF A;  3SXA A;  1V6U A;  1AF9 A;  2VLC A;  3CRG A;  1GX0 A;  2ICX A;  2YCM A;  4Z9W B;  4G1R A;  2BFH A;  2JCO A;  1VZX A;  2NM1 A;  1DZC A;  5BOW A;  4Y7V A;  5FU8 A;  1GWV A;  1MP3 A;  5EHA A;  4ISQ A;  1R7Y A;  4FRQ A;  4XFU A;  2VU9 A;  2KKI A;  5IFY A;  2D23 A;  3V0A B;  1VIC A;  5JLV A;  4IHZ A;  4B4B A;  4OWJ A;  1XZ6 A;  5C49 A;  1G9D A;  1GQ9 A;  1FWV A;  4ASY A;  2XWN A;  3POK A;  2ESU A;  5DUY A;  1V83 A;  3SXG A;  1ISZ A;  3V8Y A;  1BA7 A;  5C1L A;  4PC4 A;  2GGQ A;  5FV9 A;  3OJ2 A;  3CAH A;  1WD4 A;  2AFG A;  1FO8 A;  5BXS A;  3BAU A;  3I0I X;  2DRE A;  5BXR A;  3D5N A;  2YQC A;  3FJ8 A;  1BFF A;  3BA4 A;  3HBW A;  5D61 A;  31BI A;  3AZV A;  3HSM A;  3O5W B;  2AGD A;  1RML A;  3N0K A;  1MC9 A;  2E8B A;  7I1B A;  4P0J A;  2Y4J A;  3OKR A;  3OH2 A;  4KC4 A;  1H7E A;  1BFC A;  4B4M A;  3T7M A;  3POL A;  4KNR A;  3V0Q A;  1RY7 A;  2X2S A;  1FG5 N;  1ISY A;  4FVV A;  5AJP A;  2DPW A;  2ZU8 A;  4P00 A;  3BAH A;  4D0Z A;  1ISV A;  4GOY A;  1TW5 A;  1H5S B;  3U2U A;  2RIY A;  3F1Y A;  1S0G A;  3FJD A;  3TC2 A;  2NYY A;  5D63 A;  4I0Y A;  4J2Y A;  1R7T A;  2QYI B;  5BXP A;  2RJ8 A;  3MAL A;  3UDA A;  5BP5 C;  1VGU A;  2WVM A;  5CMI A;  5DSS B;  4KEK A;  3UD7 A;  1ZIZ A;  4Y9X A;  1GWW A;  3U2V A;  3V0P A;  4CJM A;  1T9F A;  5CMJ A;  3I0L A;  1S0D A;  1KWS A;  5BXC A;  1VGW A;  1A8D A;  1S0C A;  1ZI1 A;  1H3M A;  2OEG A;  2YC3 A;  2WAW A;  3AJ6 A;  3MPP G;  4F83 A;  4YS8 A;  3ZC8 A;  2L5X A;  4END A;  2FYD B;  2P73 A;  1VM8 A;  2BO8 A;  2OI5 A;  3EE5 A;  1L2H A;  3Q7Y A;  4LO1 C;  3I0F A;  4DDZ A;  3U0X A;  3R4U A;  4EFR A;  3I0E A;  4A7Z A;  3A07 A;  2FYA A;  4ASJ A;  4E1K A;  3BAD A;  5IDT A;  1FMZ A;  1UPS A;  5G00 A;  4G3Q A;  3WO4 A;  4BMA A;  4KEI A;  3BTA A;  1IRA X;  1TTU A;  5C1G A;  5J49 A;  1YP3 A;  1FGG A;  1JT7 A;  4DEN A;  2QN4 A;  21BI A;  3IAG C;  1JV3 A;  2V0K A;  3CKN A;  4Y64 A;  3V0O A;  2Y4L A;  1EPW A;  4X38 A;  1GQC A;  1LVW A;  1LZI A;  2RJ7 A;  4JRA A;  2W0V A;  3CGX A;  3RMV A;  3V0N A;  4I4P A;  1JYL A;  4LO3 C;  1FWY A;  4G87 A;  3CA3 A;  4KT7 A;  4JIS A;  4QKR A;  1I52 A;  3ZLL A;  1LL2 A;  1N4K A;  4ZGR B;  2MLL B;  2VFZ A;  4FCE A;  3V91 A;  1DQO A;  2FY7 A;  3P6J A;  2ZU7 A;  2VSE A;  4NAI A;  4KRV A;  3ILA A;  4HO2 A;  2J3P A;  2OI7 A;  1G82 A;  1O23 B;  3CA1 A;  4C2S A;  1GX4 A;  2DS0 A;  4J18 A;  1WBC A;  1P63 A;  3FJF A;  4KBB A;  3AKI A;  2VUA A;  4Q9G A;  1OMZ A;  4HG6 A;  3I0G A;  3H6S E;  2OI6 A;  3RMX A;  2AM3 A;  4JPZ A;  3VSF A;  3BRF A;  4ZFU B;  3I2A A;  1W55 A;  1JQZ A;  1JTC A;  4II0 A;  2Y6P A;  4AN7 B;  4Y7T A;  2WE9 A;  3SNV A;  4B4G A;  3R2W A;  4IRQ A;  3I2X A;  3QR5 A;  1ZDG A;  4Y6U A;  5FYE A;  1JLX A;  2BO6 A;  4I37 A;  2MIB A;  5FZU A;  1TW1 A;  2XWL A;  3AKH A;  1HM0 A;  1LL0 A;  1TP0 A;  2GGO A;  5F90 A;  1HKN A;  3RMY A;  4WBC A;  2YES A;  1S0F A;  3D8V A;  3OH0 A;  3U2W A;  5HPZ A;  4G9M A;  4OEG A;  2QH5 A;  4IZX A;  1ON8 A;  3BAG A;  3K1X A;  5C3A A;  4Q91 A;  5C1H A;  3DK5 A;  1LZ7 A;  3V0B B;  2BO7 A;  1G2V A;  2XMH A;  4B2X A;  1TVY A;  1ZJ3 A;  5FZY A;  2Y9X E;  3F1R A;  4HA2 A;  3WO2 A;  4I4Q A;  4EVW A;  3AJ5 A;  4DE7 A;  1OMX A;  4ZBV B;  5HS2 A;  3BAQ A;  4TLP A;  4X39 A;  1DQG A;  2HW9 A;  4L4I A;  2V0L A;  4EEA A;  3ZLK A;  1II4 A;  1O7Q A;  3GUE A;  3FJI A;  3H6Q A;  4R7P A;  1ILR 1;  5CQM X;  1EVT A;  4LO0 A;  1Q03 A;  1MC3 A;  4HO6 A;  3BRG C;  1R7V A;  1I1E A;  4NAK A;  1FRW A;  5CMG X;  2AH9 A;  4KNX A;  1IIL A;  3JTJ A;  2WGZ A;  3AZW A;  3BA7 A;  3KMV A;  2JCK A;  5FTS A;  4A7K A;  3V90 A;  3DJ4 A;  2KH2 A;  3O4B A;  1G97 A;  1D0H A;  1JT5 A;  2I5K A;  2AAI B;  2RJ1 A;  1IHK A;  2BEB A;  3BRK X;  3I0K A;  3N9W A;  4HO5 A;  5CQL X;  2NZ9 A;  1H7F A;  3D98 A;  1FQ9 A;  1W3F A;  4QKS A;  3VT1 A;  3WA1 A;  1FZW A;  1O7O A;  1H5T B;  2Z86 A;  4NAN A;  4JQ0 A;  1HWO B;  4LO2 C;  4G6J A;  1HJJ A;  1OQM B;  1VZU A;  4GAI A;  2RJ9 A;  3ZXG A;  1ZI4 A;  3A23 A;  2AM5 A;  3O4C A;  2MZB A;  1E0O A;  4JAW A;  3CQA A;  1DFQ A;  2VXT I;  1ZJ2 A;  4I2S A;  2I7B A;  3F1C A;  4IRP A;  4MND A;  4P02 A;  1WT3 A;  3UD8 A;  4I4R A;  4M2A A;  3V79 C;  2JCJ A;  3DUV A;  3CRI A;  1HIB A;  4J2K A;  5BQU C;  4I4V A;  4KPX A;  4J23 B;  5GAQ A;  3VUO A;  4ARW A;  4LO7 C;  5C3D A;  3BAO A;  1AVU A;  2DRZ A;  2O1F A;  3ZF8 A;  5CMF X;  3A22 A;  2D24 A;  2PGV A;  3NBC A;  1QG8 A;  1V84 A;  3P6I A;  1AVW B;  4ZFY B;  1QWJ A;  2PX7 A;  3CKO A;  3OH3 A;  4EEO A;  1VH3 A;  4EB2 B;  1IIN A;  9ILB A;  1HWP B;  4I1B A;  5FNW A;  5AJN A;  1BAR A;  3V0A A;  3IOH A;  3VT0 A;  2AQZ A;  5I1B A;  1IRP A;  3LW6 A;  4DEC A;  3FJE A;  2GO2 A;  5CQP A;  1NUN A;  3W9T A;  4D0T A;  4I96 A;  1OQL B;  3UD9 A;  2P23 A;  5F8W A;  3WIN A;  1PUU B;  3AH2 A;  1LZJ A;  1NQI B;  1VPA A;  3H6R B;  2YC5 A;  4M2B A;  3RMW A;  2RIX A;  3CA4 A;  1WD3 A;  1YBI A;  3BCV A;  4NAL A;  4FCU A;  1FR9 A;  3I0D A;  1INI A;  2VXR A;  3VWC A;  4JKQ A;  3PKP A;  2RQ9 A;  4KXO A;  1HWN B;  1YRO B;  4CJC A;  1K5V A;  3AH1 A;  2E4M A;  3OJM A;  1V6X A;  4KC1 A;  1YF8 B;  5AJO A;  1KNM A;  1R80 A;  3N7L A;  4I6I A;  3S8K A;  1BFG A;  1QQK A;  1QGQ A;  3LTQ A;  1T4Q A;  1VGZ A;  3Q80 A;  4AC3 A;  1CVS A;  3I29 B;  4X37 A;  3P53 A;  5F8S A;  4EKX B;  4P0K A;  4QD2 C;  2A8U A;  2AXM A;  1H5S A;  1ISW A;  1NMM B;  2D22 A;  2P6W A;  2UX8 A;  4IY9 A;  3IM7 A;  3S8J A;  1XHB A;  2D1Z A;  3N7M A;  1JVD A;  3O4A A;  3OAM A;  4FRL A;  4P6A A;  2AM4 A;  5L6V A;  1PC8 B;  3ZX7 A;  4CJB A;  1FMM S;  2D44 A;  1FOA A;  1M16 A;  4X3A A;  4JP0 A;  4EEM A;  1ZJ0 A;  2VS5 A;  1SR4 C;  3OBT A;  4ZA3 B;  4L41 C;  5C3B A;  1FGA A;  2V0I A;  2APC A;  2F2F A;  1XG6 A;  1H5S D;  4KC2 A;  3ZGG A;  3BAV A;  3B9U A;  3VSZ A;  4AN6 A;  3VT2 A;  1NF5 B;  4FRD A;  3NBN A;  3IOJ A;  4HO4 A;  1FWU A;  1PUM B;  3N7J A;  3O4O A;  2WVL A;  4FRM A;  3O44 A;  4EFQ A;  4GAF A;  2ZU9 A;  4P0L A;  2A8W A;  2D7R A;  4QO3 A;  2VSI A;  2FDB M;  4OEF A;  3CKQ A;  1EYL A;  2FGF A;  1S4P A;  3R3I A;  2YQS A;  5DVH A;  5FUH A;  1PZZ A;  1G9C A;  2X5S A;  3PNN A;  2VXM A;  4Y62 A;  2XOA A;  3USQ A;  4D11 A;  2R9K B;  2VSA A;  1K4V A;  2MC2 A;  2FO1 A;  2V0H A;  4ZLB B;  4XWI A;  3FJJ A;  1W57 A;  3U2T A;  5C38 A;  5I1F A;  1R7U A;  1AXM A;  3NBD A;  3EF2 A;  3I0J A;  4Y7G A;  4EE3 A;  4G3P A;  4EE4 A;  1Z90 A;  1WVC A;  1DIW A;  1AFC A;  2ZQN A;  2ICY A;  2IWT B;  4HJJ A;  1QQL A;  2YQJ A;  1S4O A;  2RG9 B;  3N7K A;  5D62 A;  3I0C A;  4EE5 A;  5EJ1 A;  2P39 A;  3K8D A;  1HM8 A;  2FYC B;  2NTD A;  2VSH A;  1G9R A;  5C48 A;  3OH4 A;  4HCQ A;  1ZJO A;  3NBE A;  4LW6 A;  1CE7 B;  1DZD A;  3NGW A;  3IOI A;  2XWM A;  1M2T B;  4HO9 A;  3A21 A;  4Y63 A;  4I4O A;  4LO7 B;  1WT2 A;  2Y4M A;  4M28 A;  2Y4K A;  3SXC A;  1JV1 A;  3V0M A;  2X2T A;  1HM9 A;  2K43 A;  1WSZ A;  3E8L C;  1ON6 A;  4EEE B;  2RJ0 A;  2WVK A;  1IJT A;  3OGZ A;  3T7O A;  3WMV A;  4AAW A;  4QBV A;  1R8O A;  5BXT A;  2NVH A;  1ZI3 A;  1W3G A;  2D0J A;  3PKQ A;  5C8R A;  4I4X A;  3V0B A;  3UJ4 A;  4YOL A;  1FXJ A;  4B5B A;  1BLA A;  4FRO A;  2RJ6 A;  4H9W A;  3SX7 A;  4B2W A;  3U2X A;  4D48 A;  3O49 A;  2D20 A;  4HOC A;  4LW3 A;  1WBA A;  3Q7W A;  1MP5 A;  2X65 A;  5FZZ A;  1YYN A;  3FUQ A;  1JYK A;  2RJ4 A;  3OC9 A;  1XYF A;  1F31 A;  2KI4 A;  4I3N A;  3RTI B;  1WT1 A;  1IT0 A;  1TWE A;  2ET2 A;  4R6U B;  1RG8 A;  2GZB A;  1LL3 A;  3ST8 A;  3CA0 A;  3BA5 A;  4G6M A;  4F34 A;  3C9Z A;  4GBP A;  3FGM A;  1EV2 A;  6I1B A;  41BI A;  1G8O A;  2Z49 A;  2AE7 A;  4AYJ A;  3JUJ A;  5C4D A;  4MYB A;  4OEE A;  5BVP I;  1EZI A;  1Q1U A;  2VXL A;  3HAL A;  3JUT A;  1S4N A;  1Z2V A;  5B2H A;  3HN1 A;  4QD2 B;  3SX3 A;  5DDV A;  1ITB A;  4USO A;  1ZJ1 A;  3VEQ A;  5JMC A;  1HV9 A;  1G0R A;  1ZHJ A;  1GGP B;  1W77 A;  1H5T A;  3SXE A;  2HZ9 A;  4LO0 C;  5BP5 A;  3OGF A;  3CKV A;  1E5K A;  4IYB A;  3T7N A;  1BLD A;  2LIE A;  4J2X A;  2AES A;  5F8Y A;  1BAS A;  2KLL A;  1I1B A;  4FRB A;  1IOB A;  2VS3 A;  2CU2 A;  1Z0H A;  1TWM A;  4Z8S B;  1H7H A;  2D43 A;  2Q9X A;  1HCD A;  2ERM A;  1Z4S A;  4EFP A;  4LO1 A;  3CA6 A;  4Y6N A;  1FR8 A;  4B42 A;  3O4D A;  3V8Z A;  1DLL A;  2OEF A;  3OGG A;  3CU0 A;  3QVB A;  1FV2 A;  4A7Y A;  1S0L A;  3ZC9 A;  4J2S A;  8I1B A;  1NKH B;  3BX1 C;  1ZCT A;  3JRR A;  3O3P A;  3F62 B;  1NWG B;  3I0H A;  3IM6 A;  5C4C A;  1G3L A;  1MP4 A;  2W0W A;  4GP0 A;  4K6R A;  2XME A;  3TZT A;  1FGX A;  1ZCY A;  2Z87 A;  4LO3 A;  2Y9F A;  3FJA A;  4JKX B;  1EYR A;  1YTO A;  1SR4 A;  1FN0 A;  2Y9W C;  1ZCV A;  1FV3 A;  2NXV A;  4IQP A;  4XFS A;  3UJ0 A;  1JVG A;  2VD4 A;  2ZQO A;  3E25 A;  4Y7F A;  3U0Y A;  1R7X A;  3RSB A;  3PUB A;  2Q4J A;  2VS4 A;  4FRH A;  3E26 A;  3FJK A;  1V82 A;  3JUK A;  5IDS A;  3O3Q A;  4OUJ A;  2BO4 A;  3RSJ A;  4G9N A;  1TZF A;  3V0L A;  5CMH A;  2HWM A;  4I8M A;  1H7G A;  1VZT A;  1J0S A;  3SXD A;  4L4H A;  3H6R A;  1S0E A; 
#chains in the Genus database with same CATH topology
 3USR A;  3RTJ B;  1V6W A;  1VGT A;  4IY8 A;  4EEG A;  4XFT A;  4AYL A;  1Q04 A;  2Z48 A;  5E24 E;  3Q4S A;  1AVA C;  1VH1 A;  1VCL A;  4ECM A;  1PZY B;  1ISX A;  2K8R A;  4Q9P A;  5EC5 A;  3HMY A;  1LZ0 A;  2O1H A;  1NZK A;  1H4D A;  4HO8 A;  2M49 A;  4O6N A;  1H7Q A;  2PA4 A;  2P72 A;  3WIN C;  4HO0 A;  2IHO A;  1ABR B;  2X60 A;  1AVX B;  1TIE A;  5C47 A;  1FXO A;  4HO3 A;  5C36 A;  3FFZ A;  3FJH A;  1INJ A;  2PGY A;  2YQH A;  3FOQ A;  5EJZ A;  1BFB A;  4KEJ A;  1O0R A;  1DJS B;  2LIQ A;  2NP0 A;  2I5E A;  1ZCU A;  3QYD A;  4Y7U A;  4BQH A;  4H04 A;  2E4M C;  1YP4 A;  3ZXD A;  4KQL A;  2F8X C;  5EG6 C;  1G9A A;  3FJ9 A;  1JLY A;  2Q3N B;  3CA5 A;  4I7I A;  1WT0 A;  1ZI5 A;  2E3D A;  5JQQ A;  2DRY A;  1H5R B;  1W3A A;  3R4S A;  2QKX A;  4UEG A;  4DCK C;  4FGF A;  4I4Y A;  1ONK B;  3WMU A;  1H5S C;  3PG0 A;  1HCE A;  5CQO A;  2Y9G A;  2UUS A;  1JT3 A;  1H7L A;  3CU1 B;  1NHE B;  1R81 A;  2RJ5 A;  3CRH A;  3OH1 A;  4QAL A;  1IIM A;  2V0J A;  1K5U A;  1TFM B;  1PWA A;  1DFC A;  2YUG A;  3PME A;  2BEA A;  3AKF A;  4GP3 A;  4USP A;  1SZ6 B;  2WBC A;  4D8H A;  1G1L A;  1GA8 A;  1SS9 A;  3Q7X A;  1YXW A;  2RST A;  3FUO A;  1RZO B;  5DZU A;  2O1G A;  2FFV A;  3BRD A;  4KPZ A;  3IIR A;  2KI6 B;  1HJL A;  5C4E A;  2Y7A A;  1G95 A;  4CVH A;  1MD6 A;  1QXM A;  1R82 A;  1R8N A;  4LO2 A;  1G23 A;  2F2F C;  1QGS A;  4JD0 A;  5FTV A;  1JY0 A;  4QC4 A;  2QGI A;  3SX5 A;  3HOM A;  4ZKT B;  4FRP A;  3FJB A;  2FFU A;  3OBR A;  1S0B A;  4QBC A;  1HWM B;  2WRY A;  1H5R A;  1H4C A;  1H4E A;  4ION A;  4OWK A;  2X5Z A;  3CKJ A;  4M4K A;  5C4F A;  5EIY A;  4FRE A;  4KC3 A;  3D7W B;  4ZOT A;  1TOO A;  1PZT A;  4G3S A;  4B3U A;  3AKG A;  5FNX A;  4DEP A;  2FYB A;  4OW4 A;  4XKI A;  1G9B A;  3HL3 A;  5CQN X;  4HR6 C;  4OWL A;  2AEC A;  2K4A B;  1H7T A;  4CJ8 A;  3FJC A;  1YP2 A;  3NJ5 A;  3Q7U A;  4O6M A;  5DDT A;  5BQU A;  3K8E A;  4D11 C;  3PHZ A;  4IZE A;  1JT4 A;  4LO8 B;  1V6V A;  4I4U A;  2RIZ A;  2JCL A;  4FIY A;  2D7I A;  3FWW A;  3WO3 A;  2HWA A;  1FO9 A;  4I4S A;  2WEE A;  4ISR A;  5FU0 A;  4FRA A;  2ZR1 B;  4FQW A;  4I1E A;  4GOV A;  4ZFW B;  1ZJP A;  5C4B A;  3BB2 A;  3IM5 A;  2J0A A;  3OJV A;  4ZDQ A;  3SX8 A;  1XZZ A;  5L6S A;  1ZDF A;  2RIT A;  3KIA A;  3SPT A;  2I1B A;  3LLP A;  1G93 A;  3TQD A;  3AH4 A;  3T8S A;  3SXB A;  2VK9 A;  3SXA A;  1V6U A;  1AF9 A;  2VLC A;  3CRG A;  1GX0 A;  2ICX A;  2YCM A;  4Z9W B;  4G1R A;  2BFH A;  2JCO A;  1VZX A;  2NM1 A;  1DZC A;  5BOW A;  4Y7V A;  5FU8 A;  1GWV A;  1MP3 A;  5EHA A;  4ISQ A;  1R7Y A;  4FRQ A;  4XFU A;  2VU9 A;  2KKI A;  5IFY A;  2D23 A;  3V0A B;  1VIC A;  5JLV A;  4IHZ A;  4B4B A;  4OWJ A;  1XZ6 A;  5C49 A;  1G9D A;  1GQ9 A;  1FWV A;  4ASY A;  2XWN A;  3POK A;  2ESU A;  5DUY A;  1V83 A;  3SXG A;  1ISZ A;  3V8Y A;  1BA7 A;  5C1L A;  4PC4 A;  2GGQ A;  5FV9 A;  3OJ2 A;  3CAH A;  1WD4 A;  2AFG A;  1FO8 A;  5BXS A;  3BAU A;  3I0I X;  2DRE A;  5BXR A;  3D5N A;  2YQC A;  3FJ8 A;  1BFF A;  3BA4 A;  3HBW A;  5D61 A;  31BI A;  3AZV A;  3HSM A;  3O5W B;  2AGD A;  1RML A;  3N0K A;  1MC9 A;  2E8B A;  7I1B A;  4P0J A;  2Y4J A;  3OKR A;  3OH2 A;  4KC4 A;  1H7E A;  1BFC A;  4B4M A;  3T7M A;  3POL A;  4KNR A;  3V0Q A;  1RY7 A;  2X2S A;  1FG5 N;  1ISY A;  4FVV A;  5AJP A;  2DPW A;  2ZU8 A;  4P00 A;  3BAH A;  4D0Z A;  1ISV A;  4GOY A;  1TW5 A;  1H5S B;  3U2U A;  2RIY A;  3F1Y A;  1S0G A;  3FJD A;  3TC2 A;  2NYY A;  5D63 A;  4I0Y A;  4J2Y A;  1R7T A;  2QYI B;  5BXP A;  2RJ8 A;  3MAL A;  3UDA A;  5BP5 C;  1VGU A;  2WVM A;  5CMI A;  5DSS B;  4KEK A;  3UD7 A;  1ZIZ A;  4Y9X A;  1GWW A;  3U2V A;  3V0P A;  4CJM A;  1T9F A;  5CMJ A;  3I0L A;  1S0D A;  1KWS A;  5BXC A;  1VGW A;  1A8D A;  1S0C A;  1ZI1 A;  1H3M A;  2OEG A;  2YC3 A;  2WAW A;  3AJ6 A;  3MPP G;  4F83 A;  4YS8 A;  3ZC8 A;  2L5X A;  4END A;  2FYD B;  2P73 A;  1VM8 A;  2BO8 A;  2OI5 A;  3EE5 A;  1L2H A;  3Q7Y A;  4LO1 C;  3I0F A;  4DDZ A;  3U0X A;  3R4U A;  4EFR A;  3I0E A;  4A7Z A;  3A07 A;  2FYA A;  4ASJ A;  4E1K A;  3BAD A;  5IDT A;  1FMZ A;  1UPS A;  5G00 A;  4G3Q A;  3WO4 A;  4BMA A;  4KEI A;  3BTA A;  1IRA X;  1TTU A;  5C1G A;  5J49 A;  1YP3 A;  1FGG A;  1JT7 A;  4DEN A;  2QN4 A;  21BI A;  3IAG C;  1JV3 A;  2V0K A;  3CKN A;  4Y64 A;  3V0O A;  2Y4L A;  1EPW A;  4X38 A;  1GQC A;  1LVW A;  1LZI A;  2RJ7 A;  4JRA A;  2W0V A;  3CGX A;  3RMV A;  3V0N A;  4I4P A;  1JYL A;  4LO3 C;  1FWY A;  4G87 A;  3CA3 A;  4KT7 A;  4JIS A;  4QKR A;  1I52 A;  3ZLL A;  1LL2 A;  1N4K A;  4ZGR B;  2MLL B;  4UY4 A;  2VFZ A;  4FCE A;  3V91 A;  4EEO A;  1DQO A;  2FY7 A;  3P6J A;  2ZU7 A;  2VSE A;  4NAI A;  4KRV A;  3ILA A;  4HO2 A;  2J3P A;  2OI7 A;  1G82 A;  1O23 B;  3CA1 A;  4C2S A;  1GX4 A;  2DS0 A;  4J18 A;  1WBC A;  1P63 A;  3FJF A;  4KBB A;  3AKI A;  2VUA A;  4Q9G A;  1OMZ A;  4HG6 A;  3I0G A;  3H6S E;  2OI6 A;  3RMX A;  2AM3 A;  4JPZ A;  3VSF A;  3BRF A;  4ZFU B;  3I2A A;  1W55 A;  1JQZ A;  1JTC A;  4II0 A;  2Y6P A;  4AN7 B;  4Y7T A;  2WE9 A;  3SNV A;  4B4G A;  3R2W A;  4IRQ A;  3I2X A;  3QR5 A;  1ZDG A;  4Y6U A;  5FYE A;  1JLX A;  2BO6 A;  4I37 A;  2MIB A;  5FZU A;  1TW1 A;  2XWL A;  3AKH A;  1HM0 A;  1LL0 A;  1TP0 A;  2GGO A;  5F90 A;  1HKN A;  3RMY A;  4WBC A;  2YES A;  1S0F A;  3D8V A;  3OH0 A;  3U2W A;  5HPZ A;  4G9M A;  4OEG A;  2QH5 A;  4IZX A;  1ON8 A;  3BAG A;  3K1X A;  5C3A A;  4Q91 A;  5C1H A;  3DK5 A;  1LZ7 A;  3V0B B;  2BO7 A;  1G2V A;  2XMH A;  4B2X A;  1TVY A;  1ZJ3 A;  5FZY A;  2Y9X E;  3F1R A;  4HA2 A;  3WO2 A;  4I4Q A;  4EVW A;  3AJ5 A;  4DE7 A;  1OMX A;  4ZBV B;  5HS2 A;  3BAQ A;  4TLP A;  4X39 A;  1DQG A;  2HW9 A;  4L4I A;  2V0L A;  4EEA A;  3ZLK A;  1II4 A;  1O7Q A;  3GUE A;  3FJI A;  3H6Q A;  4R7P A;  1ILR 1;  5CQM X;  1EVT A;  4LO0 A;  1Q03 A;  1MC3 A;  4HO6 A;  3BRG C;  1R7V A;  1I1E A;  4NAK A;  1FRW A;  5CMG X;  2AH9 A;  4KNX A;  1IIL A;  3JTJ A;  2WGZ A;  3AZW A;  3BA7 A;  3KMV A;  2JCK A;  5FTS A;  4A7K A;  3V90 A;  3DJ4 A;  2KH2 A;  3O4B A;  1G97 A;  1D0H A;  1JT5 A;  2I5K A;  2AAI B;  2RJ1 A;  1IHK A;  2BEB A;  3BRK X;  3I0K A;  3N9W A;  4HO5 A;  5CQL X;  2NZ9 A;  1H7F A;  3D98 A;  1FQ9 A;  1W3F A;  4QKS A;  3VT1 A;  3WA1 A;  1FZW A;  1O7O A;  1H5T B;  2Z86 A;  4NAN A;  4JQ0 A;  1HWO B;  4LO2 C;  4G6J A;  2NS2 A;  1HJJ A;  1OQM B;  4GAI A;  1VZU A;  2RJ9 A;  3ZXG A;  1ZI4 A;  3A23 A;  2AM5 A;  5C4D A;  3O4C A;  2MZB A;  1E0O A;  4JAW A;  3CQA A;  1DFQ A;  2VXT I;  1ZJ2 A;  4I2S A;  2I7B A;  3F1C A;  4IRP A;  4MND A;  4P02 A;  1WT3 A;  3UD8 A;  4I4R A;  3ZGF A;  4M2A A;  3V79 C;  2JCJ A;  3DUV A;  3CRI A;  1HIB A;  4J2K A;  5BQU C;  4I4V A;  4KPX A;  4J23 B;  5GAQ A;  3VUO A;  4ARW A;  4LO7 C;  5C3D A;  3BAO A;  1AVU A;  2DRZ A;  2O1F A;  3ZF8 A;  5CMF X;  3A22 A;  2D24 A;  2PGV A;  3NBC A;  1QG8 A;  1V84 A;  3P6I A;  1AVW B;  4H75 A;  4ZFY B;  1QWJ A;  2PX7 A;  3CKO A;  3OH3 A;  1VH3 A;  4EB2 B;  1IIN A;  9ILB A;  1HWP B;  4I1B A;  5FNW A;  5AJN A;  1BAR A;  3V0A A;  3IOH A;  3VT0 A;  2AQZ A;  5I1B A;  1IRP A;  3LW6 A;  4DEC A;  3FJE A;  2GO2 A;  5CQP A;  1NUN A;  3W9T A;  4D0T A;  4I96 A;  1OQL B;  3UD9 A;  2P23 A;  5F8W A;  3WIN A;  1PUU B;  3AH2 A;  1LZJ A;  1NQI B;  1VPA A;  3H6R B;  2YC5 A;  4M2B A;  3RMW A;  2RIX A;  3CA4 A;  1WD3 A;  1YBI A;  3BCV A;  4NAL A;  4FCU A;  1FR9 A;  3I0D A;  1INI A;  2VXR A;  3VWC A;  4JKQ A;  3PKP A;  2RQ9 A;  4KXO A;  1HWN B;  1YRO B;  4CJC A;  1K5V A;  3AH1 A;  2E4M A;  3OJM A;  1V6X A;  4KC1 A;  1YF8 B;  5AJO A;  1KNM A;  1R80 A;  3N7L A;  4I6I A;  3S8K A;  1BFG A;  1QQK A;  1QGQ A;  3LTQ A;  1T4Q A;  1VGZ A;  3Q80 A;  5D91 A;  4AC3 A;  1CVS A;  3I29 B;  4X37 A;  3P53 A;  5F8S A;  4EKX B;  4P0K A;  4QD2 C;  2A8U A;  2AXM A;  1H5S A;  1ISW A;  1NMM B;  2D22 A;  2P6W A;  2UX8 A;  4IY9 A;  3IM7 A;  3S8J A;  1XHB A;  2D1Z A;  3N7M A;  1JVD A;  3O4A A;  3OAM A;  4FRL A;  4P6A A;  2AM4 A;  5L6V A;  1PC8 B;  3ZX7 A;  4CJB A;  1FMM S;  2D44 A;  1FOA A;  1M16 A;  4X3A A;  4JP0 A;  4EEM A;  1ZJ0 A;  2VS5 A;  1SR4 C;  3OBT A;  4ZA3 B;  4L41 C;  5C3B A;  4Q7C A;  1FGA A;  2V0I A;  2APC A;  2F2F A;  1XG6 A;  1H5S D;  4KC2 A;  3ZGG A;  3BAV A;  3B9U A;  3VSZ A;  4AN6 A;  3VT2 A;  1NF5 B;  4FRD A;  3NBN A;  3IOJ A;  4HO4 A;  1FWU A;  1PUM B;  3N7J A;  3O4O A;  2WVL A;  4FRM A;  3O44 A;  4EFQ A;  4GAF A;  2ZU9 A;  4P0L A;  2A8W A;  2D7R A;  4QO3 A;  2VSI A;  2FDB M;  4OEF A;  3CKQ A;  1EYL A;  2FGF A;  1S4P A;  3R3I A;  2YQS A;  5DVH A;  5FUH A;  1PZZ A;  1G9C A;  2X5S A;  3PNN A;  2VXM A;  4Y62 A;  2XOA A;  3USQ A;  4D11 A;  2R9K B;  2VSA A;  1K4V A;  2MC2 A;  2FO1 A;  2V0H A;  4ZLB B;  4XWI A;  3FJJ A;  1W57 A;  3U2T A;  5C38 A;  4AYJ A;  5I1F A;  1R7U A;  1AXM A;  3NBD A;  3EF2 A;  3I0J A;  4Y7G A;  4EE3 A;  4G3P A;  4EE4 A;  1Z90 A;  5D92 A;  1WVC A;  1DIW A;  1AFC A;  2ZQN A;  2ICY A;  2IWT B;  4HJJ A;  1QQL A;  2YQJ A;  1S4O A;  2RG9 B;  3N7K A;  5D62 A;  3I0C A;  4EE5 A;  5EJ1 A;  2P39 A;  3K8D A;  1HM8 A;  2FYC B;  2NTD A;  2VSH A;  1G9R A;  5C48 A;  3OH4 A;  4HCQ A;  1ZJO A;  3NBE A;  4LW6 A;  1CE7 B;  1DZD A;  3NGW A;  3IOI A;  2XWM A;  1M2T B;  4HO9 A;  3A21 A;  4Y63 A;  4I4O A;  4LO7 B;  1WT2 A;  2Y4M A;  4M28 A;  2Y4K A;  3SXC A;  1JV1 A;  3V0M A;  2X2T A;  1HM9 A;  2K43 A;  1WSZ A;  2J0B A;  3E8L C;  1ON6 A;  4EEE B;  2RJ0 A;  2WVK A;  1IJT A;  3OGZ A;  3T7O A;  3WMV A;  4AAW A;  4QBV A;  1R8O A;  5BXT A;  2NVH A;  1ZI3 A;  1W3G A;  2D0J A;  3PKQ A;  5C8R A;  4FIX A;  4I4X A;  3V0B A;  3UJ4 A;  4YOL A;  1FXJ A;  4B5B A;  1BLA A;  4FRO A;  2RJ6 A;  4H9W A;  3SX7 A;  4B2W A;  3U2X A;  4D48 A;  3O49 A;  2D20 A;  4HOC A;  4LW3 A;  1WBA A;  3Q7W A;  1MP5 A;  2X65 A;  5FZZ A;  1YYN A;  3FUQ A;  1JYK A;  2RJ4 A;  3OC9 A;  1XYF A;  1F31 A;  2KI4 A;  4I3N A;  3RTI B;  1WT1 A;  1IT0 A;  1TWE A;  2ET2 A;  4R6U B;  1RG8 A;  2GZB A;  1LL3 A;  2C0N A;  3ST8 A;  3CA0 A;  3BA5 A;  4G6M A;  4F34 A;  3C9Z A;  4GBP A;  3FGM A;  1EV2 A;  6I1B A;  4MZH A;  41BI A;  2Z49 A;  1G8O A;  2AE7 A;  4MZF B;  3JUJ A;  4MYB A;  4OEE A;  5BVP I;  1EZI A;  1Q1U A;  2VXL A;  3HAL A;  3JUT A;  1S4N A;  1Z2V A;  5B2H A;  3HN1 A;  4QD2 B;  3SX3 A;  5DDV A;  1ITB A;  4USO A;  1ZJ1 A;  3VEQ A;  5JMC A;  1HV9 A;  1G0R A;  1ZHJ A;  1GGP B;  1W77 A;  1H5T A;  3SXE A;  2HZ9 A;  4LO0 C;  5BP5 A;  3OGF A;  3CKV A;  1E5K A;  4IYB A;  3T7N A;  1BLD A;  2LIE A;  4J2X A;  2AES A;  5F8Y A;  1BAS A;  2KLL A;  1I1B A;  4FRB A;  1IOB A;  2VS3 A;  2CU2 A;  1Z0H A;  1TWM A;  4Z8S B;  1H7H A;  2D43 A;  2Q9X A;  4MZG B;  1HCD A;  2ERM A;  1Z4S A;  4EFP A;  4LO1 A;  3CA6 A;  4Y6N A;  1FR8 A;  4B42 A;  3O4D A;  3V8Z A;  1DLL A;  2OEF A;  3OGG A;  3CU0 A;  3QVB A;  1FV2 A;  4A7Y A;  1S0L A;  3ZC9 A;  4J2S A;  8I1B A;  1NKH B;  3BX1 C;  1ZCT A;  3JRR A;  3O3P A;  3F62 B;  1NWG B;  3I0H A;  3IM6 A;  5C4C A;  1G3L A;  1MP4 A;  2W0W A;  4GP0 A;  4K6R A;  2XME A;  3TZT A;  1FGX A;  1ZCY A;  2Z87 A;  4LO3 A;  2Y9F A;  3FJA A;  4JKX B;  1EYR A;  1YTO A;  1SR4 A;  1FN0 A;  2Y9W C;  1ZCV A;  1FV3 A;  2NXV A;  4IQP A;  4XFS A;  3UJ0 A;  1JVG A;  2VD4 A;  2ZQO A;  3E25 A;  4Y7F A;  3U0Y A;  1R7X A;  4MIX A;  3RSB A;  3PUB A;  2Q4J A;  2VS4 A;  4FRH A;  3E26 A;  3FJK A;  1V82 A;  3JUK A;  5IDS A;  3O3Q A;  4OUJ A;  2BO4 A;  3RSJ A;  4G9N A;  1TZF A;  3V0L A;  5CMH A;  2HWM A;  4I8M A;  1H7G A;  1VZT A;  1J0S A;  3SXD A;  4L4H A;  3H6R A;  1S0E A; 
#chains in the Genus database with same CATH homology
 3USR A;  3RTJ B;  1V6W A;  1VGT A;  4IY8 A;  4EEG A;  4XFT A;  4AYL A;  1Q04 A;  2Z48 A;  5E24 E;  3Q4S A;  1AVA C;  1VH1 A;  1VCL A;  4ECM A;  1PZY B;  1ISX A;  2K8R A;  4Q9P A;  5EC5 A;  3HMY A;  1LZ0 A;  2O1H A;  1NZK A;  1H4D A;  4HO8 A;  2M49 A;  4O6N A;  1H7Q A;  2PA4 A;  2P72 A;  3WIN C;  4HO0 A;  2IHO A;  1ABR B;  2X60 A;  1AVX B;  1TIE A;  5C47 A;  1FXO A;  4HO3 A;  5C36 A;  3FFZ A;  3FJH A;  1INJ A;  2PGY A;  2YQH A;  3FOQ A;  5EJZ A;  1BFB A;  4KEJ A;  1O0R A;  1DJS B;  2LIQ A;  2NP0 A;  2I5E A;  1ZCU A;  3QYD A;  4Y7U A;  4BQH A;  4H04 A;  2E4M C;  1YP4 A;  3ZXD A;  4KQL A;  2F8X C;  5EG6 C;  1G9A A;  3FJ9 A;  1JLY A;  2Q3N B;  3CA5 A;  4I7I A;  1WT0 A;  1ZI5 A;  2E3D A;  5JQQ A;  2DRY A;  1H5R B;  1W3A A;  3R4S A;  2QKX A;  4UEG A;  4DCK C;  4FGF A;  4I4Y A;  1ONK B;  3WMU A;  1H5S C;  3PG0 A;  1HCE A;  5CQO A;  2Y9G A;  2UUS A;  1JT3 A;  1H7L A;  3CU1 B;  1NHE B;  1R81 A;  2RJ5 A;  3CRH A;  3OH1 A;  4QAL A;  1IIM A;  2V0J A;  1K5U A;  1TFM B;  1PWA A;  1DFC A;  2YUG A;  3PME A;  2BEA A;  3AKF A;  4GP3 A;  4USP A;  1SZ6 B;  2WBC A;  4D8H A;  1G1L A;  1GA8 A;  1SS9 A;  3Q7X A;  1YXW A;  2RST A;  3FUO A;  1RZO B;  5DZU A;  2O1G A;  2FFV A;  3BRD A;  4KPZ A;  3IIR A;  2KI6 B;  1HJL A;  5C4E A;  2Y7A A;  1G95 A;  4CVH A;  1MD6 A;  1QXM A;  1R82 A;  1R8N A;  4LO2 A;  1G23 A;  2F2F C;  1QGS A;  4JD0 A;  5FTV A;  1JY0 A;  4QC4 A;  2QGI A;  3SX5 A;  3HOM A;  4ZKT B;  4FRP A;  3FJB A;  2FFU A;  3OBR A;  1S0B A;  4QBC A;  1HWM B;  2WRY A;  1H5R A;  1H4C A;  1H4E A;  4ION A;  4OWK A;  2X5Z A;  3CKJ A;  4M4K A;  5C4F A;  5EIY A;  4FRE A;  4KC3 A;  3D7W B;  4ZOT A;  1TOO A;  1PZT A;  4G3S A;  4B3U A;  3AKG A;  5FNX A;  4DEP A;  2FYB A;  4OW4 A;  4XKI A;  1G9B A;  3HL3 A;  5CQN X;  4HR6 C;  4OWL A;  2AEC A;  2K4A B;  1H7T A;  4CJ8 A;  3FJC A;  1YP2 A;  3NJ5 A;  3Q7U A;  4O6M A;  5DDT A;  5BQU A;  3K8E A;  4D11 C;  3PHZ A;  4IZE A;  1JT4 A;  4LO8 B;  1V6V A;  4I4U A;  2RIZ A;  2JCL A;  4FIY A;  2D7I A;  3FWW A;  3WO3 A;  2HWA A;  1FO9 A;  4I4S A;  2WEE A;  4ISR A;  5FU0 A;  4FRA A;  2ZR1 B;  4FQW A;  4I1E A;  4GOV A;  4ZFW B;  1ZJP A;  5C4B A;  3BB2 A;  3IM5 A;  2J0A A;  3OJV A;  4ZDQ A;  3SX8 A;  1XZZ A;  5L6S A;  1ZDF A;  2RIT A;  3KIA A;  3SPT A;  2I1B A;  3LLP A;  1G93 A;  3TQD A;  3AH4 A;  3T8S A;  3SXB A;  2VK9 A;  3SXA A;  1V6U A;  1AF9 A;  2VLC A;  3CRG A;  1GX0 A;  2ICX A;  2YCM A;  4Z9W B;  4G1R A;  2BFH A;  2JCO A;  1VZX A;  2NM1 A;  1DZC A;  5BOW A;  4Y7V A;  5FU8 A;  1GWV A;  1MP3 A;  5EHA A;  4ISQ A;  1R7Y A;  4FRQ A;  4XFU A;  2VU9 A;  2KKI A;  5IFY A;  2D23 A;  3V0A B;  1VIC A;  5JLV A;  4IHZ A;  4B4B A;  4OWJ A;  1XZ6 A;  5C49 A;  1G9D A;  1GQ9 A;  1FWV A;  4ASY A;  2XWN A;  3POK A;  2ESU A;  5DUY A;  1V83 A;  3SXG A;  1ISZ A;  3V8Y A;  1BA7 A;  5C1L A;  4PC4 A;  2GGQ A;  5FV9 A;  3OJ2 A;  3CAH A;  1WD4 A;  2AFG A;  1FO8 A;  5BXS A;  3BAU A;  3I0I X;  2DRE A;  5BXR A;  3D5N A;  2YQC A;  3FJ8 A;  1BFF A;  3BA4 A;  3HBW A;  5D61 A;  31BI A;  3AZV A;  3HSM A;  3O5W B;  2AGD A;  1RML A;  3N0K A;  1MC9 A;  2E8B A;  7I1B A;  4P0J A;  2Y4J A;  3OKR A;  3OH2 A;  4KC4 A;  1H7E A;  1BFC A;  4B4M A;  3T7M A;  3POL A;  4KNR A;  3V0Q A;  1RY7 A;  2X2S A;  1FG5 N;  1ISY A;  4FVV A;  5AJP A;  2DPW A;  2ZU8 A;  4P00 A;  3BAH A;  4D0Z A;  1ISV A;  4GOY A;  1TW5 A;  1H5S B;  3U2U A;  2RIY A;  3F1Y A;  1S0G A;  3FJD A;  3TC2 A;  2NYY A;  5D63 A;  4I0Y A;  4J2Y A;  1R7T A;  2QYI B;  5BXP A;  2RJ8 A;  3MAL A;  3UDA A;  5BP5 C;  1VGU A;  2WVM A;  5CMI A;  5DSS B;  4KEK A;  3UD7 A;  1ZIZ A;  4Y9X A;  1GWW A;  3U2V A;  3V0P A;  4CJM A;  1T9F A;  5CMJ A;  3I0L A;  1S0D A;  1KWS A;  5BXC A;  1VGW A;  1A8D A;  1S0C A;  1ZI1 A;  1H3M A;  2OEG A;  2YC3 A;  2WAW A;  3AJ6 A;  3MPP G;  4F83 A;  4YS8 A;  3ZC8 A;  2L5X A;  4END A;  2FYD B;  2P73 A;  1VM8 A;  2BO8 A;  2OI5 A;  3EE5 A;  1L2H A;  3Q7Y A;  4LO1 C;  3I0F A;  4DDZ A;  3U0X A;  3R4U A;  4EFR A;  3I0E A;  4A7Z A;  3A07 A;  2FYA A;  4ASJ A;  4E1K A;  3BAD A;  5IDT A;  1FMZ A;  1UPS A;  5G00 A;  4G3Q A;  3WO4 A;  4BMA A;  4KEI A;  3BTA A;  1IRA X;  1TTU A;  5C1G A;  5J49 A;  1YP3 A;  1FGG A;  1JT7 A;  4DEN A;  2QN4 A;  21BI A;  3IAG C;  1JV3 A;  2V0K A;  3CKN A;  4Y64 A;  3V0O A;  2Y4L A;  1EPW A;  4X38 A;  1GQC A;  1LVW A;  1LZI A;  2RJ7 A;  4JRA A;  2W0V A;  3CGX A;  3RMV A;  3V0N A;  4I4P A;  1JYL A;  4LO3 C;  1FWY A;  4G87 A;  3CA3 A;  4KT7 A;  4JIS A;  4QKR A;  1I52 A;  3ZLL A;  1LL2 A;  1N4K A;  4ZGR B;  2MLL B;  4UY4 A;  2VFZ A;  4FCE A;  3V91 A;  4EEO A;  1DQO A;  2FY7 A;  3P6J A;  2ZU7 A;  2VSE A;  4NAI A;  4KRV A;  3ILA A;  4HO2 A;  2J3P A;  2OI7 A;  1G82 A;  1O23 B;  3CA1 A;  4C2S A;  1GX4 A;  2DS0 A;  4J18 A;  1WBC A;  1P63 A;  3FJF A;  4KBB A;  3AKI A;  2VUA A;  4Q9G A;  1OMZ A;  4HG6 A;  3I0G A;  3H6S E;  2OI6 A;  3RMX A;  2AM3 A;  4JPZ A;  3VSF A;  3BRF A;  4ZFU B;  3I2A A;  1W55 A;  1JQZ A;  1JTC A;  4II0 A;  2Y6P A;  4AN7 B;  4Y7T A;  2WE9 A;  3SNV A;  4B4G A;  3R2W A;  4IRQ A;  3I2X A;  3QR5 A;  1ZDG A;  4Y6U A;  5FYE A;  1JLX A;  2BO6 A;  4I37 A;  2MIB A;  5FZU A;  1TW1 A;  2XWL A;  3AKH A;  1HM0 A;  1LL0 A;  1TP0 A;  2GGO A;  5F90 A;  1HKN A;  3RMY A;  4WBC A;  2YES A;  1S0F A;  3D8V A;  3OH0 A;  3U2W A;  5HPZ A;  4G9M A;  4OEG A;  2QH5 A;  4IZX A;  1ON8 A;  3BAG A;  3K1X A;  5C3A A;  4Q91 A;  5C1H A;  3DK5 A;  1LZ7 A;  3V0B B;  2BO7 A;  1G2V A;  2XMH A;  4B2X A;  1TVY A;  1ZJ3 A;  5FZY A;  2Y9X E;  3F1R A;  4HA2 A;  3WO2 A;  4I4Q A;  4EVW A;  3AJ5 A;  4DE7 A;  1OMX A;  4ZBV B;  5HS2 A;  3BAQ A;  4TLP A;  4X39 A;  1DQG A;  2HW9 A;  4L4I A;  2V0L A;  4EEA A;  3ZLK A;  1II4 A;  1O7Q A;  3GUE A;  3FJI A;  3H6Q A;  4R7P A;  1ILR 1;  5CQM X;  1EVT A;  4LO0 A;  1Q03 A;  1MC3 A;  4HO6 A;  3BRG C;  1R7V A;  1I1E A;  4NAK A;  1FRW A;  5CMG X;  2AH9 A;  4KNX A;  1IIL A;  3JTJ A;  2WGZ A;  3AZW A;  3BA7 A;  3KMV A;  2JCK A;  5FTS A;  4A7K A;  3V90 A;  3DJ4 A;  2KH2 A;  3O4B A;  1G97 A;  1D0H A;  1JT5 A;  2I5K A;  2AAI B;  2RJ1 A;  1IHK A;  2BEB A;  3BRK X;  3I0K A;  3N9W A;  4HO5 A;  5CQL X;  2NZ9 A;  1H7F A;  3D98 A;  1FQ9 A;  1W3F A;  4QKS A;  3VT1 A;  3WA1 A;  1FZW A;  1O7O A;  1H5T B;  2Z86 A;  4NAN A;  4JQ0 A;  1HWO B;  4LO2 C;  4G6J A;  2NS2 A;  1HJJ A;  1OQM B;  4GAI A;  1VZU A;  2RJ9 A;  3ZXG A;  1ZI4 A;  3A23 A;  2AM5 A;  5C4D A;  3O4C A;  2MZB A;  1E0O A;  4JAW A;  3CQA A;  1DFQ A;  2VXT I;  1ZJ2 A;  4I2S A;  2I7B A;  3F1C A;  4IRP A;  4MND A;  4P02 A;  1WT3 A;  3UD8 A;  4I4R A;  3ZGF A;  4M2A A;  3V79 C;  2JCJ A;  3DUV A;  3CRI A;  1HIB A;  4J2K A;  5BQU C;  4I4V A;  4KPX A;  4J23 B;  5GAQ A;  3VUO A;  4ARW A;  4LO7 C;  5C3D A;  3BAO A;  1AVU A;  2DRZ A;  2O1F A;  3ZF8 A;  5CMF X;  3A22 A;  2D24 A;  2PGV A;  3NBC A;  1QG8 A;  1V84 A;  3P6I A;  1AVW B;  4H75 A;  4ZFY B;  1QWJ A;  2PX7 A;  3CKO A;  3OH3 A;  1VH3 A;  4EB2 B;  1IIN A;  9ILB A;  1HWP B;  4I1B A;  5FNW A;  5AJN A;  1BAR A;  3V0A A;  3IOH A;  3VT0 A;  2AQZ A;  5I1B A;  1IRP A;  3LW6 A;  4DEC A;  3FJE A;  2GO2 A;  5CQP A;  1NUN A;  3W9T A;  4D0T A;  4I96 A;  1OQL B;  3UD9 A;  2P23 A;  5F8W A;  3WIN A;  1PUU B;  3AH2 A;  1LZJ A;  1NQI B;  1VPA A;  3H6R B;  2YC5 A;  4M2B A;  3RMW A;  2RIX A;  3CA4 A;  1WD3 A;  1YBI A;  3BCV A;  4NAL A;  4FCU A;  1FR9 A;  3I0D A;  1INI A;  2VXR A;  3VWC A;  4JKQ A;  3PKP A;  2RQ9 A;  4KXO A;  1HWN B;  1YRO B;  4CJC A;  1K5V A;  3AH1 A;  2E4M A;  3OJM A;  1V6X A;  4KC1 A;  1YF8 B;  5AJO A;  1KNM A;  1R80 A;  3N7L A;  4I6I A;  3S8K A;  1BFG A;  1QQK A;  1QGQ A;  3LTQ A;  1T4Q A;  1VGZ A;  3Q80 A;  5D91 A;  4AC3 A;  1CVS A;  3I29 B;  4X37 A;  3P53 A;  5F8S A;  4EKX B;  4P0K A;  4QD2 C;  2A8U A;  2AXM A;  1H5S A;  1ISW A;  1NMM B;  2D22 A;  2P6W A;  2UX8 A;  4IY9 A;  3IM7 A;  3S8J A;  1XHB A;  2D1Z A;  3N7M A;  1JVD A;  3O4A A;  3OAM A;  4FRL A;  4P6A A;  2AM4 A;  5L6V A;  1PC8 B;  3ZX7 A;  4CJB A;  1FMM S;  2D44 A;  1FOA A;  1M16 A;  4X3A A;  4JP0 A;  4EEM A;  1ZJ0 A;  2VS5 A;  1SR4 C;  3OBT A;  4ZA3 B;  4L41 C;  5C3B A;  4Q7C A;  1FGA A;  2V0I A;  2APC A;  2F2F A;  1XG6 A;  1H5S D;  4KC2 A;  3ZGG A;  3BAV A;  3B9U A;  3VSZ A;  4AN6 A;  3VT2 A;  1NF5 B;  4FRD A;  3NBN A;  3IOJ A;  4HO4 A;  1FWU A;  1PUM B;  3N7J A;  3O4O A;  2WVL A;  4FRM A;  3O44 A;  4EFQ A;  4GAF A;  2ZU9 A;  4P0L A;  2A8W A;  2D7R A;  4QO3 A;  2VSI A;  2FDB M;  4OEF A;  3CKQ A;  1EYL A;  2FGF A;  1S4P A;  3R3I A;  2YQS A;  5DVH A;  5FUH A;  1PZZ A;  1G9C A;  2X5S A;  3PNN A;  2VXM A;  4Y62 A;  2XOA A;  3USQ A;  4D11 A;  2R9K B;  2VSA A;  1K4V A;  2MC2 A;  2FO1 A;  2V0H A;  4ZLB B;  4XWI A;  3FJJ A;  1W57 A;  3U2T A;  5C38 A;  4AYJ A;  5I1F A;  1R7U A;  1AXM A;  3NBD A;  3EF2 A;  3I0J A;  4Y7G A;  4EE3 A;  4G3P A;  4EE4 A;  1Z90 A;  5D92 A;  1WVC A;  1DIW A;  1AFC A;  2ZQN A;  2ICY A;  2IWT B;  4HJJ A;  1QQL A;  2YQJ A;  1S4O A;  2RG9 B;  3N7K A;  5D62 A;  3I0C A;  4EE5 A;  5EJ1 A;  2P39 A;  3K8D A;  1HM8 A;  2FYC B;  2NTD A;  2VSH A;  1G9R A;  5C48 A;  3OH4 A;  4HCQ A;  1ZJO A;  3NBE A;  4LW6 A;  1CE7 B;  1DZD A;  3NGW A;  3IOI A;  2XWM A;  1M2T B;  4HO9 A;  3A21 A;  4Y63 A;  4I4O A;  4LO7 B;  1WT2 A;  2Y4M A;  4M28 A;  2Y4K A;  3SXC A;  1JV1 A;  3V0M A;  2X2T A;  1HM9 A;  2K43 A;  1WSZ A;  2J0B A;  3E8L C;  1ON6 A;  4EEE B;  2RJ0 A;  2WVK A;  1IJT A;  3OGZ A;  3T7O A;  3WMV A;  4AAW A;  4QBV A;  1R8O A;  5BXT A;  2NVH A;  1ZI3 A;  1W3G A;  2D0J A;  3PKQ A;  5C8R A;  4FIX A;  4I4X A;  3V0B A;  3UJ4 A;  4YOL A;  1FXJ A;  4B5B A;  1BLA A;  4FRO A;  2RJ6 A;  4H9W A;  3SX7 A;  4B2W A;  3U2X A;  4D48 A;  3O49 A;  2D20 A;  4HOC A;  4LW3 A;  1WBA A;  3Q7W A;  1MP5 A;  2X65 A;  5FZZ A;  1YYN A;  3FUQ A;  1JYK A;  2RJ4 A;  3OC9 A;  1XYF A;  1F31 A;  2KI4 A;  4I3N A;  3RTI B;  1WT1 A;  1IT0 A;  1TWE A;  2ET2 A;  4R6U B;  1RG8 A;  2GZB A;  1LL3 A;  2C0N A;  3ST8 A;  3CA0 A;  3BA5 A;  4G6M A;  4F34 A;  3C9Z A;  4GBP A;  3FGM A;  1EV2 A;  6I1B A;  4MZH A;  41BI A;  2Z49 A;  1G8O A;  2AE7 A;  4MZF B;  3JUJ A;  4MYB A;  4OEE A;  5BVP I;  1EZI A;  1Q1U A;  2VXL A;  3HAL A;  3JUT A;  1S4N A;  1Z2V A;  5B2H A;  3HN1 A;  4QD2 B;  3SX3 A;  5DDV A;  1ITB A;  4USO A;  1ZJ1 A;  3VEQ A;  5JMC A;  1HV9 A;  1G0R A;  1ZHJ A;  1GGP B;  1W77 A;  1H5T A;  3SXE A;  2HZ9 A;  4LO0 C;  5BP5 A;  3OGF A;  3CKV A;  1E5K A;  4IYB A;  3T7N A;  1BLD A;  2LIE A;  4J2X A;  2AES A;  5F8Y A;  1BAS A;  2KLL A;  1I1B A;  4FRB A;  1IOB A;  2VS3 A;  2CU2 A;  1Z0H A;  1TWM A;  4Z8S B;  1H7H A;  2D43 A;  2Q9X A;  4MZG B;  1HCD A;  2ERM A;  1Z4S A;  4EFP A;  4LO1 A;  3CA6 A;  4Y6N A;  1FR8 A;  4B42 A;  3O4D A;  3V8Z A;  1DLL A;  2OEF A;  3OGG A;  3CU0 A;  3QVB A;  1FV2 A;  4A7Y A;  1S0L A;  3ZC9 A;  4J2S A;  8I1B A;  1NKH B;  3BX1 C;  1ZCT A;  3JRR A;  3O3P A;  3F62 B;  1NWG B;  3I0H A;  3IM6 A;  5C4C A;  1G3L A;  1MP4 A;  2W0W A;  4GP0 A;  4K6R A;  2XME A;  3TZT A;  1FGX A;  1ZCY A;  2Z87 A;  4LO3 A;  2Y9F A;  3FJA A;  4JKX B;  1EYR A;  1YTO A;  1SR4 A;  1FN0 A;  2Y9W C;  1ZCV A;  1FV3 A;  2NXV A;  4IQP A;  4XFS A;  3UJ0 A;  1JVG A;  2VD4 A;  2ZQO A;  3E25 A;  4Y7F A;  3U0Y A;  1R7X A;  4MIX A;  3RSB A;  3PUB A;  2Q4J A;  2VS4 A;  4FRH A;  3E26 A;  3FJK A;  1V82 A;  3JUK A;  5IDS A;  3O3Q A;  4OUJ A;  2BO4 A;  3RSJ A;  4G9N A;  1TZF A;  3V0L A;  5CMH A;  2HWM A;  4I8M A;  1H7G A;  1VZT A;  1J0S A;  3SXD A;  4L4H A;  3H6R A;  1S0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...