2D7RA

Crystal structure of pp-galnac-t10 complexed with galnac-ser on lectin domain
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
536
structure length
536
Chain Sequence
GQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 10
publication title Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 155
structure length 536
sequence length 536
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2d7rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2d7rA01
3V0BA 4IRPA 4I96A 4I2SA 2VUAA 3I0GA 4G87A 5CQLX 1SZ6B 3JUTA 3Q7YA 1YP3A 2WEEA 1R82A 1TP0A 1OMXA 2Q3NB 3BADA 3BAUA 4ZA3B 2RJ9A 3I0LA 1R81A 5C4CA 4QBVA 2MLLB 3BAGA 5FZZA 4EB2B 3F1CA 2X2SA 4YS8A 2KI6B 2KLLA 2WAWA 3FWWA 4G9MA 2VLCA 4I1BA 4Z8SB 3AKGA 4DCKC 4OWLA 1VZUA 3OJVA 5EHAA 1NUNA 2RSTA 1LL0A 1DQGA 5IFYA 4NAIA 3O44A 4D11C 5C48A 1BA7A 5CQOA 1LZJA 4B4GA 4FROA 1QGSA 2BEBA 1MP3A 4X3AA 4EKXB 1Z90A 2O1FA 4KNRA 4R7PA 1ON8A 1DJSB 2JCKA 1H3MA 4J2YA 5C3AA 1QXMA 2P23A 3UJ0A 4D0TA 2YUGA 2RQ9A 3BB2A 3NBEA 3FJAA 4GOVA 4HJJA 3VWCA 2YESA 3TC2A 3UDAA 1GWWA 4FCUA 4ZGRB 4USPA 1G3LA 4XWIA 1FXOA 2Y4KA 1H5RA 3NBCA 1MP4A 1WD3A 3CKQA 1EVTA 3I0FA 4I1EA 1G1LA 3V0MA 1H5SD 1VGUA 2VSIA 2I7BA 3OBTA 3CAHA 1H7GA 1CVSA 1EYLA 3I29B 4I7IA 3OJ2A 6I1BA 1K4VA 4Y6NA 4G9NA 1LL2A 4E1KA 1I1EA 5FUHA 4FRPA 4NAKA 3E8LC 3NGWA 1ZJ1A 4ZFUB 1BLDA 1S0GA 1LZIA 1T9FA 2V0KA 2RIZA 3SXBA 3SNVA 4CVHA 3OGFA 1ZI4A 4K6RA 4B42A 3O3QA 4D11A 1V6XA 2MC2A 1GQCA 4II0A 1BFCA 2Y9XE 4IY9A 4X37A 1G23A 3WA1A 2W0VA 2ZU7A 3OH1A 3F1YA 4B4MA 2D44A 1JV3A 4FRBA 1LL3A 4MNDA 2QYIB 2A8UA 2QN4A 2X5SA 1HCEA 1TVYA 1E5KA 1ZHJA 2FDBM 2Y9WC 3RMWA 3CA6A 3V0LA 2F2FC 3ILAA 1NWGB 4A7KA 1IOBA 2AAIB 3O4OA 1ISWA 5BXTA 3Q80A 4IYBA 5C38A 1GGPB 3S8JA 4A7ZA 3USRA 3B9UA 1FQ9A 1YBIA 5I1FA 4OWKA 5DVHA 3F1RA 3UJ4A 1K5VA 3QYDA 1NZKA 2ZQNA 2FGFA 3SPTA 2Q9XA 4QKSA 4Q91A 1G9DA 4G3PA 2X2TA 5JLVA 2BO4A 1VZTA 2I5KA 1VM8A 1Q04A 1FZWA 3CU0A 4PC4A 3I0IX 2KKIA 4OEGA 5CQMX 3ZLKA 3WO3A 4JAWA 1XZZA 1RZOB 1ISXA 4P00A 2VU9A 4QD2B 2A8WA 4KNXA 1YROB 1G9RA 4KPXA 1I1BA 1AF9A 1W3FA 3IAGC 1WD4A 4XKIA 4P0LA 3U2WA 5D63A 3FJFA 4I6IA 1F31A 1FRWA 3MALA 1E0OA 1ZI3A 1SS9A 4HA2A 4OEFA 5DUYA 2K43A 4QALA 1H7HA 3PKPA 4HO5A 1AVAC 3O4AA 2P73A 4Y62A 1W3AA 3NBDA 3EE5A 4FRQA 1YTOA 2W0WA 3QVBA 2D22A 4WBCA 2VS5A 1ZJ3A 1JVGA 1S0DA 3O4BA 3LTQA 7I1BA 1HJJA 5EJZA 4FRLA 1TW1A 2AM3A 1M16A 3AH1A 3AJ5A 2ZU9A 5FTSA 4TLPA 1VPAA 4HOCA 1FG5N 1YYNA 2D1ZA 4GAIA 1H4CA 4KEJA 1IRPA 3AH4A 1G82A 3D98A 3P53A 4M28A 3ST8A 3KMVA 4BQHA 2L5XA 2FYDB 1DZCA 1FR8A 5B2HA 9ILBA 2Y9FA 3LW6A 2RJ1A 3GUEA 3R2WA 2Z49A 2Y4LA 4FREA 3I0JA 4KBBA 1FV2A 3RTJB 2UX8A 5I1BA 2X65A 3PG0A 4Z9WB 4IRQA 1FGAA 1V84A 1G2VA 1ILR1 4LO3C 1NF5B 4B2WA 2APCA 1Z0HA 3R4UA 1S0BA 4I3NA 1R7YA 2ZU8A 4KC3A 3I0CA 3P6JA 2X60A 4FGFA 5C47A 1H7EA 4DDZA 3ZXDA 3KIAA 3BA7A 5FTVA 1RG8A 4L41C 4ZFWB 3AJ6A 4JPZA 1HJLA 4P0KA 5DZUA 1R7UA 4EFQA 2HW9A 3H6RB 1ON6A 5FV9A 2XOAA 2AXMA 5C8RA 1FMMS 1WBCA 4ZLBB 1H4EA 1ZCYA 3UD9A 2YQJA 4I0YA 4H04A 3VSFA 1YP4A 2P39A 3R4SA 1ZJ0A 5G00A 3RMVA 3SX8A 3JTJA 3H6RA 31BIA 1R7XA 2QH5A 3VT1A 1MP5A 3SXAA 3D5NA 3U2XA 5D62A 1IHKA 3BRKX 2I1BA 1INJA 1S4PA 2YQHA 3K8EA 3IM5A 5CQNX 4LO3A 1VGWA 4EVWA 1H5RB 2KH2A 3ZXGA 3CKNA 4D48A 4I4YA 1IRAX 1JT7A 5F8SA 4KPZA 4B3UA 3A23A 3EF2A 3CKVA 4ZFYB 1VICA 1TWMA 4ISRA 3T7OA 2FY7A 2PX7A 3R3IA 3ZGFA 1AVWB 5BXSA 3HN1A 3POLA 3H6SE 4X39A 4Q9PA 3FJCA 3BAOA 1PZTA 1WT3A 2V0HA 4KEKA 1Z2VA 4I4QA 4EEOA 5IDTA 4L4IA 4D8HA 4LO0A 3QR5A 2Y7AA 4Y7VA 4I4XA 4I37A 1T4QA 2GO2A 3MPPG 4EFRA 4KXOA 3SX5A 4LO8B 5EJ1A 1GQ9A 1DFQA 2YC5A 5HPZA 3Q7WA 2E4MC 2NP0A 5DDVA 4G6MA 1TFMB 1JT3A 4ENDA 2D23A 3BRDA 1SR4C 5FZYA 3BRGC 4QKRA 4GP0A 1I52A 2E3DA 3D7WB 1MC3A 2GZBA 3BTAA 4I8MA 4KEIA 2WVLA 3CA4A 2M49A 4ZBVB 1GX4A 1FMZA 2AH9A 1BFGA 1HWNB 1UPSA 2ERMA 1KNMA 1TW5A 2VXLA 3DJ4A 4B5BA 3N7KA 1LZ7A 1VH1A 2Q4JA 3SXEA 3CGXA 1R7VA 3BAVA 4QC4A 1H5SC 1VH3A 3OH0A 1FWYA 1ISYA 4G3SA 3JRRA 1WT0A 2JCLA 4HO3A 1HM9A 3WO2A 4Y9XA 4AAWA 5L6SA 3WMUA 1PWAA 2BFHA 3OH3A 1ZJOA 1HIBA 4KC1A 5AJNA 3V0AA 2D24A 5EC5A 4AN7B 3POKA 1YP2A 5C1LA 3W9TA 2LIEA 3RMXA 1S4NA 3K1XA 2ICYA 3U0YA 1PUMB 5HS2A 1GWVA 1S0CA 1W55A 2NXVA 1TIEA 1PUUB 2E4MA 1TZFA 4J18A 4Y7TA 5C49A 3ZGGA 2HWAA 1G9BA 1ZCTA 2ZR1B 4DE7A 1SR4A 3A22A 4FRDA 3RTIB 1G95A 2VXMA 2VSHA 1ISVA 3OKRA 2Y4MA 3TQDA 5BXPA 1JT4A 1JY0A 3ZLLA 1G97A 1HV9A 5BQUC 2ET2A 1A8DA 4ZDQA 5C4EA 5L6VA 1JT5A 3FJ9A 4IQPA 3ZC9A 3PMEA 4EEAA 4XFTA 5JMCA 1ISZA 3N0KA 4B4BA 3OJMA 4LO1C 4LO7C 1H7TA 2YQCA 2VFZA 2RG9B 3OGZA 1N4KA 1H7QA 3OAMA 2F2FA 4MYBA 1QG8A 3LLPA 1HWOB 4KQLA 1FXJA 2XWMA 4KRVA 5C3DA 3FJDA 2BEAA 4IY8A 1VGZA 4XFSA 4FQWA 3U2TA 2HWMA 1XYFA 3A21A 4GAFA 1NMMB 3FOQA 4JKXB 4X38A 3CRIA 1J0SA 5FU0A 2VSAA 1IILA 5E24E 1M2TB 1S0FA 1QGQA 1V83A 3DK5A 4USOA 3TZTA 1FWUA 3FUOA 3N7JA 1PZZA 4LO7B 3VEQA 2K8RA 3ZF8A 5C3BA 4KT7A 5DDTA 3I0DA 1HCDA 5F8YA 2NVHA 3CA5A 5BP5C 1ZJPA 2V0IA 2VD4A 5CMIA 4OWJA 3RSJA 5BQUA 3SXGA 5C4DA 1EV2A 2E8BA 1EZIA 3AH2A 1ZCUA 5CMGX 3VT0A 4F34A 1V6WA 5BVPI 2PGVA 3OGGA 2NTDA 4OW4A 4LO1A 3CRGA 5FYEA 4CJMA 3PUBA 4OEEA 3HL3A 4J23B 3V79C 1HWPB 1AXMA 1Q03A 2VS4A 4DEPA 4XFUA 1R8NA 3F62B 1G93A 4FRHA 3UD7A 1NQIB 4EEEB 1G0RA 2MZBA 3HSMA 3FFZA 1V82A 3AKHA 5FU8A 1MD6A 2O1HA 4H9WA 2RJ8A 4P02A 2DRYA 3HOMA 4I4PA 1O7QA 2YCMA 3CRHA 4I4UA 3WO4A 1DZDA 3S8KA 1ZDFA 2BO6A 3T7NA 2JCJA 1W57A 4AYJA 1FGGA 2JCOA 1L2HA 2LIQA 2RJ7A 5JQQA 3NJ5A 1WSZA 1ZDGA 3BX1C 5BP5A 3FJBA 5EG6C 1VGTA 1YF8B 3BCVA 5C4BA 3FJHA 4HO9A 4FCEA 4ZKTB 4AYLA 2Y6PA 2F8XC 1AVXB 1BASA 1IT0A 4JD0A 3IOJA 5D61A 3V8YA 4JQ0A 4R6UB 3PHZA 4M2BA 2Z87A 5FNWA 2RJ5A 4HCQA 1BLAA 1FGXA 1WT2A 2D0JA 3E26A 2FYAA 2DPWA 1DLLA 1ABRB 4G1RA 2BO7A 3E25A 1K5UA 3CKOA 1S0LA 2XWNA 2RJ0A 2P6WA 1RMLA 3IOIA 1KWSA 3O4CA 1WT1A 2XWLA 4NALA 2RITA 4EE3A 3OH2A 1XHBA 2FFUA 2VSEA 3FJ8A 4YOLA 4JRAA 3Q7XA 1NHEB 3RSBA 4CJCA 1ZJ2A 1JLYA 3CA1A 3O4DA 3BA4A 3O49A 4B2XA 3N7LA 1H7FA 3I2AA 1IINA 4F83A 4D0ZA 4CJ8A 3OH4A 41BIA 5F8WA 3Q4SA 2RIXA 5AJOA 3V91A 1LZ0A 1FO9A 5CMJA 1H5TB 3OBRA 5BOWA 1PC8B 3P6IA 4EE4A 5J49A 4DENA 2HZ9A 5FZUA 3V0AB 5BXRA 3I2XA 2CU2A 1O0RA 5C1GA 4I4RA 1VCLA 1JTCA 1D0HA 3IM7A 4J2KA 2WVMA 3V90A 1O7OA 2GGOA 4Y7FA 4Y7UA 4NANA 1XZ6A 4G3QA 2OEFA 4LW3A 1FN0A 3HBWA 2AGDA 2P72A 3U2UA 3N7MA 3NBNA 2WE9A 4Y7GA 1H5TA 5C1HA 2Z48A 3OC9A 1V6UA 2FYCB 5C4FA 4OUJA 2RJ4A 3AKIA 1LVWA 4FRMA 4HO2A 4L4HA 3PNNA 3ZX7A 3FJJA 1JYKA 1CE7B 3CKJA 5AJPA 2PGYA 2NYYA 4I4VA 1W77A 3N9WA 2NZ9A 2AFGA 4IZXA 1H5SB 4JKQA 4LO2C 2I5EA 3USQA 3BRFA 1ZIZA 2AM4A 1HWMB 1W3GA 2BO8A 4AC3A 4HG6A 3ZC8A 8I1BA 4M4KA 1DFCA 3V0PA 2AE7A 1G8OA 4QO3A 3WINC 3SX7A 1S0EA 4IZEA 1G9AA 1JVDA 2Y9GA 4M2AA 4QBCA 3BAQA 3T8SA 3VT2A 4I4OA 3O3PA 2DS0A 1TWEA 1YXWA 2D43A 1V6VA 1HKNA 1ITBA 3CA3A 3FJEA 4AN6A 2QKXA 1H5SA 2Z86A 4QD2C 4Y63A 1QQLA 3SX3A 1MC9A 1Z4SA 1NKHB 1ZCVA 2Y4JA 3AZVA 1OQLB 3CQAA 4JISA 1EPWA 2OEGA 1R7TA 2MIBA 4FRAA 1R80A 3D8VA 1BARA 2J3PA 1FO8A 5C36A 2D7RA 2FYBA 2AESA 1HM0A 2XMEA 4J2XA 3AKFA 2D20A 1JV1A 3RMYA 2X5ZA 1TTUA 3V0OA 3C9ZA 2V0LA 4J2SA 3O5WB 3AZWA 1WVCA 2RIYA 1AVUA 2FFVA 4LW6A 4ASJA 2UUSA 5F90A 4KC2A 1HM8A 2ZQOA 3V0NA 2ESUA 4LO2A 4P0JA 3HMYA 4FVVA 2KI4A 1IJTA 1DIWA 4EEGA 2ICXA 3BA5A 1II4A 4GP3A 3WMVA 2K4AB 2WRYA 4GOYA 5GAQA 2WGZA 3WINA 2WVKA 4ZOTA 3V0QA 4GBPA 1P63A 2O1GA 4UEGA 3I0HA 4C2SA 4KC4A 2WBCA 1PZYB 1GA8A 1JLXA 1H4DA 2V0JA 3T7MA 5DSSB 3V8ZA 2AECA 2PA4A 3HALA 3JUJA 3SXCA 1Q1UA 2AQZA 4EEMA 2OI6A 1INIA 2OI5A 3SXDA 5CMHA 4ECMA 2IHOA 4HO0A 1G9CA 4G6JA 1ZI1A 4A7YA 1JYLA 1WBAA 3FJKA 3CU1B 5CMFX 3FUQA 4Y6UA 1S4OA 3IM6A 2YQSA 1H7LA 4JP0A 2VS3A 1RY7A 3DUVA 4HR6C 2OI7A 4HO4A 4BMAA 1EYRA 2NM1A 2R9KB 1IIMA 2VXTI 4ISQA 3UD8A 2D7IA 1OMZA 1ONKB 1XG6A 1VZXA 3I0EA 3Q7UA 3U2VA 5BXCA 3FGMA 1FOAA 4Y64A 1R8OA 4ASYA 4EFPA 4DECA 5FNXA 2FO1A 2AM5A 2GGQA 4CJBA 3IIRA 1FWVA 1QWJA 3IOHA 3U0XA 4EE5A 5EIYA 1ZI5A 4HO6A 1BFBA 3FJIA 1FV3A 1GX0A 2RJ6A 3V0BB 1AFCA 2YC3A 3PKQA 3VSZA 3BAHA 5IDSA 1QQKA 21BIA 2IWTB 3H6QA 4Q9GA 1O23B 1OQMB 2QGIA 1BFFA 2DREA 2VXRA 4I4SA 2DRZA 4IONA 1TOOA 4P6AA 2XMHA 1FR9A 3JUKA 4LO0C 1DQOA 3I0KA 4HO8A 4ARWA 3A07A 3K8DA 3CA0A 5CQPA 4IHZA 1JQZA 3VUOA
chains in the Genus database with same CATH superfamily
3V0BA 4IRPA 4I96A 4I2SA 2VUAA 3I0GA 4G87A 5CQLX 1SZ6B 3JUTA 3Q7YA 1YP3A 2WEEA 1R82A 1TP0A 1OMXA 2Q3NB 3BADA 3BAUA 4ZA3B 2RJ9A 3I0LA 1R81A 5C4CA 4QBVA 2MLLB 3BAGA 5FZZA 4EB2B 3F1CA 2X2SA 4YS8A 4MIXA 2KI6B 2KLLA 2WAWA 3FWWA 4G9MA 2VLCA 4I1BA 4Z8SB 3AKGA 4DCKC 4OWLA 1VZUA 3OJVA 5EHAA 1NUNA 2RSTA 1LL0A 1DQGA 5IFYA 4NAIA 3O44A 4D11C 5C48A 1BA7A 5CQOA 1LZJA 4B4GA 4FROA 1QGSA 2BEBA 1MP3A 4X3AA 4EKXB 1Z90A 2O1FA 4KNRA 4R7PA 1ON8A 1DJSB 2JCKA 1H3MA 4J2YA 5C3AA 1QXMA 2VK9A 2P23A 3UJ0A 4D0TA 2YUGA 2RQ9A 3BB2A 3NBEA 3FJAA 4GOVA 4HJJA 3VWCA 2YESA 3TC2A 3UDAA 1GWWA 4FCUA 4ZGRB 4USPA 1G3LA 4XWIA 1FXOA 2Y4KA 1H5RA 3NBCA 1MP4A 1WD3A 3CKQA 1EVTA 3I0FA 4I1EA 1G1LA 3V0MA 5D91A 1H5SD 1VGUA 2VSIA 2I7BA 3OBTA 3CAHA 1H7GA 1CVSA 1EYLA 3I29B 4I7IA 3OJ2A 6I1BA 1K4VA 4Y6NA 4G9NA 1LL2A 4E1KA 1I1EA 5FUHA 4FRPA 4NAKA 3E8LC 3NGWA 1ZJ1A 4ZFUB 1BLDA 1S0GA 1LZIA 1T9FA 2V0KA 2RIZA 3SXBA 3SNVA 4CVHA 3OGFA 1ZI4A 4K6RA 4FIXA 4B42A 3O3QA 4D11A 1V6XA 2MC2A 1GQCA 4II0A 1BFCA 2Y9XE 4IY9A 4X37A 1G23A 3WA1A 2W0VA 2ZU7A 3OH1A 3F1YA 4B4MA 2D44A 1JV3A 4FRBA 1LL3A 4MNDA 2QYIB 2A8UA 2QN4A 2X5SA 1HCEA 1TVYA 1E5KA 1ZHJA 2FDBM 2Y9WC 3RMWA 3CA6A 3V0LA 2F2FC 3ILAA 1NWGB 4A7KA 1IOBA 2AAIB 3O4OA 1ISWA 5BXTA 3Q80A 4IYBA 5C38A 1GGPB 3S8JA 4A7ZA 3USRA 3B9UA 2J0BA 1FQ9A 1YBIA 5I1FA 4OWKA 5DVHA 3F1RA 3UJ4A 1K5VA 2C0NA 3QYDA 1NZKA 2ZQNA 2FGFA 3SPTA 2Q9XA 4QKSA 4Q91A 1G9DA 4G3PA 2X2TA 5JLVA 2BO4A 1VZTA 2I5KA 1VM8A 1Q04A 1FZWA 3CU0A 4PC4A 3I0IX 2KKIA 4OEGA 5CQMX 3ZLKA 3WO3A 4JAWA 1XZZA 1RZOB 1ISXA 4P00A 2VU9A 4QD2B 2A8WA 4KNXA 1YROB 1G9RA 4KPXA 1I1BA 2J0AA 1AF9A 1W3FA 3IAGC 1WD4A 4XKIA 4P0LA 3U2WA 5D63A 3FJFA 4I6IA 1F31A 1FRWA 3MALA 1E0OA 1ZI3A 1SS9A 4HA2A 4OEFA 5DUYA 2K43A 4QALA 1H7HA 3PKPA 4HO5A 1AVAC 3O4AA 2P73A 4Y62A 1W3AA 3NBDA 3EE5A 4FRQA 1YTOA 2W0WA 3QVBA 2D22A 4WBCA 2VS5A 1ZJ3A 1JVGA 1S0DA 3O4BA 3LTQA 7I1BA 1HJJA 5EJZA 4UY4A 4FRLA 1TW1A 2AM3A 1M16A 3AH1A 3AJ5A 2ZU9A 5FTSA 4TLPA 1VPAA 4HOCA 1FG5N 1YYNA 2D1ZA 4GAIA 1H4CA 4KEJA 1IRPA 3AH4A 1G82A 3D98A 3P53A 4M28A 3ST8A 3KMVA 4BQHA 2NS2A 2L5XA 2FYDB 1DZCA 1FR8A 5B2HA 9ILBA 2Y9FA 3LW6A 2RJ1A 3GUEA 3R2WA 2Z49A 2Y4LA 4FREA 3I0JA 4KBBA 1FV2A 3RTJB 2UX8A 5I1BA 2X65A 3PG0A 4Z9WB 4IRQA 1FGAA 1V84A 1G2VA 1ILR1 4LO3C 1NF5B 4B2WA 2APCA 1Z0HA 3R4UA 1S0BA 4I3NA 1R7YA 2ZU8A 4KC3A 3I0CA 4MZFB 3P6JA 2X60A 4FGFA 5C47A 1H7EA 4DDZA 3ZXDA 3KIAA 3BA7A 5FTVA 1RG8A 4L41C 4ZFWB 3AJ6A 4JPZA 1HJLA 4P0KA 5DZUA 1R7UA 4EFQA 2HW9A 3H6RB 1ON6A 5FV9A 2XOAA 2AXMA 5C8RA 1FMMS 1WBCA 4ZLBB 1H4EA 1ZCYA 3UD9A 2YQJA 4I0YA 4H04A 3VSFA 1YP4A 2P39A 3R4SA 1ZJ0A 5G00A 3RMVA 3SX8A 3JTJA 3H6RA 31BIA 1R7XA 2QH5A 3VT1A 1MP5A 3SXAA 3D5NA 3U2XA 5D62A 1IHKA 3BRKX 2I1BA 1INJA 1S4PA 2YQHA 3K8EA 3IM5A 5CQNX 4LO3A 1VGWA 4EVWA 1H5RB 2KH2A 3ZXGA 3CKNA 4D48A 4I4YA 1IRAX 1JT7A 5F8SA 4KPZA 4B3UA 3A23A 3EF2A 3CKVA 4ZFYB 1VICA 1TWMA 4ISRA 3T7OA 2FY7A 2PX7A 3R3IA 3ZGFA 1AVWB 5BXSA 3HN1A 3POLA 3H6SE 4X39A 4Q9PA 3FJCA 3BAOA 1PZTA 1WT3A 2V0HA 4KEKA 1Z2VA 4I4QA 4EEOA 5IDTA 4L4IA 4D8HA 4LO0A 3QR5A 2Y7AA 4Y7VA 4I4XA 4I37A 1T4QA 2GO2A 3MPPG 4EFRA 4KXOA 3SX5A 4LO8B 5EJ1A 1GQ9A 1DFQA 2YC5A 5HPZA 3Q7WA 2E4MC 2NP0A 5DDVA 4G6MA 1TFMB 1JT3A 4ENDA 2D23A 3BRDA 1SR4C 5FZYA 3BRGC 4QKRA 4GP0A 1I52A 2E3DA 3D7WB 1MC3A 2GZBA 3BTAA 4I8MA 4KEIA 2WVLA 3CA4A 2M49A 4ZBVB 1GX4A 1FMZA 2AH9A 1BFGA 1HWNB 1UPSA 2ERMA 1KNMA 1TW5A 2VXLA 3DJ4A 4B5BA 3N7KA 1LZ7A 1VH1A 2Q4JA 3SXEA 3CGXA 1R7VA 3BAVA 4QC4A 5D92A 1H5SC 1VH3A 3OH0A 1FWYA 1ISYA 4G3SA 4Q7CA 3JRRA 1WT0A 2JCLA 4HO3A 1HM9A 3WO2A 4Y9XA 4AAWA 5L6SA 3WMUA 1PWAA 2BFHA 3OH3A 1ZJOA 1HIBA 4KC1A 5AJNA 3V0AA 2D24A 5EC5A 4AN7B 3POKA 1YP2A 5C1LA 3W9TA 2LIEA 3RMXA 1S4NA 3K1XA 2ICYA 3U0YA 1PUMB 5HS2A 1GWVA 1S0CA 1W55A 2NXVA 1TIEA 1PUUB 2E4MA 1TZFA 4J18A 4Y7TA 5C49A 3ZGGA 2HWAA 1G9BA 1ZCTA 2ZR1B 4DE7A 1SR4A 3A22A 4FRDA 3RTIB 1G95A 2VXMA 2VSHA 1ISVA 3OKRA 2Y4MA 3TQDA 5BXPA 1JT4A 1JY0A 3ZLLA 1G97A 1HV9A 5BQUC 2ET2A 1A8DA 4ZDQA 5C4EA 5L6VA 1JT5A 3FJ9A 4IQPA 3ZC9A 3PMEA 4EEAA 4XFTA 5JMCA 1ISZA 3N0KA 4B4BA 3OJMA 4LO1C 4LO7C 1H7TA 2YQCA 2VFZA 2RG9B 3OGZA 1N4KA 1H7QA 3OAMA 2F2FA 4MYBA 1QG8A 3LLPA 1HWOB 4KQLA 1FXJA 2XWMA 4KRVA 5C3DA 3FJDA 2BEAA 4IY8A 1VGZA 4XFSA 4FIYA 4FQWA 4O6NA 3U2TA 2HWMA 1XYFA 3A21A 4GAFA 4H75A 1NMMB 4JKXB 4X38A 3CRIA 3FOQA 1J0SA 5FU0A 2VSAA 1IILA 5E24E 1M2TB 1S0FA 1QGQA 1V83A 3DK5A 4USOA 3TZTA 1FWUA 3FUOA 3N7JA 1PZZA 4LO7B 3VEQA 2K8RA 3ZF8A 5C3BA 4KT7A 5DDTA 3I0DA 1HCDA 5F8YA 2NVHA 3CA5A 5BP5C 1ZJPA 2V0IA 2VD4A 5CMIA 4OWJA 3RSJA 5BQUA 3SXGA 5C4DA 1EV2A 2E8BA 1EZIA 3AH2A 1ZCUA 5CMGX 3VT0A 4F34A 1V6WA 5BVPI 2PGVA 3OGGA 2NTDA 4OW4A 4LO1A 3CRGA 5FYEA 4CJMA 3PUBA 4OEEA 3HL3A 4J23B 3V79C 1HWPB 1AXMA 1Q03A 2VS4A 4DEPA 4XFUA 1R8NA 3F62B 1G93A 4FRHA 4O6MA 3UD7A 1NQIB 4EEEB 1G0RA 2MZBA 3HSMA 3FFZA 1V82A 3AKHA 5FU8A 1MD6A 2O1HA 4H9WA 2RJ8A 4P02A 2DRYA 3HOMA 4I4PA 1O7QA 2YCMA 3CRHA 4I4UA 3WO4A 1DZDA 3S8KA 1ZDFA 2BO6A 3T7NA 2JCJA 1W57A 4AYJA 1FGGA 2JCOA 1L2HA 2LIQA 2RJ7A 5JQQA 3NJ5A 1WSZA 1ZDGA 3BX1C 5BP5A 3FJBA 5EG6C 1VGTA 1YF8B 3BCVA 5C4BA 3FJHA 4HO9A 4FCEA 4ZKTB 4AYLA 2Y6PA 2F8XC 1AVXB 1BASA 1IT0A 4JD0A 3IOJA 5D61A 3V8YA 4JQ0A 4R6UB 3PHZA 4M2BA 2Z87A 5FNWA 2RJ5A 4HCQA 1BLAA 1FGXA 1WT2A 2D0JA 3E26A 2FYAA 2DPWA 1DLLA 1ABRB 4G1RA 2BO7A 3E25A 1K5UA 3CKOA 1S0LA 2XWNA 2RJ0A 2P6WA 1RMLA 3IOIA 1KWSA 3O4CA 1WT1A 2XWLA 4NALA 2RITA 4EE3A 3OH2A 1XHBA 2FFUA 2VSEA 3FJ8A 4YOLA 4JRAA 3Q7XA 1NHEB 3RSBA 4CJCA 1ZJ2A 1JLYA 3CA1A 3O4DA 3BA4A 3O49A 4MZGB 4B2XA 3N7LA 1H7FA 3I2AA 1IINA 4F83A 4D0ZA 4CJ8A 3OH4A 41BIA 5F8WA 3Q4SA 2RIXA 5AJOA 3V91A 1LZ0A 1FO9A 5CMJA 1H5TB 3OBRA 5BOWA 1PC8B 3P6IA 4EE4A 5J49A 4DENA 2HZ9A 5FZUA 3V0AB 5BXRA 3I2XA 2CU2A 1O0RA 5C1GA 4I4RA 1VCLA 1JTCA 1D0HA 3IM7A 4J2KA 2WVMA 3V90A 1O7OA 2GGOA 4Y7FA 4Y7UA 4NANA 1XZ6A 4G3QA 2OEFA 4LW3A 1FN0A 3HBWA 2AGDA 2P72A 3U2UA 3N7MA 3NBNA 2WE9A 4Y7GA 1H5TA 5C1HA 2Z48A 3OC9A 1V6UA 2FYCB 5C4FA 4OUJA 2RJ4A 3AKIA 1LVWA 4FRMA 4HO2A 4L4HA 3PNNA 3ZX7A 3FJJA 1JYKA 1CE7B 3CKJA 5AJPA 2PGYA 2NYYA 4I4VA 1W77A 3N9WA 2NZ9A 2AFGA 4IZXA 1H5SB 4JKQA 4LO2C 2I5EA 3USQA 3BRFA 1ZIZA 2AM4A 1HWMB 1W3GA 2BO8A 4AC3A 4HG6A 3ZC8A 8I1BA 4M4KA 1DFCA 3V0PA 2AE7A 1G8OA 4QO3A 3WINC 3SX7A 1S0EA 4IZEA 1G9AA 1JVDA 2Y9GA 4M2AA 4QBCA 3BAQA 3T8SA 3VT2A 4I4OA 3O3PA 2DS0A 1TWEA 1YXWA 2D43A 1V6VA 1HKNA 1ITBA 3CA3A 3FJEA 4AN6A 2QKXA 1H5SA 2Z86A 4QD2C 4Y63A 1QQLA 3SX3A 1MC9A 1Z4SA 1NKHB 1ZCVA 2Y4JA 3AZVA 1OQLB 3CQAA 4JISA 1EPWA 2OEGA 1R7TA 2MIBA 4FRAA 1R80A 3D8VA 1BARA 2J3PA 1FO8A 5C36A 2D7RA 2FYBA 2AESA 1HM0A 2XMEA 4J2XA 3AKFA 2D20A 1JV1A 3RMYA 2X5ZA 1TTUA 3V0OA 3C9ZA 2V0LA 4J2SA 3O5WB 3AZWA 1WVCA 2RIYA 1AVUA 2FFVA 4LW6A 4ASJA 2UUSA 5F90A 4KC2A 1HM8A 2ZQOA 3V0NA 2ESUA 4LO2A 4P0JA 3HMYA 4FVVA 2KI4A 1IJTA 1DIWA 4EEGA 2ICXA 3BA5A 1II4A 4GP3A 3WMVA 2K4AB 2WRYA 4GOYA 5GAQA 2WGZA 3WINA 2WVKA 4ZOTA 3V0QA 4GBPA 1P63A 4MZHA 2O1GA 4UEGA 3I0HA 4C2SA 4KC4A 2WBCA 1PZYB 1GA8A 1JLXA 1H4DA 2V0JA 3T7MA 5DSSB 3V8ZA 2AECA 2PA4A 3HALA 3JUJA 3SXCA 1Q1UA 2AQZA 4EEMA 2OI6A 1INIA 2OI5A 3SXDA 5CMHA 4ECMA 2IHOA 4HO0A 1G9CA 4G6JA 1ZI1A 4A7YA 1JYLA 1WBAA 3FJKA 3CU1B 5CMFX 3FUQA 4Y6UA 1S4OA 3IM6A 2YQSA 1H7LA 4JP0A 2VS3A 1RY7A 3DUVA 4HR6C 2OI7A 4HO4A 4BMAA 1EYRA 2NM1A 2R9KB 1IIMA 2VXTI 4ISQA 3UD8A 2D7IA 1OMZA 1ONKB 1XG6A 1VZXA 3I0EA 3Q7UA 3U2VA 5BXCA 3FGMA 1FOAA 4Y64A 1R8OA 4ASYA 4EFPA 4DECA 5FNXA 2FO1A 2AM5A 2GGQA 4CJBA 3IIRA 1FWVA 1QWJA 3IOHA 3U0XA 4EE5A 5EIYA 1ZI5A 4HO6A 1BFBA 3FJIA 1FV3A 1GX0A 2RJ6A 3V0BB 1AFCA 2YC3A 3PKQA 3VSZA 3BAHA 5IDSA 1QQKA 21BIA 2IWTB 3H6QA 4Q9GA 1O23B 1OQMB 2QGIA 1BFFA 2DREA 2VXRA 4I4SA 2DRZA 4IONA 1TOOA 4P6AA 2XMHA 1FR9A 3JUKA 4LO0C 1DQOA 3I0KA 4HO8A 4ARWA 3A07A 3K8DA 3CA0A 5CQPA 4IHZA 1JQZA 3VUOA
chains in the Genus database with same CATH topology
3V0BA 4IRPA 4I96A 4I2SA 2VUAA 3I0GA 4G87A 5CQLX 1SZ6B 3JUTA 3Q7YA 1YP3A 2WEEA 1R82A 1TP0A 1OMXA 2Q3NB 3BADA 3BAUA 4ZA3B 2RJ9A 3I0LA 1R81A 5C4CA 4QBVA 2MLLB 3BAGA 5FZZA 4EB2B 3F1CA 2X2SA 4YS8A 4MIXA 2KI6B 2KLLA 2WAWA 3FWWA 4G9MA 2VLCA 4I1BA 4Z8SB 3AKGA 4DCKC 4OWLA 1VZUA 3OJVA 5EHAA 1NUNA 2RSTA 1LL0A 1DQGA 5IFYA 4NAIA 3O44A 4D11C 5C48A 1BA7A 5CQOA 1LZJA 4B4GA 4FROA 1QGSA 2BEBA 1MP3A 4X3AA 4EKXB 1Z90A 2O1FA 4KNRA 4R7PA 1ON8A 1DJSB 2JCKA 1H3MA 4J2YA 5C3AA 1QXMA 2VK9A 2P23A 3UJ0A 4D0TA 2YUGA 2RQ9A 3BB2A 3NBEA 3FJAA 4GOVA 4HJJA 3VWCA 2YESA 3TC2A 3UDAA 1GWWA 4FCUA 4ZGRB 4USPA 1G3LA 4XWIA 1FXOA 2Y4KA 1H5RA 3NBCA 1MP4A 1WD3A 3CKQA 1EVTA 3I0FA 4I1EA 1G1LA 3V0MA 5D91A 1H5SD 1VGUA 2VSIA 2I7BA 3OBTA 3CAHA 1H7GA 1CVSA 1EYLA 3I29B 4I7IA 3OJ2A 6I1BA 1K4VA 4Y6NA 4G9NA 1LL2A 4E1KA 1I1EA 5FUHA 4FRPA 4NAKA 3E8LC 3NGWA 1ZJ1A 4ZFUB 1BLDA 1S0GA 1LZIA 1T9FA 2V0KA 2RIZA 3SXBA 3SNVA 4CVHA 3OGFA 1ZI4A 4K6RA 4FIXA 4B42A 3O3QA 4D11A 1V6XA 2MC2A 1GQCA 4II0A 1BFCA 2Y9XE 4IY9A 4X37A 1G23A 3WA1A 2W0VA 2ZU7A 3OH1A 3F1YA 4B4MA 2D44A 1JV3A 4FRBA 1LL3A 4MNDA 2QYIB 2A8UA 2QN4A 2X5SA 1HCEA 1TVYA 1E5KA 1ZHJA 2FDBM 2Y9WC 3RMWA 3CA6A 3V0LA 2F2FC 3ILAA 1NWGB 4A7KA 1IOBA 2AAIB 3O4OA 1ISWA 5BXTA 3Q80A 4IYBA 5C38A 1GGPB 3S8JA 4A7ZA 3USRA 3B9UA 2J0BA 1FQ9A 1YBIA 5I1FA 4OWKA 5DVHA 3F1RA 3UJ4A 1K5VA 2C0NA 3QYDA 1NZKA 2ZQNA 2FGFA 3SPTA 2Q9XA 4QKSA 4Q91A 1G9DA 4G3PA 2X2TA 5JLVA 2BO4A 1VZTA 2I5KA 1VM8A 1Q04A 1FZWA 3CU0A 4PC4A 3I0IX 2KKIA 4OEGA 5CQMX 3ZLKA 3WO3A 4JAWA 1XZZA 1RZOB 1ISXA 4P00A 2VU9A 4QD2B 2A8WA 4KNXA 1YROB 1G9RA 4KPXA 1I1BA 2J0AA 1AF9A 1W3FA 3IAGC 1WD4A 4XKIA 4P0LA 3U2WA 5D63A 3FJFA 4I6IA 1F31A 1FRWA 3MALA 1E0OA 1ZI3A 1SS9A 4HA2A 4OEFA 5DUYA 2K43A 4QALA 1H7HA 3PKPA 4HO5A 1AVAC 3O4AA 2P73A 4Y62A 1W3AA 3NBDA 3EE5A 4FRQA 1YTOA 2W0WA 3QVBA 2D22A 4WBCA 2VS5A 1ZJ3A 1JVGA 1S0DA 3O4BA 3LTQA 7I1BA 1HJJA 5EJZA 4UY4A 4FRLA 1TW1A 2AM3A 1M16A 3AH1A 3AJ5A 2ZU9A 5FTSA 4TLPA 1VPAA 4HOCA 1FG5N 1YYNA 2D1ZA 4GAIA 1H4CA 4KEJA 1IRPA 3AH4A 1G82A 3D98A 3P53A 4M28A 3ST8A 3KMVA 4BQHA 2NS2A 2L5XA 2FYDB 1DZCA 1FR8A 5B2HA 9ILBA 2Y9FA 3LW6A 2RJ1A 3GUEA 3R2WA 2Z49A 2Y4LA 4FREA 3I0JA 4KBBA 1FV2A 3RTJB 2UX8A 5I1BA 2X65A 3PG0A 4Z9WB 4IRQA 1FGAA 1V84A 1G2VA 1ILR1 4LO3C 1NF5B 4B2WA 2APCA 1Z0HA 3R4UA 1S0BA 4I3NA 1R7YA 2ZU8A 4KC3A 3I0CA 4MZFB 3P6JA 2X60A 4FGFA 5C47A 1H7EA 4DDZA 3ZXDA 3KIAA 3BA7A 5FTVA 1RG8A 4L41C 4ZFWB 3AJ6A 4JPZA 1HJLA 4P0KA 5DZUA 1R7UA 4EFQA 2HW9A 3H6RB 1ON6A 5FV9A 2XOAA 2AXMA 5C8RA 1FMMS 1WBCA 4ZLBB 1H4EA 1ZCYA 3UD9A 2YQJA 4I0YA 4H04A 3VSFA 1YP4A 2P39A 3R4SA 1ZJ0A 5G00A 3RMVA 3SX8A 3JTJA 3H6RA 31BIA 1R7XA 2QH5A 3VT1A 1MP5A 3SXAA 3D5NA 3U2XA 5D62A 1IHKA 3BRKX 2I1BA 1INJA 1S4PA 2YQHA 3K8EA 3IM5A 5CQNX 4LO3A 1VGWA 4EVWA 1H5RB 2KH2A 3ZXGA 3CKNA 4D48A 4I4YA 1IRAX 1JT7A 5F8SA 4KPZA 4B3UA 3A23A 3EF2A 3CKVA 4ZFYB 1VICA 1TWMA 4ISRA 3T7OA 2FY7A 2PX7A 3R3IA 3ZGFA 1AVWB 5BXSA 3HN1A 3POLA 3H6SE 4X39A 4Q9PA 3FJCA 3BAOA 1PZTA 1WT3A 2V0HA 4KEKA 1Z2VA 4I4QA 4EEOA 5IDTA 4L4IA 4D8HA 4LO0A 3QR5A 2Y7AA 4Y7VA 4I4XA 4I37A 1T4QA 2GO2A 3MPPG 4EFRA 4KXOA 3SX5A 4LO8B 5EJ1A 1GQ9A 1DFQA 2YC5A 5HPZA 3Q7WA 2E4MC 2NP0A 5DDVA 4G6MA 1TFMB 1JT3A 4ENDA 2D23A 3BRDA 1SR4C 5FZYA 3BRGC 4QKRA 4GP0A 1I52A 2E3DA 3D7WB 1MC3A 2GZBA 3BTAA 4I8MA 4KEIA 2WVLA 3CA4A 2M49A 4ZBVB 1GX4A 1FMZA 2AH9A 1BFGA 1HWNB 1UPSA 2ERMA 1KNMA 1TW5A 2VXLA 3DJ4A 4B5BA 3N7KA 1LZ7A 1VH1A 2Q4JA 3SXEA 3CGXA 1R7VA 3BAVA 4QC4A 5D92A 1H5SC 1VH3A 3OH0A 1FWYA 1ISYA 4G3SA 4Q7CA 3JRRA 1WT0A 2JCLA 4HO3A 1HM9A 3WO2A 4Y9XA 4AAWA 5L6SA 3WMUA 1PWAA 2BFHA 3OH3A 1ZJOA 1HIBA 4KC1A 5AJNA 3V0AA 2D24A 5EC5A 4AN7B 3POKA 1YP2A 5C1LA 3W9TA 2LIEA 3RMXA 1S4NA 3K1XA 2ICYA 3U0YA 1PUMB 5HS2A 1GWVA 1S0CA 1W55A 2NXVA 1TIEA 1PUUB 2E4MA 1TZFA 4J18A 4Y7TA 5C49A 3ZGGA 2HWAA 1G9BA 1ZCTA 2ZR1B 4DE7A 1SR4A 3A22A 4FRDA 3RTIB 1G95A 2VXMA 2VSHA 1ISVA 3OKRA 2Y4MA 3TQDA 5BXPA 1JT4A 1JY0A 3ZLLA 1G97A 1HV9A 5BQUC 2ET2A 1A8DA 4ZDQA 5C4EA 5L6VA 1JT5A 3FJ9A 4IQPA 3ZC9A 3PMEA 4EEAA 4XFTA 5JMCA 1ISZA 3N0KA 4B4BA 3OJMA 4LO1C 4LO7C 1H7TA 2YQCA 2VFZA 2RG9B 3OGZA 1N4KA 1H7QA 3OAMA 2F2FA 4MYBA 1QG8A 3LLPA 1HWOB 4KQLA 1FXJA 2XWMA 4KRVA 5C3DA 3FJDA 2BEAA 4IY8A 1VGZA 4XFSA 4FIYA 4FQWA 4O6NA 3U2TA 2HWMA 1XYFA 3A21A 4GAFA 4H75A 1NMMB 4JKXB 4X38A 3CRIA 3FOQA 1J0SA 5FU0A 2VSAA 1IILA 5E24E 1M2TB 1S0FA 1QGQA 1V83A 3DK5A 4USOA 3TZTA 1FWUA 3FUOA 3N7JA 1PZZA 4LO7B 3VEQA 2K8RA 3ZF8A 5C3BA 4KT7A 5DDTA 3I0DA 1HCDA 5F8YA 2NVHA 3CA5A 5BP5C 1ZJPA 2V0IA 2VD4A 5CMIA 4OWJA 3RSJA 5BQUA 3SXGA 5C4DA 1EV2A 2E8BA 1EZIA 3AH2A 1ZCUA 5CMGX 3VT0A 4F34A 1V6WA 5BVPI 2PGVA 3OGGA 2NTDA 4OW4A 4LO1A 3CRGA 5FYEA 4CJMA 3PUBA 4OEEA 3HL3A 4J23B 3V79C 1HWPB 1AXMA 1Q03A 2VS4A 4DEPA 4XFUA 1R8NA 3F62B 1G93A 4FRHA 4O6MA 3UD7A 1NQIB 4EEEB 1G0RA 2MZBA 3HSMA 3FFZA 1V82A 3AKHA 5FU8A 1MD6A 2O1HA 4H9WA 2RJ8A 4P02A 2DRYA 3HOMA 4I4PA 1O7QA 2YCMA 3CRHA 4I4UA 3WO4A 1DZDA 3S8KA 1ZDFA 2BO6A 3T7NA 2JCJA 1W57A 4AYJA 1FGGA 2JCOA 1L2HA 2LIQA 2RJ7A 5JQQA 3NJ5A 1WSZA 1ZDGA 3BX1C 5BP5A 3FJBA 5EG6C 1VGTA 1YF8B 3BCVA 5C4BA 3FJHA 4HO9A 4FCEA 4ZKTB 4AYLA 2Y6PA 2F8XC 1AVXB 1BASA 1IT0A 4JD0A 3IOJA 5D61A 3V8YA 4JQ0A 4R6UB 3PHZA 4M2BA 2Z87A 5FNWA 2RJ5A 4HCQA 1BLAA 1FGXA 1WT2A 2D0JA 3E26A 2FYAA 2DPWA 1DLLA 1ABRB 4G1RA 2BO7A 3E25A 1K5UA 3CKOA 1S0LA 2XWNA 2RJ0A 2P6WA 1RMLA 3IOIA 1KWSA 3O4CA 1WT1A 2XWLA 4NALA 2RITA 4EE3A 3OH2A 1XHBA 2FFUA 2VSEA 3FJ8A 4YOLA 4JRAA 3Q7XA 1NHEB 3RSBA 4CJCA 1ZJ2A 1JLYA 3CA1A 3O4DA 3BA4A 3O49A 4MZGB 4B2XA 3N7LA 1H7FA 3I2AA 1IINA 4F83A 4D0ZA 4CJ8A 3OH4A 41BIA 5F8WA 3Q4SA 2RIXA 5AJOA 3V91A 1LZ0A 1FO9A 5CMJA 1H5TB 3OBRA 5BOWA 1PC8B 3P6IA 4EE4A 5J49A 4DENA 2HZ9A 5FZUA 3V0AB 5BXRA 3I2XA 2CU2A 1O0RA 5C1GA 4I4RA 1VCLA 1JTCA 1D0HA 3IM7A 4J2KA 2WVMA 3V90A 1O7OA 2GGOA 4Y7FA 4Y7UA 4NANA 1XZ6A 4G3QA 2OEFA 4LW3A 1FN0A 3HBWA 2AGDA 2P72A 3U2UA 3N7MA 3NBNA 2WE9A 4Y7GA 1H5TA 5C1HA 2Z48A 3OC9A 1V6UA 2FYCB 5C4FA 4OUJA 2RJ4A 3AKIA 1LVWA 4FRMA 4HO2A 4L4HA 3PNNA 3ZX7A 3FJJA 1JYKA 1CE7B 3CKJA 5AJPA 2PGYA 2NYYA 4I4VA 1W77A 3N9WA 2NZ9A 2AFGA 4IZXA 1H5SB 4JKQA 4LO2C 2I5EA 3USQA 3BRFA 1ZIZA 2AM4A 1HWMB 1W3GA 2BO8A 4AC3A 4HG6A 3ZC8A 8I1BA 4M4KA 1DFCA 3V0PA 2AE7A 1G8OA 4QO3A 3WINC 3SX7A 1S0EA 4IZEA 1G9AA 1JVDA 2Y9GA 4M2AA 4QBCA 3BAQA 3T8SA 3VT2A 4I4OA 3O3PA 2DS0A 1TWEA 1YXWA 2D43A 1V6VA 1HKNA 1ITBA 3CA3A 3FJEA 4AN6A 2QKXA 1H5SA 2Z86A 4QD2C 4Y63A 1QQLA 3SX3A 1MC9A 1Z4SA 1NKHB 1ZCVA 2Y4JA 3AZVA 1OQLB 3CQAA 4JISA 1EPWA 2OEGA 1R7TA 2MIBA 4FRAA 1R80A 3D8VA 1BARA 2J3PA 1FO8A 5C36A 2D7RA 2FYBA 2AESA 1HM0A 2XMEA 4J2XA 3AKFA 2D20A 1JV1A 3RMYA 2X5ZA 1TTUA 3V0OA 3C9ZA 2V0LA 4J2SA 3O5WB 3AZWA 1WVCA 2RIYA 1AVUA 2FFVA 4LW6A 4ASJA 2UUSA 5F90A 4KC2A 1HM8A 2ZQOA 3V0NA 2ESUA 4LO2A 4P0JA 3HMYA 4FVVA 2KI4A 1IJTA 1DIWA 4EEGA 2ICXA 3BA5A 1II4A 4GP3A 3WMVA 2K4AB 2WRYA 4GOYA 5GAQA 2WGZA 3WINA 2WVKA 4ZOTA 3V0QA 4GBPA 1P63A 4MZHA 2O1GA 4UEGA 3I0HA 4C2SA 4KC4A 2WBCA 1PZYB 1GA8A 1JLXA 1H4DA 2V0JA 3T7MA 5DSSB 3V8ZA 2AECA 2PA4A 3HALA 3JUJA 3SXCA 1Q1UA 2AQZA 4EEMA 2OI6A 1INIA 2OI5A 3SXDA 5CMHA 4ECMA 2IHOA 4HO0A 1G9CA 4G6JA 1ZI1A 4A7YA 1JYLA 1WBAA 3FJKA 3CU1B 5CMFX 3FUQA 4Y6UA 1S4OA 3IM6A 2YQSA 1H7LA 4JP0A 2VS3A 1RY7A 3DUVA 4HR6C 2OI7A 4HO4A 4BMAA 1EYRA 2NM1A 2R9KB 1IIMA 2VXTI 4ISQA 3UD8A 2D7IA 1OMZA 1ONKB 1XG6A 1VZXA 3I0EA 3Q7UA 3U2VA 5BXCA 3FGMA 1FOAA 4Y64A 1R8OA 4ASYA 4EFPA 4DECA 5FNXA 2FO1A 2AM5A 2GGQA 4CJBA 3IIRA 1FWVA 1QWJA 3IOHA 3U0XA 4EE5A 5EIYA 1ZI5A 4HO6A 1BFBA 3FJIA 1FV3A 1GX0A 2RJ6A 3V0BB 1AFCA 2YC3A 3PKQA 3VSZA 3BAHA 5IDSA 1QQKA 21BIA 2IWTB 3H6QA 4Q9GA 1O23B 1OQMB 2QGIA 1BFFA 2DREA 2VXRA 4I4SA 2DRZA 4IONA 1TOOA 4P6AA 2XMHA 1FR9A 3JUKA 4LO0C 1DQOA 3I0KA 4HO8A 4ARWA 3A07A 3K8DA 3CA0A 5CQPA 4IHZA 1JQZA 3VUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0B A;  4IRP A;  4I96 A;  4I2S A;  2VUA A;  3I0G A;  4G87 A;  5CQL X;  1SZ6 B;  3JUT A;  3Q7Y A;  1YP3 A;  2WEE A;  1R82 A;  1TP0 A;  1OMX A;  2Q3N B;  3BAD A;  3BAU A;  4ZA3 B;  2RJ9 A;  3I0L A;  1R81 A;  5C4C A;  4QBV A;  2MLL B;  3BAG A;  5FZZ A;  4EB2 B;  3F1C A;  2X2S A;  4YS8 A;  2KI6 B;  2KLL A;  2WAW A;  3FWW A;  4G9M A;  2VLC A;  4I1B A;  4Z8S B;  3AKG A;  4DCK C;  4OWL A;  1VZU A;  3OJV A;  5EHA A;  1NUN A;  2RST A;  1LL0 A;  1DQG A;  5IFY A;  4NAI A;  3O44 A;  4D11 C;  5C48 A;  1BA7 A;  5CQO A;  1LZJ A;  4B4G A;  4FRO A;  1QGS A;  2BEB A;  1MP3 A;  4X3A A;  4EKX B;  1Z90 A;  2O1F A;  4KNR A;  4R7P A;  1ON8 A;  1DJS B;  2JCK A;  1H3M A;  4J2Y A;  5C3A A;  1QXM A;  2P23 A;  3UJ0 A;  4D0T A;  2YUG A;  2RQ9 A;  3BB2 A;  3NBE A;  3FJA A;  4GOV A;  4HJJ A;  3VWC A;  2YES A;  3TC2 A;  3UDA A;  1GWW A;  4FCU A;  4ZGR B;  4USP A;  1G3L A;  4XWI A;  1FXO A;  2Y4K A;  1H5R A;  3NBC A;  1MP4 A;  1WD3 A;  3CKQ A;  1EVT A;  3I0F A;  4I1E A;  1G1L A;  3V0M A;  1H5S D;  1VGU A;  2VSI A;  2I7B A;  3OBT A;  3CAH A;  1H7G A;  1CVS A;  1EYL A;  3I29 B;  4I7I A;  3OJ2 A;  6I1B A;  1K4V A;  4Y6N A;  4G9N A;  1LL2 A;  4E1K A;  1I1E A;  5FUH A;  4FRP A;  4NAK A;  3E8L C;  3NGW A;  1ZJ1 A;  4ZFU B;  1BLD A;  1S0G A;  1LZI A;  1T9F A;  2V0K A;  2RIZ A;  3SXB A;  3SNV A;  4CVH A;  3OGF A;  1ZI4 A;  4K6R A;  4B42 A;  3O3Q A;  4D11 A;  1V6X A;  2MC2 A;  1GQC A;  4II0 A;  1BFC A;  2Y9X E;  4IY9 A;  4X37 A;  1G23 A;  3WA1 A;  2W0V A;  2ZU7 A;  3OH1 A;  3F1Y A;  4B4M A;  2D44 A;  1JV3 A;  4FRB A;  1LL3 A;  4MND A;  2QYI B;  2A8U A;  2QN4 A;  2X5S A;  1HCE A;  1TVY A;  1E5K A;  1ZHJ A;  2FDB M;  2Y9W C;  3RMW A;  3CA6 A;  3V0L A;  2F2F C;  3ILA A;  1NWG B;  4A7K A;  1IOB A;  2AAI B;  3O4O A;  1ISW A;  5BXT A;  3Q80 A;  4IYB A;  5C38 A;  1GGP B;  3S8J A;  4A7Z A;  3USR A;  3B9U A;  1FQ9 A;  1YBI A;  5I1F A;  4OWK A;  5DVH A;  3F1R A;  3UJ4 A;  1K5V A;  3QYD A;  1NZK A;  2ZQN A;  2FGF A;  3SPT A;  2Q9X A;  4QKS A;  4Q91 A;  1G9D A;  4G3P A;  2X2T A;  5JLV A;  2BO4 A;  1VZT A;  2I5K A;  1VM8 A;  1Q04 A;  1FZW A;  3CU0 A;  4PC4 A;  3I0I X;  2KKI A;  4OEG A;  5CQM X;  3ZLK A;  3WO3 A;  4JAW A;  1XZZ A;  1RZO B;  1ISX A;  4P00 A;  2VU9 A;  4QD2 B;  2A8W A;  4KNX A;  1YRO B;  1G9R A;  4KPX A;  1I1B A;  1AF9 A;  1W3F A;  3IAG C;  1WD4 A;  4XKI A;  4P0L A;  3U2W A;  5D63 A;  3FJF A;  4I6I A;  1F31 A;  1FRW A;  3MAL A;  1E0O A;  1ZI3 A;  1SS9 A;  4HA2 A;  4OEF A;  5DUY A;  2K43 A;  4QAL A;  1H7H A;  3PKP A;  4HO5 A;  1AVA C;  3O4A A;  2P73 A;  4Y62 A;  1W3A A;  3NBD A;  3EE5 A;  4FRQ A;  1YTO A;  2W0W A;  3QVB A;  2D22 A;  4WBC A;  2VS5 A;  1ZJ3 A;  1JVG A;  1S0D A;  3O4B A;  3LTQ A;  7I1B A;  1HJJ A;  5EJZ A;  4FRL A;  1TW1 A;  2AM3 A;  1M16 A;  3AH1 A;  3AJ5 A;  2ZU9 A;  5FTS A;  4TLP A;  1VPA A;  4HOC A;  1FG5 N;  1YYN A;  2D1Z A;  4GAI A;  1H4C A;  4KEJ A;  1IRP A;  3AH4 A;  1G82 A;  3D98 A;  3P53 A;  4M28 A;  3ST8 A;  3KMV A;  4BQH A;  2L5X A;  2FYD B;  1DZC A;  1FR8 A;  5B2H A;  9ILB A;  2Y9F A;  3LW6 A;  2RJ1 A;  3GUE A;  3R2W A;  2Z49 A;  2Y4L A;  4FRE A;  3I0J A;  4KBB A;  1FV2 A;  3RTJ B;  2UX8 A;  5I1B A;  2X65 A;  3PG0 A;  4Z9W B;  4IRQ A;  1FGA A;  1V84 A;  1G2V A;  1ILR 1;  4LO3 C;  1NF5 B;  4B2W A;  2APC A;  1Z0H A;  3R4U A;  1S0B A;  4I3N A;  1R7Y A;  2ZU8 A;  4KC3 A;  3I0C A;  3P6J A;  2X60 A;  4FGF A;  5C47 A;  1H7E A;  4DDZ A;  3ZXD A;  3KIA A;  3BA7 A;  5FTV A;  1RG8 A;  4L41 C;  4ZFW B;  3AJ6 A;  4JPZ A;  1HJL A;  4P0K A;  5DZU A;  1R7U A;  4EFQ A;  2HW9 A;  3H6R B;  1ON6 A;  5FV9 A;  2XOA A;  2AXM A;  5C8R A;  1FMM S;  1WBC A;  4ZLB B;  1H4E A;  1ZCY A;  3UD9 A;  2YQJ A;  4I0Y A;  4H04 A;  3VSF A;  1YP4 A;  2P39 A;  3R4S A;  1ZJ0 A;  5G00 A;  3RMV A;  3SX8 A;  3JTJ A;  3H6R A;  31BI A;  1R7X A;  2QH5 A;  3VT1 A;  1MP5 A;  3SXA A;  3D5N A;  3U2X A;  5D62 A;  1IHK A;  3BRK X;  2I1B A;  1INJ A;  1S4P A;  2YQH A;  3K8E A;  3IM5 A;  5CQN X;  4LO3 A;  1VGW A;  4EVW A;  1H5R B;  2KH2 A;  3ZXG A;  3CKN A;  4D48 A;  4I4Y A;  1IRA X;  1JT7 A;  5F8S A;  4KPZ A;  4B3U A;  3A23 A;  3EF2 A;  3CKV A;  4ZFY B;  1VIC A;  1TWM A;  4ISR A;  3T7O A;  2FY7 A;  2PX7 A;  3R3I A;  3ZGF A;  1AVW B;  5BXS A;  3HN1 A;  3POL A;  3H6S E;  4X39 A;  4Q9P A;  3FJC A;  3BAO A;  1PZT A;  1WT3 A;  2V0H A;  4KEK A;  1Z2V A;  4I4Q A;  4EEO A;  5IDT A;  4L4I A;  4D8H A;  4LO0 A;  3QR5 A;  2Y7A A;  4Y7V A;  4I4X A;  4I37 A;  1T4Q A;  2GO2 A;  3MPP G;  4EFR A;  4KXO A;  3SX5 A;  4LO8 B;  5EJ1 A;  1GQ9 A;  1DFQ A;  2YC5 A;  5HPZ A;  3Q7W A;  2E4M C;  2NP0 A;  5DDV A;  4G6M A;  1TFM B;  1JT3 A;  4END A;  2D23 A;  3BRD A;  1SR4 C;  5FZY A;  3BRG C;  4QKR A;  4GP0 A;  1I52 A;  2E3D A;  3D7W B;  1MC3 A;  2GZB A;  3BTA A;  4I8M A;  4KEI A;  2WVL A;  3CA4 A;  2M49 A;  4ZBV B;  1GX4 A;  1FMZ A;  2AH9 A;  1BFG A;  1HWN B;  1UPS A;  2ERM A;  1KNM A;  1TW5 A;  2VXL A;  3DJ4 A;  4B5B A;  3N7K A;  1LZ7 A;  1VH1 A;  2Q4J A;  3SXE A;  3CGX A;  1R7V A;  3BAV A;  4QC4 A;  1H5S C;  1VH3 A;  3OH0 A;  1FWY A;  1ISY A;  4G3S A;  3JRR A;  1WT0 A;  2JCL A;  4HO3 A;  1HM9 A;  3WO2 A;  4Y9X A;  4AAW A;  5L6S A;  3WMU A;  1PWA A;  2BFH A;  3OH3 A;  1ZJO A;  1HIB A;  4KC1 A;  5AJN A;  3V0A A;  2D24 A;  5EC5 A;  4AN7 B;  3POK A;  1YP2 A;  5C1L A;  3W9T A;  2LIE A;  3RMX A;  1S4N A;  3K1X A;  2ICY A;  3U0Y A;  1PUM B;  5HS2 A;  1GWV A;  1S0C A;  1W55 A;  2NXV A;  1TIE A;  1PUU B;  2E4M A;  1TZF A;  4J18 A;  4Y7T A;  5C49 A;  3ZGG A;  2HWA A;  1G9B A;  1ZCT A;  2ZR1 B;  4DE7 A;  1SR4 A;  3A22 A;  4FRD A;  3RTI B;  1G95 A;  2VXM A;  2VSH A;  1ISV A;  3OKR A;  2Y4M A;  3TQD A;  5BXP A;  1JT4 A;  1JY0 A;  3ZLL A;  1G97 A;  1HV9 A;  5BQU C;  2ET2 A;  1A8D A;  4ZDQ A;  5C4E A;  5L6V A;  1JT5 A;  3FJ9 A;  4IQP A;  3ZC9 A;  3PME A;  4EEA A;  4XFT A;  5JMC A;  1ISZ A;  3N0K A;  4B4B A;  3OJM A;  4LO1 C;  4LO7 C;  1H7T A;  2YQC A;  2VFZ A;  2RG9 B;  3OGZ A;  1N4K A;  1H7Q A;  3OAM A;  2F2F A;  4MYB A;  1QG8 A;  3LLP A;  1HWO B;  4KQL A;  1FXJ A;  2XWM A;  4KRV A;  5C3D A;  3FJD A;  2BEA A;  4IY8 A;  1VGZ A;  4XFS A;  4FQW A;  3U2T A;  2HWM A;  1XYF A;  3A21 A;  4GAF A;  1NMM B;  3FOQ A;  4JKX B;  4X38 A;  3CRI A;  1J0S A;  5FU0 A;  2VSA A;  1IIL A;  5E24 E;  1M2T B;  1S0F A;  1QGQ A;  1V83 A;  3DK5 A;  4USO A;  3TZT A;  1FWU A;  3FUO A;  3N7J A;  1PZZ A;  4LO7 B;  3VEQ A;  2K8R A;  3ZF8 A;  5C3B A;  4KT7 A;  5DDT A;  3I0D A;  1HCD A;  5F8Y A;  2NVH A;  3CA5 A;  5BP5 C;  1ZJP A;  2V0I A;  2VD4 A;  5CMI A;  4OWJ A;  3RSJ A;  5BQU A;  3SXG A;  5C4D A;  1EV2 A;  2E8B A;  1EZI A;  3AH2 A;  1ZCU A;  5CMG X;  3VT0 A;  4F34 A;  1V6W A;  5BVP I;  2PGV A;  3OGG A;  2NTD A;  4OW4 A;  4LO1 A;  3CRG A;  5FYE A;  4CJM A;  3PUB A;  4OEE A;  3HL3 A;  4J23 B;  3V79 C;  1HWP B;  1AXM A;  1Q03 A;  2VS4 A;  4DEP A;  4XFU A;  1R8N A;  3F62 B;  1G93 A;  4FRH A;  3UD7 A;  1NQI B;  4EEE B;  1G0R A;  2MZB A;  3HSM A;  3FFZ A;  1V82 A;  3AKH A;  5FU8 A;  1MD6 A;  2O1H A;  4H9W A;  2RJ8 A;  4P02 A;  2DRY A;  3HOM A;  4I4P A;  1O7Q A;  2YCM A;  3CRH A;  4I4U A;  3WO4 A;  1DZD A;  3S8K A;  1ZDF A;  2BO6 A;  3T7N A;  2JCJ A;  1W57 A;  4AYJ A;  1FGG A;  2JCO A;  1L2H A;  2LIQ A;  2RJ7 A;  5JQQ A;  3NJ5 A;  1WSZ A;  1ZDG A;  3BX1 C;  5BP5 A;  3FJB A;  5EG6 C;  1VGT A;  1YF8 B;  3BCV A;  5C4B A;  3FJH A;  4HO9 A;  4FCE A;  4ZKT B;  4AYL A;  2Y6P A;  2F8X C;  1AVX B;  1BAS A;  1IT0 A;  4JD0 A;  3IOJ A;  5D61 A;  3V8Y A;  4JQ0 A;  4R6U B;  3PHZ A;  4M2B A;  2Z87 A;  5FNW A;  2RJ5 A;  4HCQ A;  1BLA A;  1FGX A;  1WT2 A;  2D0J A;  3E26 A;  2FYA A;  2DPW A;  1DLL A;  1ABR B;  4G1R A;  2BO7 A;  3E25 A;  1K5U A;  3CKO A;  1S0L A;  2XWN A;  2RJ0 A;  2P6W A;  1RML A;  3IOI A;  1KWS A;  3O4C A;  1WT1 A;  2XWL A;  4NAL A;  2RIT A;  4EE3 A;  3OH2 A;  1XHB A;  2FFU A;  2VSE A;  3FJ8 A;  4YOL A;  4JRA A;  3Q7X A;  1NHE B;  3RSB A;  4CJC A;  1ZJ2 A;  1JLY A;  3CA1 A;  3O4D A;  3BA4 A;  3O49 A;  4B2X A;  3N7L A;  1H7F A;  3I2A A;  1IIN A;  4F83 A;  4D0Z A;  4CJ8 A;  3OH4 A;  41BI A;  5F8W A;  3Q4S A;  2RIX A;  5AJO A;  3V91 A;  1LZ0 A;  1FO9 A;  5CMJ A;  1H5T B;  3OBR A;  5BOW A;  1PC8 B;  3P6I A;  4EE4 A;  5J49 A;  4DEN A;  2HZ9 A;  5FZU A;  3V0A B;  5BXR A;  3I2X A;  2CU2 A;  1O0R A;  5C1G A;  4I4R A;  1VCL A;  1JTC A;  1D0H A;  3IM7 A;  4J2K A;  2WVM A;  3V90 A;  1O7O A;  2GGO A;  4Y7F A;  4Y7U A;  4NAN A;  1XZ6 A;  4G3Q A;  2OEF A;  4LW3 A;  1FN0 A;  3HBW A;  2AGD A;  2P72 A;  3U2U A;  3N7M A;  3NBN A;  2WE9 A;  4Y7G A;  1H5T A;  5C1H A;  2Z48 A;  3OC9 A;  1V6U A;  2FYC B;  5C4F A;  4OUJ A;  2RJ4 A;  3AKI A;  1LVW A;  4FRM A;  4HO2 A;  4L4H A;  3PNN A;  3ZX7 A;  3FJJ A;  1JYK A;  1CE7 B;  3CKJ A;  5AJP A;  2PGY A;  2NYY A;  4I4V A;  1W77 A;  3N9W A;  2NZ9 A;  2AFG A;  4IZX A;  1H5S B;  4JKQ A;  4LO2 C;  2I5E A;  3USQ A;  3BRF A;  1ZIZ A;  2AM4 A;  1HWM B;  1W3G A;  2BO8 A;  4AC3 A;  4HG6 A;  3ZC8 A;  8I1B A;  4M4K A;  1DFC A;  3V0P A;  2AE7 A;  1G8O A;  4QO3 A;  3WIN C;  3SX7 A;  1S0E A;  4IZE A;  1G9A A;  1JVD A;  2Y9G A;  4M2A A;  4QBC A;  3BAQ A;  3T8S A;  3VT2 A;  4I4O A;  3O3P A;  2DS0 A;  1TWE A;  1YXW A;  2D43 A;  1V6V A;  1HKN A;  1ITB A;  3CA3 A;  3FJE A;  4AN6 A;  2QKX A;  1H5S A;  2Z86 A;  4QD2 C;  4Y63 A;  1QQL A;  3SX3 A;  1MC9 A;  1Z4S A;  1NKH B;  1ZCV A;  2Y4J A;  3AZV A;  1OQL B;  3CQA A;  4JIS A;  1EPW A;  2OEG A;  1R7T A;  2MIB A;  4FRA A;  1R80 A;  3D8V A;  1BAR A;  2J3P A;  1FO8 A;  5C36 A;  2D7R A;  2FYB A;  2AES A;  1HM0 A;  2XME A;  4J2X A;  3AKF A;  2D20 A;  1JV1 A;  3RMY A;  2X5Z A;  1TTU A;  3V0O A;  3C9Z A;  2V0L A;  4J2S A;  3O5W B;  3AZW A;  1WVC A;  2RIY A;  1AVU A;  2FFV A;  4LW6 A;  4ASJ A;  2UUS A;  5F90 A;  4KC2 A;  1HM8 A;  2ZQO A;  3V0N A;  2ESU A;  4LO2 A;  4P0J A;  3HMY A;  4FVV A;  2KI4 A;  1IJT A;  1DIW A;  4EEG A;  2ICX A;  3BA5 A;  1II4 A;  4GP3 A;  3WMV A;  2K4A B;  2WRY A;  4GOY A;  5GAQ A;  2WGZ A;  3WIN A;  2WVK A;  4ZOT A;  3V0Q A;  4GBP A;  1P63 A;  2O1G A;  4UEG A;  3I0H A;  4C2S A;  4KC4 A;  2WBC A;  1PZY B;  1GA8 A;  1JLX A;  1H4D A;  2V0J A;  3T7M A;  5DSS B;  3V8Z A;  2AEC A;  2PA4 A;  3HAL A;  3JUJ A;  3SXC A;  1Q1U A;  2AQZ A;  4EEM A;  2OI6 A;  1INI A;  2OI5 A;  3SXD A;  5CMH A;  4ECM A;  2IHO A;  4HO0 A;  1G9C A;  4G6J A;  1ZI1 A;  4A7Y A;  1JYL A;  1WBA A;  3FJK A;  3CU1 B;  5CMF X;  3FUQ A;  4Y6U A;  1S4O A;  3IM6 A;  2YQS A;  1H7L A;  4JP0 A;  2VS3 A;  1RY7 A;  3DUV A;  4HR6 C;  2OI7 A;  4HO4 A;  4BMA A;  1EYR A;  2NM1 A;  2R9K B;  1IIM A;  2VXT I;  4ISQ A;  3UD8 A;  2D7I A;  1OMZ A;  1ONK B;  1XG6 A;  1VZX A;  3I0E A;  3Q7U A;  3U2V A;  5BXC A;  3FGM A;  1FOA A;  4Y64 A;  1R8O A;  4ASY A;  4EFP A;  4DEC A;  5FNX A;  2FO1 A;  2AM5 A;  2GGQ A;  4CJB A;  3IIR A;  1FWV A;  1QWJ A;  3IOH A;  3U0X A;  4EE5 A;  5EIY A;  1ZI5 A;  4HO6 A;  1BFB A;  3FJI A;  1FV3 A;  1GX0 A;  2RJ6 A;  3V0B B;  1AFC A;  2YC3 A;  3PKQ A;  3VSZ A;  3BAH A;  5IDS A;  1QQK A;  21BI A;  2IWT B;  3H6Q A;  4Q9G A;  1O23 B;  1OQM B;  2QGI A;  1BFF A;  2DRE A;  2VXR A;  4I4S A;  2DRZ A;  4ION A;  1TOO A;  4P6A A;  2XMH A;  1FR9 A;  3JUK A;  4LO0 C;  1DQO A;  3I0K A;  4HO8 A;  4ARW A;  3A07 A;  3K8D A;  3CA0 A;  5CQP A;  4IHZ A;  1JQZ A;  3VUO A; 
#chains in the Genus database with same CATH topology
 3V0B A;  4IRP A;  4I96 A;  4I2S A;  2VUA A;  3I0G A;  4G87 A;  5CQL X;  1SZ6 B;  3JUT A;  3Q7Y A;  1YP3 A;  2WEE A;  1R82 A;  1TP0 A;  1OMX A;  2Q3N B;  3BAD A;  3BAU A;  4ZA3 B;  2RJ9 A;  3I0L A;  1R81 A;  5C4C A;  4QBV A;  2MLL B;  3BAG A;  5FZZ A;  4EB2 B;  3F1C A;  2X2S A;  4YS8 A;  4MIX A;  2KI6 B;  2KLL A;  2WAW A;  3FWW A;  4G9M A;  2VLC A;  4I1B A;  4Z8S B;  3AKG A;  4DCK C;  4OWL A;  1VZU A;  3OJV A;  5EHA A;  1NUN A;  2RST A;  1LL0 A;  1DQG A;  5IFY A;  4NAI A;  3O44 A;  4D11 C;  5C48 A;  1BA7 A;  5CQO A;  1LZJ A;  4B4G A;  4FRO A;  1QGS A;  2BEB A;  1MP3 A;  4X3A A;  4EKX B;  1Z90 A;  2O1F A;  4KNR A;  4R7P A;  1ON8 A;  1DJS B;  2JCK A;  1H3M A;  4J2Y A;  5C3A A;  1QXM A;  2VK9 A;  2P23 A;  3UJ0 A;  4D0T A;  2YUG A;  2RQ9 A;  3BB2 A;  3NBE A;  3FJA A;  4GOV A;  4HJJ A;  3VWC A;  2YES A;  3TC2 A;  3UDA A;  1GWW A;  4FCU A;  4ZGR B;  4USP A;  1G3L A;  4XWI A;  1FXO A;  2Y4K A;  1H5R A;  3NBC A;  1MP4 A;  1WD3 A;  3CKQ A;  1EVT A;  3I0F A;  4I1E A;  1G1L A;  3V0M A;  5D91 A;  1H5S D;  1VGU A;  2VSI A;  2I7B A;  3OBT A;  3CAH A;  1H7G A;  1CVS A;  1EYL A;  3I29 B;  4I7I A;  3OJ2 A;  6I1B A;  1K4V A;  4Y6N A;  4G9N A;  1LL2 A;  4E1K A;  1I1E A;  5FUH A;  4FRP A;  4NAK A;  3E8L C;  3NGW A;  1ZJ1 A;  4ZFU B;  1BLD A;  1S0G A;  1LZI A;  1T9F A;  2V0K A;  2RIZ A;  3SXB A;  3SNV A;  4CVH A;  3OGF A;  1ZI4 A;  4K6R A;  4FIX A;  4B42 A;  3O3Q A;  4D11 A;  1V6X A;  2MC2 A;  1GQC A;  4II0 A;  1BFC A;  2Y9X E;  4IY9 A;  4X37 A;  1G23 A;  3WA1 A;  2W0V A;  2ZU7 A;  3OH1 A;  3F1Y A;  4B4M A;  2D44 A;  1JV3 A;  4FRB A;  1LL3 A;  4MND A;  2QYI B;  2A8U A;  2QN4 A;  2X5S A;  1HCE A;  1TVY A;  1E5K A;  1ZHJ A;  2FDB M;  2Y9W C;  3RMW A;  3CA6 A;  3V0L A;  2F2F C;  3ILA A;  1NWG B;  4A7K A;  1IOB A;  2AAI B;  3O4O A;  1ISW A;  5BXT A;  3Q80 A;  4IYB A;  5C38 A;  1GGP B;  3S8J A;  4A7Z A;  3USR A;  3B9U A;  2J0B A;  1FQ9 A;  1YBI A;  5I1F A;  4OWK A;  5DVH A;  3F1R A;  3UJ4 A;  1K5V A;  2C0N A;  3QYD A;  1NZK A;  2ZQN A;  2FGF A;  3SPT A;  2Q9X A;  4QKS A;  4Q91 A;  1G9D A;  4G3P A;  2X2T A;  5JLV A;  2BO4 A;  1VZT A;  2I5K A;  1VM8 A;  1Q04 A;  1FZW A;  3CU0 A;  4PC4 A;  3I0I X;  2KKI A;  4OEG A;  5CQM X;  3ZLK A;  3WO3 A;  4JAW A;  1XZZ A;  1RZO B;  1ISX A;  4P00 A;  2VU9 A;  4QD2 B;  2A8W A;  4KNX A;  1YRO B;  1G9R A;  4KPX A;  1I1B A;  2J0A A;  1AF9 A;  1W3F A;  3IAG C;  1WD4 A;  4XKI A;  4P0L A;  3U2W A;  5D63 A;  3FJF A;  4I6I A;  1F31 A;  1FRW A;  3MAL A;  1E0O A;  1ZI3 A;  1SS9 A;  4HA2 A;  4OEF A;  5DUY A;  2K43 A;  4QAL A;  1H7H A;  3PKP A;  4HO5 A;  1AVA C;  3O4A A;  2P73 A;  4Y62 A;  1W3A A;  3NBD A;  3EE5 A;  4FRQ A;  1YTO A;  2W0W A;  3QVB A;  2D22 A;  4WBC A;  2VS5 A;  1ZJ3 A;  1JVG A;  1S0D A;  3O4B A;  3LTQ A;  7I1B A;  1HJJ A;  5EJZ A;  4UY4 A;  4FRL A;  1TW1 A;  2AM3 A;  1M16 A;  3AH1 A;  3AJ5 A;  2ZU9 A;  5FTS A;  4TLP A;  1VPA A;  4HOC A;  1FG5 N;  1YYN A;  2D1Z A;  4GAI A;  1H4C A;  4KEJ A;  1IRP A;  3AH4 A;  1G82 A;  3D98 A;  3P53 A;  4M28 A;  3ST8 A;  3KMV A;  4BQH A;  2NS2 A;  2L5X A;  2FYD B;  1DZC A;  1FR8 A;  5B2H A;  9ILB A;  2Y9F A;  3LW6 A;  2RJ1 A;  3GUE A;  3R2W A;  2Z49 A;  2Y4L A;  4FRE A;  3I0J A;  4KBB A;  1FV2 A;  3RTJ B;  2UX8 A;  5I1B A;  2X65 A;  3PG0 A;  4Z9W B;  4IRQ A;  1FGA A;  1V84 A;  1G2V A;  1ILR 1;  4LO3 C;  1NF5 B;  4B2W A;  2APC A;  1Z0H A;  3R4U A;  1S0B A;  4I3N A;  1R7Y A;  2ZU8 A;  4KC3 A;  3I0C A;  4MZF B;  3P6J A;  2X60 A;  4FGF A;  5C47 A;  1H7E A;  4DDZ A;  3ZXD A;  3KIA A;  3BA7 A;  5FTV A;  1RG8 A;  4L41 C;  4ZFW B;  3AJ6 A;  4JPZ A;  1HJL A;  4P0K A;  5DZU A;  1R7U A;  4EFQ A;  2HW9 A;  3H6R B;  1ON6 A;  5FV9 A;  2XOA A;  2AXM A;  5C8R A;  1FMM S;  1WBC A;  4ZLB B;  1H4E A;  1ZCY A;  3UD9 A;  2YQJ A;  4I0Y A;  4H04 A;  3VSF A;  1YP4 A;  2P39 A;  3R4S A;  1ZJ0 A;  5G00 A;  3RMV A;  3SX8 A;  3JTJ A;  3H6R A;  31BI A;  1R7X A;  2QH5 A;  3VT1 A;  1MP5 A;  3SXA A;  3D5N A;  3U2X A;  5D62 A;  1IHK A;  3BRK X;  2I1B A;  1INJ A;  1S4P A;  2YQH A;  3K8E A;  3IM5 A;  5CQN X;  4LO3 A;  1VGW A;  4EVW A;  1H5R B;  2KH2 A;  3ZXG A;  3CKN A;  4D48 A;  4I4Y A;  1IRA X;  1JT7 A;  5F8S A;  4KPZ A;  4B3U A;  3A23 A;  3EF2 A;  3CKV A;  4ZFY B;  1VIC A;  1TWM A;  4ISR A;  3T7O A;  2FY7 A;  2PX7 A;  3R3I A;  3ZGF A;  1AVW B;  5BXS A;  3HN1 A;  3POL A;  3H6S E;  4X39 A;  4Q9P A;  3FJC A;  3BAO A;  1PZT A;  1WT3 A;  2V0H A;  4KEK A;  1Z2V A;  4I4Q A;  4EEO A;  5IDT A;  4L4I A;  4D8H A;  4LO0 A;  3QR5 A;  2Y7A A;  4Y7V A;  4I4X A;  4I37 A;  1T4Q A;  2GO2 A;  3MPP G;  4EFR A;  4KXO A;  3SX5 A;  4LO8 B;  5EJ1 A;  1GQ9 A;  1DFQ A;  2YC5 A;  5HPZ A;  3Q7W A;  2E4M C;  2NP0 A;  5DDV A;  4G6M A;  1TFM B;  1JT3 A;  4END A;  2D23 A;  3BRD A;  1SR4 C;  5FZY A;  3BRG C;  4QKR A;  4GP0 A;  1I52 A;  2E3D A;  3D7W B;  1MC3 A;  2GZB A;  3BTA A;  4I8M A;  4KEI A;  2WVL A;  3CA4 A;  2M49 A;  4ZBV B;  1GX4 A;  1FMZ A;  2AH9 A;  1BFG A;  1HWN B;  1UPS A;  2ERM A;  1KNM A;  1TW5 A;  2VXL A;  3DJ4 A;  4B5B A;  3N7K A;  1LZ7 A;  1VH1 A;  2Q4J A;  3SXE A;  3CGX A;  1R7V A;  3BAV A;  4QC4 A;  5D92 A;  1H5S C;  1VH3 A;  3OH0 A;  1FWY A;  1ISY A;  4G3S A;  4Q7C A;  3JRR A;  1WT0 A;  2JCL A;  4HO3 A;  1HM9 A;  3WO2 A;  4Y9X A;  4AAW A;  5L6S A;  3WMU A;  1PWA A;  2BFH A;  3OH3 A;  1ZJO A;  1HIB A;  4KC1 A;  5AJN A;  3V0A A;  2D24 A;  5EC5 A;  4AN7 B;  3POK A;  1YP2 A;  5C1L A;  3W9T A;  2LIE A;  3RMX A;  1S4N A;  3K1X A;  2ICY A;  3U0Y A;  1PUM B;  5HS2 A;  1GWV A;  1S0C A;  1W55 A;  2NXV A;  1TIE A;  1PUU B;  2E4M A;  1TZF A;  4J18 A;  4Y7T A;  5C49 A;  3ZGG A;  2HWA A;  1G9B A;  1ZCT A;  2ZR1 B;  4DE7 A;  1SR4 A;  3A22 A;  4FRD A;  3RTI B;  1G95 A;  2VXM A;  2VSH A;  1ISV A;  3OKR A;  2Y4M A;  3TQD A;  5BXP A;  1JT4 A;  1JY0 A;  3ZLL A;  1G97 A;  1HV9 A;  5BQU C;  2ET2 A;  1A8D A;  4ZDQ A;  5C4E A;  5L6V A;  1JT5 A;  3FJ9 A;  4IQP A;  3ZC9 A;  3PME A;  4EEA A;  4XFT A;  5JMC A;  1ISZ A;  3N0K A;  4B4B A;  3OJM A;  4LO1 C;  4LO7 C;  1H7T A;  2YQC A;  2VFZ A;  2RG9 B;  3OGZ A;  1N4K A;  1H7Q A;  3OAM A;  2F2F A;  4MYB A;  1QG8 A;  3LLP A;  1HWO B;  4KQL A;  1FXJ A;  2XWM A;  4KRV A;  5C3D A;  3FJD A;  2BEA A;  4IY8 A;  1VGZ A;  4XFS A;  4FIY A;  4FQW A;  4O6N A;  3U2T A;  2HWM A;  1XYF A;  3A21 A;  4GAF A;  4H75 A;  1NMM B;  4JKX B;  4X38 A;  3CRI A;  3FOQ A;  1J0S A;  5FU0 A;  2VSA A;  1IIL A;  5E24 E;  1M2T B;  1S0F A;  1QGQ A;  1V83 A;  3DK5 A;  4USO A;  3TZT A;  1FWU A;  3FUO A;  3N7J A;  1PZZ A;  4LO7 B;  3VEQ A;  2K8R A;  3ZF8 A;  5C3B A;  4KT7 A;  5DDT A;  3I0D A;  1HCD A;  5F8Y A;  2NVH A;  3CA5 A;  5BP5 C;  1ZJP A;  2V0I A;  2VD4 A;  5CMI A;  4OWJ A;  3RSJ A;  5BQU A;  3SXG A;  5C4D A;  1EV2 A;  2E8B A;  1EZI A;  3AH2 A;  1ZCU A;  5CMG X;  3VT0 A;  4F34 A;  1V6W A;  5BVP I;  2PGV A;  3OGG A;  2NTD A;  4OW4 A;  4LO1 A;  3CRG A;  5FYE A;  4CJM A;  3PUB A;  4OEE A;  3HL3 A;  4J23 B;  3V79 C;  1HWP B;  1AXM A;  1Q03 A;  2VS4 A;  4DEP A;  4XFU A;  1R8N A;  3F62 B;  1G93 A;  4FRH A;  4O6M A;  3UD7 A;  1NQI B;  4EEE B;  1G0R A;  2MZB A;  3HSM A;  3FFZ A;  1V82 A;  3AKH A;  5FU8 A;  1MD6 A;  2O1H A;  4H9W A;  2RJ8 A;  4P02 A;  2DRY A;  3HOM A;  4I4P A;  1O7Q A;  2YCM A;  3CRH A;  4I4U A;  3WO4 A;  1DZD A;  3S8K A;  1ZDF A;  2BO6 A;  3T7N A;  2JCJ A;  1W57 A;  4AYJ A;  1FGG A;  2JCO A;  1L2H A;  2LIQ A;  2RJ7 A;  5JQQ A;  3NJ5 A;  1WSZ A;  1ZDG A;  3BX1 C;  5BP5 A;  3FJB A;  5EG6 C;  1VGT A;  1YF8 B;  3BCV A;  5C4B A;  3FJH A;  4HO9 A;  4FCE A;  4ZKT B;  4AYL A;  2Y6P A;  2F8X C;  1AVX B;  1BAS A;  1IT0 A;  4JD0 A;  3IOJ A;  5D61 A;  3V8Y A;  4JQ0 A;  4R6U B;  3PHZ A;  4M2B A;  2Z87 A;  5FNW A;  2RJ5 A;  4HCQ A;  1BLA A;  1FGX A;  1WT2 A;  2D0J A;  3E26 A;  2FYA A;  2DPW A;  1DLL A;  1ABR B;  4G1R A;  2BO7 A;  3E25 A;  1K5U A;  3CKO A;  1S0L A;  2XWN A;  2RJ0 A;  2P6W A;  1RML A;  3IOI A;  1KWS A;  3O4C A;  1WT1 A;  2XWL A;  4NAL A;  2RIT A;  4EE3 A;  3OH2 A;  1XHB A;  2FFU A;  2VSE A;  3FJ8 A;  4YOL A;  4JRA A;  3Q7X A;  1NHE B;  3RSB A;  4CJC A;  1ZJ2 A;  1JLY A;  3CA1 A;  3O4D A;  3BA4 A;  3O49 A;  4MZG B;  4B2X A;  3N7L A;  1H7F A;  3I2A A;  1IIN A;  4F83 A;  4D0Z A;  4CJ8 A;  3OH4 A;  41BI A;  5F8W A;  3Q4S A;  2RIX A;  5AJO A;  3V91 A;  1LZ0 A;  1FO9 A;  5CMJ A;  1H5T B;  3OBR A;  5BOW A;  1PC8 B;  3P6I A;  4EE4 A;  5J49 A;  4DEN A;  2HZ9 A;  5FZU A;  3V0A B;  5BXR A;  3I2X A;  2CU2 A;  1O0R A;  5C1G A;  4I4R A;  1VCL A;  1JTC A;  1D0H A;  3IM7 A;  4J2K A;  2WVM A;  3V90 A;  1O7O A;  2GGO A;  4Y7F A;  4Y7U A;  4NAN A;  1XZ6 A;  4G3Q A;  2OEF A;  4LW3 A;  1FN0 A;  3HBW A;  2AGD A;  2P72 A;  3U2U A;  3N7M A;  3NBN A;  2WE9 A;  4Y7G A;  1H5T A;  5C1H A;  2Z48 A;  3OC9 A;  1V6U A;  2FYC B;  5C4F A;  4OUJ A;  2RJ4 A;  3AKI A;  1LVW A;  4FRM A;  4HO2 A;  4L4H A;  3PNN A;  3ZX7 A;  3FJJ A;  1JYK A;  1CE7 B;  3CKJ A;  5AJP A;  2PGY A;  2NYY A;  4I4V A;  1W77 A;  3N9W A;  2NZ9 A;  2AFG A;  4IZX A;  1H5S B;  4JKQ A;  4LO2 C;  2I5E A;  3USQ A;  3BRF A;  1ZIZ A;  2AM4 A;  1HWM B;  1W3G A;  2BO8 A;  4AC3 A;  4HG6 A;  3ZC8 A;  8I1B A;  4M4K A;  1DFC A;  3V0P A;  2AE7 A;  1G8O A;  4QO3 A;  3WIN C;  3SX7 A;  1S0E A;  4IZE A;  1G9A A;  1JVD A;  2Y9G A;  4M2A A;  4QBC A;  3BAQ A;  3T8S A;  3VT2 A;  4I4O A;  3O3P A;  2DS0 A;  1TWE A;  1YXW A;  2D43 A;  1V6V A;  1HKN A;  1ITB A;  3CA3 A;  3FJE A;  4AN6 A;  2QKX A;  1H5S A;  2Z86 A;  4QD2 C;  4Y63 A;  1QQL A;  3SX3 A;  1MC9 A;  1Z4S A;  1NKH B;  1ZCV A;  2Y4J A;  3AZV A;  1OQL B;  3CQA A;  4JIS A;  1EPW A;  2OEG A;  1R7T A;  2MIB A;  4FRA A;  1R80 A;  3D8V A;  1BAR A;  2J3P A;  1FO8 A;  5C36 A;  2D7R A;  2FYB A;  2AES A;  1HM0 A;  2XME A;  4J2X A;  3AKF A;  2D20 A;  1JV1 A;  3RMY A;  2X5Z A;  1TTU A;  3V0O A;  3C9Z A;  2V0L A;  4J2S A;  3O5W B;  3AZW A;  1WVC A;  2RIY A;  1AVU A;  2FFV A;  4LW6 A;  4ASJ A;  2UUS A;  5F90 A;  4KC2 A;  1HM8 A;  2ZQO A;  3V0N A;  2ESU A;  4LO2 A;  4P0J A;  3HMY A;  4FVV A;  2KI4 A;  1IJT A;  1DIW A;  4EEG A;  2ICX A;  3BA5 A;  1II4 A;  4GP3 A;  3WMV A;  2K4A B;  2WRY A;  4GOY A;  5GAQ A;  2WGZ A;  3WIN A;  2WVK A;  4ZOT A;  3V0Q A;  4GBP A;  1P63 A;  4MZH A;  2O1G A;  4UEG A;  3I0H A;  4C2S A;  4KC4 A;  2WBC A;  1PZY B;  1GA8 A;  1JLX A;  1H4D A;  2V0J A;  3T7M A;  5DSS B;  3V8Z A;  2AEC A;  2PA4 A;  3HAL A;  3JUJ A;  3SXC A;  1Q1U A;  2AQZ A;  4EEM A;  2OI6 A;  1INI A;  2OI5 A;  3SXD A;  5CMH A;  4ECM A;  2IHO A;  4HO0 A;  1G9C A;  4G6J A;  1ZI1 A;  4A7Y A;  1JYL A;  1WBA A;  3FJK A;  3CU1 B;  5CMF X;  3FUQ A;  4Y6U A;  1S4O A;  3IM6 A;  2YQS A;  1H7L A;  4JP0 A;  2VS3 A;  1RY7 A;  3DUV A;  4HR6 C;  2OI7 A;  4HO4 A;  4BMA A;  1EYR A;  2NM1 A;  2R9K B;  1IIM A;  2VXT I;  4ISQ A;  3UD8 A;  2D7I A;  1OMZ A;  1ONK B;  1XG6 A;  1VZX A;  3I0E A;  3Q7U A;  3U2V A;  5BXC A;  3FGM A;  1FOA A;  4Y64 A;  1R8O A;  4ASY A;  4EFP A;  4DEC A;  5FNX A;  2FO1 A;  2AM5 A;  2GGQ A;  4CJB A;  3IIR A;  1FWV A;  1QWJ A;  3IOH A;  3U0X A;  4EE5 A;  5EIY A;  1ZI5 A;  4HO6 A;  1BFB A;  3FJI A;  1FV3 A;  1GX0 A;  2RJ6 A;  3V0B B;  1AFC A;  2YC3 A;  3PKQ A;  3VSZ A;  3BAH A;  5IDS A;  1QQK A;  21BI A;  2IWT B;  3H6Q A;  4Q9G A;  1O23 B;  1OQM B;  2QGI A;  1BFF A;  2DRE A;  2VXR A;  4I4S A;  2DRZ A;  4ION A;  1TOO A;  4P6A A;  2XMH A;  1FR9 A;  3JUK A;  4LO0 C;  1DQO A;  3I0K A;  4HO8 A;  4ARW A;  3A07 A;  3K8D A;  3CA0 A;  5CQP A;  4IHZ A;  1JQZ A;  3VUO A; 
#chains in the Genus database with same CATH homology
 3V0B A;  4IRP A;  4I96 A;  4I2S A;  2VUA A;  3I0G A;  4G87 A;  5CQL X;  1SZ6 B;  3JUT A;  3Q7Y A;  1YP3 A;  2WEE A;  1R82 A;  1TP0 A;  1OMX A;  2Q3N B;  3BAD A;  3BAU A;  4ZA3 B;  2RJ9 A;  3I0L A;  1R81 A;  5C4C A;  4QBV A;  2MLL B;  3BAG A;  5FZZ A;  4EB2 B;  3F1C A;  2X2S A;  4YS8 A;  4MIX A;  2KI6 B;  2KLL A;  2WAW A;  3FWW A;  4G9M A;  2VLC A;  4I1B A;  4Z8S B;  3AKG A;  4DCK C;  4OWL A;  1VZU A;  3OJV A;  5EHA A;  1NUN A;  2RST A;  1LL0 A;  1DQG A;  5IFY A;  4NAI A;  3O44 A;  4D11 C;  5C48 A;  1BA7 A;  5CQO A;  1LZJ A;  4B4G A;  4FRO A;  1QGS A;  2BEB A;  1MP3 A;  4X3A A;  4EKX B;  1Z90 A;  2O1F A;  4KNR A;  4R7P A;  1ON8 A;  1DJS B;  2JCK A;  1H3M A;  4J2Y A;  5C3A A;  1QXM A;  2VK9 A;  2P23 A;  3UJ0 A;  4D0T A;  2YUG A;  2RQ9 A;  3BB2 A;  3NBE A;  3FJA A;  4GOV A;  4HJJ A;  3VWC A;  2YES A;  3TC2 A;  3UDA A;  1GWW A;  4FCU A;  4ZGR B;  4USP A;  1G3L A;  4XWI A;  1FXO A;  2Y4K A;  1H5R A;  3NBC A;  1MP4 A;  1WD3 A;  3CKQ A;  1EVT A;  3I0F A;  4I1E A;  1G1L A;  3V0M A;  5D91 A;  1H5S D;  1VGU A;  2VSI A;  2I7B A;  3OBT A;  3CAH A;  1H7G A;  1CVS A;  1EYL A;  3I29 B;  4I7I A;  3OJ2 A;  6I1B A;  1K4V A;  4Y6N A;  4G9N A;  1LL2 A;  4E1K A;  1I1E A;  5FUH A;  4FRP A;  4NAK A;  3E8L C;  3NGW A;  1ZJ1 A;  4ZFU B;  1BLD A;  1S0G A;  1LZI A;  1T9F A;  2V0K A;  2RIZ A;  3SXB A;  3SNV A;  4CVH A;  3OGF A;  1ZI4 A;  4K6R A;  4FIX A;  4B42 A;  3O3Q A;  4D11 A;  1V6X A;  2MC2 A;  1GQC A;  4II0 A;  1BFC A;  2Y9X E;  4IY9 A;  4X37 A;  1G23 A;  3WA1 A;  2W0V A;  2ZU7 A;  3OH1 A;  3F1Y A;  4B4M A;  2D44 A;  1JV3 A;  4FRB A;  1LL3 A;  4MND A;  2QYI B;  2A8U A;  2QN4 A;  2X5S A;  1HCE A;  1TVY A;  1E5K A;  1ZHJ A;  2FDB M;  2Y9W C;  3RMW A;  3CA6 A;  3V0L A;  2F2F C;  3ILA A;  1NWG B;  4A7K A;  1IOB A;  2AAI B;  3O4O A;  1ISW A;  5BXT A;  3Q80 A;  4IYB A;  5C38 A;  1GGP B;  3S8J A;  4A7Z A;  3USR A;  3B9U A;  2J0B A;  1FQ9 A;  1YBI A;  5I1F A;  4OWK A;  5DVH A;  3F1R A;  3UJ4 A;  1K5V A;  2C0N A;  3QYD A;  1NZK A;  2ZQN A;  2FGF A;  3SPT A;  2Q9X A;  4QKS A;  4Q91 A;  1G9D A;  4G3P A;  2X2T A;  5JLV A;  2BO4 A;  1VZT A;  2I5K A;  1VM8 A;  1Q04 A;  1FZW A;  3CU0 A;  4PC4 A;  3I0I X;  2KKI A;  4OEG A;  5CQM X;  3ZLK A;  3WO3 A;  4JAW A;  1XZZ A;  1RZO B;  1ISX A;  4P00 A;  2VU9 A;  4QD2 B;  2A8W A;  4KNX A;  1YRO B;  1G9R A;  4KPX A;  1I1B A;  2J0A A;  1AF9 A;  1W3F A;  3IAG C;  1WD4 A;  4XKI A;  4P0L A;  3U2W A;  5D63 A;  3FJF A;  4I6I A;  1F31 A;  1FRW A;  3MAL A;  1E0O A;  1ZI3 A;  1SS9 A;  4HA2 A;  4OEF A;  5DUY A;  2K43 A;  4QAL A;  1H7H A;  3PKP A;  4HO5 A;  1AVA C;  3O4A A;  2P73 A;  4Y62 A;  1W3A A;  3NBD A;  3EE5 A;  4FRQ A;  1YTO A;  2W0W A;  3QVB A;  2D22 A;  4WBC A;  2VS5 A;  1ZJ3 A;  1JVG A;  1S0D A;  3O4B A;  3LTQ A;  7I1B A;  1HJJ A;  5EJZ A;  4UY4 A;  4FRL A;  1TW1 A;  2AM3 A;  1M16 A;  3AH1 A;  3AJ5 A;  2ZU9 A;  5FTS A;  4TLP A;  1VPA A;  4HOC A;  1FG5 N;  1YYN A;  2D1Z A;  4GAI A;  1H4C A;  4KEJ A;  1IRP A;  3AH4 A;  1G82 A;  3D98 A;  3P53 A;  4M28 A;  3ST8 A;  3KMV A;  4BQH A;  2NS2 A;  2L5X A;  2FYD B;  1DZC A;  1FR8 A;  5B2H A;  9ILB A;  2Y9F A;  3LW6 A;  2RJ1 A;  3GUE A;  3R2W A;  2Z49 A;  2Y4L A;  4FRE A;  3I0J A;  4KBB A;  1FV2 A;  3RTJ B;  2UX8 A;  5I1B A;  2X65 A;  3PG0 A;  4Z9W B;  4IRQ A;  1FGA A;  1V84 A;  1G2V A;  1ILR 1;  4LO3 C;  1NF5 B;  4B2W A;  2APC A;  1Z0H A;  3R4U A;  1S0B A;  4I3N A;  1R7Y A;  2ZU8 A;  4KC3 A;  3I0C A;  4MZF B;  3P6J A;  2X60 A;  4FGF A;  5C47 A;  1H7E A;  4DDZ A;  3ZXD A;  3KIA A;  3BA7 A;  5FTV A;  1RG8 A;  4L41 C;  4ZFW B;  3AJ6 A;  4JPZ A;  1HJL A;  4P0K A;  5DZU A;  1R7U A;  4EFQ A;  2HW9 A;  3H6R B;  1ON6 A;  5FV9 A;  2XOA A;  2AXM A;  5C8R A;  1FMM S;  1WBC A;  4ZLB B;  1H4E A;  1ZCY A;  3UD9 A;  2YQJ A;  4I0Y A;  4H04 A;  3VSF A;  1YP4 A;  2P39 A;  3R4S A;  1ZJ0 A;  5G00 A;  3RMV A;  3SX8 A;  3JTJ A;  3H6R A;  31BI A;  1R7X A;  2QH5 A;  3VT1 A;  1MP5 A;  3SXA A;  3D5N A;  3U2X A;  5D62 A;  1IHK A;  3BRK X;  2I1B A;  1INJ A;  1S4P A;  2YQH A;  3K8E A;  3IM5 A;  5CQN X;  4LO3 A;  1VGW A;  4EVW A;  1H5R B;  2KH2 A;  3ZXG A;  3CKN A;  4D48 A;  4I4Y A;  1IRA X;  1JT7 A;  5F8S A;  4KPZ A;  4B3U A;  3A23 A;  3EF2 A;  3CKV A;  4ZFY B;  1VIC A;  1TWM A;  4ISR A;  3T7O A;  2FY7 A;  2PX7 A;  3R3I A;  3ZGF A;  1AVW B;  5BXS A;  3HN1 A;  3POL A;  3H6S E;  4X39 A;  4Q9P A;  3FJC A;  3BAO A;  1PZT A;  1WT3 A;  2V0H A;  4KEK A;  1Z2V A;  4I4Q A;  4EEO A;  5IDT A;  4L4I A;  4D8H A;  4LO0 A;  3QR5 A;  2Y7A A;  4Y7V A;  4I4X A;  4I37 A;  1T4Q A;  2GO2 A;  3MPP G;  4EFR A;  4KXO A;  3SX5 A;  4LO8 B;  5EJ1 A;  1GQ9 A;  1DFQ A;  2YC5 A;  5HPZ A;  3Q7W A;  2E4M C;  2NP0 A;  5DDV A;  4G6M A;  1TFM B;  1JT3 A;  4END A;  2D23 A;  3BRD A;  1SR4 C;  5FZY A;  3BRG C;  4QKR A;  4GP0 A;  1I52 A;  2E3D A;  3D7W B;  1MC3 A;  2GZB A;  3BTA A;  4I8M A;  4KEI A;  2WVL A;  3CA4 A;  2M49 A;  4ZBV B;  1GX4 A;  1FMZ A;  2AH9 A;  1BFG A;  1HWN B;  1UPS A;  2ERM A;  1KNM A;  1TW5 A;  2VXL A;  3DJ4 A;  4B5B A;  3N7K A;  1LZ7 A;  1VH1 A;  2Q4J A;  3SXE A;  3CGX A;  1R7V A;  3BAV A;  4QC4 A;  5D92 A;  1H5S C;  1VH3 A;  3OH0 A;  1FWY A;  1ISY A;  4G3S A;  4Q7C A;  3JRR A;  1WT0 A;  2JCL A;  4HO3 A;  1HM9 A;  3WO2 A;  4Y9X A;  4AAW A;  5L6S A;  3WMU A;  1PWA A;  2BFH A;  3OH3 A;  1ZJO A;  1HIB A;  4KC1 A;  5AJN A;  3V0A A;  2D24 A;  5EC5 A;  4AN7 B;  3POK A;  1YP2 A;  5C1L A;  3W9T A;  2LIE A;  3RMX A;  1S4N A;  3K1X A;  2ICY A;  3U0Y A;  1PUM B;  5HS2 A;  1GWV A;  1S0C A;  1W55 A;  2NXV A;  1TIE A;  1PUU B;  2E4M A;  1TZF A;  4J18 A;  4Y7T A;  5C49 A;  3ZGG A;  2HWA A;  1G9B A;  1ZCT A;  2ZR1 B;  4DE7 A;  1SR4 A;  3A22 A;  4FRD A;  3RTI B;  1G95 A;  2VXM A;  2VSH A;  1ISV A;  3OKR A;  2Y4M A;  3TQD A;  5BXP A;  1JT4 A;  1JY0 A;  3ZLL A;  1G97 A;  1HV9 A;  5BQU C;  2ET2 A;  1A8D A;  4ZDQ A;  5C4E A;  5L6V A;  1JT5 A;  3FJ9 A;  4IQP A;  3ZC9 A;  3PME A;  4EEA A;  4XFT A;  5JMC A;  1ISZ A;  3N0K A;  4B4B A;  3OJM A;  4LO1 C;  4LO7 C;  1H7T A;  2YQC A;  2VFZ A;  2RG9 B;  3OGZ A;  1N4K A;  1H7Q A;  3OAM A;  2F2F A;  4MYB A;  1QG8 A;  3LLP A;  1HWO B;  4KQL A;  1FXJ A;  2XWM A;  4KRV A;  5C3D A;  3FJD A;  2BEA A;  4IY8 A;  1VGZ A;  4XFS A;  4FIY A;  4FQW A;  4O6N A;  3U2T A;  2HWM A;  1XYF A;  3A21 A;  4GAF A;  4H75 A;  1NMM B;  4JKX B;  4X38 A;  3CRI A;  3FOQ A;  1J0S A;  5FU0 A;  2VSA A;  1IIL A;  5E24 E;  1M2T B;  1S0F A;  1QGQ A;  1V83 A;  3DK5 A;  4USO A;  3TZT A;  1FWU A;  3FUO A;  3N7J A;  1PZZ A;  4LO7 B;  3VEQ A;  2K8R A;  3ZF8 A;  5C3B A;  4KT7 A;  5DDT A;  3I0D A;  1HCD A;  5F8Y A;  2NVH A;  3CA5 A;  5BP5 C;  1ZJP A;  2V0I A;  2VD4 A;  5CMI A;  4OWJ A;  3RSJ A;  5BQU A;  3SXG A;  5C4D A;  1EV2 A;  2E8B A;  1EZI A;  3AH2 A;  1ZCU A;  5CMG X;  3VT0 A;  4F34 A;  1V6W A;  5BVP I;  2PGV A;  3OGG A;  2NTD A;  4OW4 A;  4LO1 A;  3CRG A;  5FYE A;  4CJM A;  3PUB A;  4OEE A;  3HL3 A;  4J23 B;  3V79 C;  1HWP B;  1AXM A;  1Q03 A;  2VS4 A;  4DEP A;  4XFU A;  1R8N A;  3F62 B;  1G93 A;  4FRH A;  4O6M A;  3UD7 A;  1NQI B;  4EEE B;  1G0R A;  2MZB A;  3HSM A;  3FFZ A;  1V82 A;  3AKH A;  5FU8 A;  1MD6 A;  2O1H A;  4H9W A;  2RJ8 A;  4P02 A;  2DRY A;  3HOM A;  4I4P A;  1O7Q A;  2YCM A;  3CRH A;  4I4U A;  3WO4 A;  1DZD A;  3S8K A;  1ZDF A;  2BO6 A;  3T7N A;  2JCJ A;  1W57 A;  4AYJ A;  1FGG A;  2JCO A;  1L2H A;  2LIQ A;  2RJ7 A;  5JQQ A;  3NJ5 A;  1WSZ A;  1ZDG A;  3BX1 C;  5BP5 A;  3FJB A;  5EG6 C;  1VGT A;  1YF8 B;  3BCV A;  5C4B A;  3FJH A;  4HO9 A;  4FCE A;  4ZKT B;  4AYL A;  2Y6P A;  2F8X C;  1AVX B;  1BAS A;  1IT0 A;  4JD0 A;  3IOJ A;  5D61 A;  3V8Y A;  4JQ0 A;  4R6U B;  3PHZ A;  4M2B A;  2Z87 A;  5FNW A;  2RJ5 A;  4HCQ A;  1BLA A;  1FGX A;  1WT2 A;  2D0J A;  3E26 A;  2FYA A;  2DPW A;  1DLL A;  1ABR B;  4G1R A;  2BO7 A;  3E25 A;  1K5U A;  3CKO A;  1S0L A;  2XWN A;  2RJ0 A;  2P6W A;  1RML A;  3IOI A;  1KWS A;  3O4C A;  1WT1 A;  2XWL A;  4NAL A;  2RIT A;  4EE3 A;  3OH2 A;  1XHB A;  2FFU A;  2VSE A;  3FJ8 A;  4YOL A;  4JRA A;  3Q7X A;  1NHE B;  3RSB A;  4CJC A;  1ZJ2 A;  1JLY A;  3CA1 A;  3O4D A;  3BA4 A;  3O49 A;  4MZG B;  4B2X A;  3N7L A;  1H7F A;  3I2A A;  1IIN A;  4F83 A;  4D0Z A;  4CJ8 A;  3OH4 A;  41BI A;  5F8W A;  3Q4S A;  2RIX A;  5AJO A;  3V91 A;  1LZ0 A;  1FO9 A;  5CMJ A;  1H5T B;  3OBR A;  5BOW A;  1PC8 B;  3P6I A;  4EE4 A;  5J49 A;  4DEN A;  2HZ9 A;  5FZU A;  3V0A B;  5BXR A;  3I2X A;  2CU2 A;  1O0R A;  5C1G A;  4I4R A;  1VCL A;  1JTC A;  1D0H A;  3IM7 A;  4J2K A;  2WVM A;  3V90 A;  1O7O A;  2GGO A;  4Y7F A;  4Y7U A;  4NAN A;  1XZ6 A;  4G3Q A;  2OEF A;  4LW3 A;  1FN0 A;  3HBW A;  2AGD A;  2P72 A;  3U2U A;  3N7M A;  3NBN A;  2WE9 A;  4Y7G A;  1H5T A;  5C1H A;  2Z48 A;  3OC9 A;  1V6U A;  2FYC B;  5C4F A;  4OUJ A;  2RJ4 A;  3AKI A;  1LVW A;  4FRM A;  4HO2 A;  4L4H A;  3PNN A;  3ZX7 A;  3FJJ A;  1JYK A;  1CE7 B;  3CKJ A;  5AJP A;  2PGY A;  2NYY A;  4I4V A;  1W77 A;  3N9W A;  2NZ9 A;  2AFG A;  4IZX A;  1H5S B;  4JKQ A;  4LO2 C;  2I5E A;  3USQ A;  3BRF A;  1ZIZ A;  2AM4 A;  1HWM B;  1W3G A;  2BO8 A;  4AC3 A;  4HG6 A;  3ZC8 A;  8I1B A;  4M4K A;  1DFC A;  3V0P A;  2AE7 A;  1G8O A;  4QO3 A;  3WIN C;  3SX7 A;  1S0E A;  4IZE A;  1G9A A;  1JVD A;  2Y9G A;  4M2A A;  4QBC A;  3BAQ A;  3T8S A;  3VT2 A;  4I4O A;  3O3P A;  2DS0 A;  1TWE A;  1YXW A;  2D43 A;  1V6V A;  1HKN A;  1ITB A;  3CA3 A;  3FJE A;  4AN6 A;  2QKX A;  1H5S A;  2Z86 A;  4QD2 C;  4Y63 A;  1QQL A;  3SX3 A;  1MC9 A;  1Z4S A;  1NKH B;  1ZCV A;  2Y4J A;  3AZV A;  1OQL B;  3CQA A;  4JIS A;  1EPW A;  2OEG A;  1R7T A;  2MIB A;  4FRA A;  1R80 A;  3D8V A;  1BAR A;  2J3P A;  1FO8 A;  5C36 A;  2D7R A;  2FYB A;  2AES A;  1HM0 A;  2XME A;  4J2X A;  3AKF A;  2D20 A;  1JV1 A;  3RMY A;  2X5Z A;  1TTU A;  3V0O A;  3C9Z A;  2V0L A;  4J2S A;  3O5W B;  3AZW A;  1WVC A;  2RIY A;  1AVU A;  2FFV A;  4LW6 A;  4ASJ A;  2UUS A;  5F90 A;  4KC2 A;  1HM8 A;  2ZQO A;  3V0N A;  2ESU A;  4LO2 A;  4P0J A;  3HMY A;  4FVV A;  2KI4 A;  1IJT A;  1DIW A;  4EEG A;  2ICX A;  3BA5 A;  1II4 A;  4GP3 A;  3WMV A;  2K4A B;  2WRY A;  4GOY A;  5GAQ A;  2WGZ A;  3WIN A;  2WVK A;  4ZOT A;  3V0Q A;  4GBP A;  1P63 A;  4MZH A;  2O1G A;  4UEG A;  3I0H A;  4C2S A;  4KC4 A;  2WBC A;  1PZY B;  1GA8 A;  1JLX A;  1H4D A;  2V0J A;  3T7M A;  5DSS B;  3V8Z A;  2AEC A;  2PA4 A;  3HAL A;  3JUJ A;  3SXC A;  1Q1U A;  2AQZ A;  4EEM A;  2OI6 A;  1INI A;  2OI5 A;  3SXD A;  5CMH A;  4ECM A;  2IHO A;  4HO0 A;  1G9C A;  4G6J A;  1ZI1 A;  4A7Y A;  1JYL A;  1WBA A;  3FJK A;  3CU1 B;  5CMF X;  3FUQ A;  4Y6U A;  1S4O A;  3IM6 A;  2YQS A;  1H7L A;  4JP0 A;  2VS3 A;  1RY7 A;  3DUV A;  4HR6 C;  2OI7 A;  4HO4 A;  4BMA A;  1EYR A;  2NM1 A;  2R9K B;  1IIM A;  2VXT I;  4ISQ A;  3UD8 A;  2D7I A;  1OMZ A;  1ONK B;  1XG6 A;  1VZX A;  3I0E A;  3Q7U A;  3U2V A;  5BXC A;  3FGM A;  1FOA A;  4Y64 A;  1R8O A;  4ASY A;  4EFP A;  4DEC A;  5FNX A;  2FO1 A;  2AM5 A;  2GGQ A;  4CJB A;  3IIR A;  1FWV A;  1QWJ A;  3IOH A;  3U0X A;  4EE5 A;  5EIY A;  1ZI5 A;  4HO6 A;  1BFB A;  3FJI A;  1FV3 A;  1GX0 A;  2RJ6 A;  3V0B B;  1AFC A;  2YC3 A;  3PKQ A;  3VSZ A;  3BAH A;  5IDS A;  1QQK A;  21BI A;  2IWT B;  3H6Q A;  4Q9G A;  1O23 B;  1OQM B;  2QGI A;  1BFF A;  2DRE A;  2VXR A;  4I4S A;  2DRZ A;  4ION A;  1TOO A;  4P6A A;  2XMH A;  1FR9 A;  3JUK A;  4LO0 C;  1DQO A;  3I0K A;  4HO8 A;  4ARW A;  3A07 A;  3K8D A;  3CA0 A;  5CQP A;  4IHZ A;  1JQZ A;  3VUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...