2D7RA

Crystal structure of pp-galnac-t10 complexed with galnac-ser on lectin domain
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
536
structure length
536
Chain Sequence
GQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 10
publication title Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 155
structure length 536
sequence length 536
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2d7rA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2d7rA01
3F1CA 1INIA 2X5SA 1S0BA 1HWMB 4LO3C 1T4QA 1G9DA 1G1LA 4HOCA 1S0EA 3ZF8A 5C3DA 4DDZA 4PC4A 1IILA 1HCDA 3BRGC 3DJ4A 3EE5A 4L4HA 4X3AA 1S4OA 4FREA 1H7GA 3BAQA 4DECA 5EC5A 4D48A 3FWWA 1ZJOA 2HWMA 1PZYB 1HV9A 1O23B 5GAQA 3LW6A 2NP0A 4IRQA 1OMXA 31BIA 4ISQA 2GZBA 1QG8A 2YESA 3D98A 4G3PA 1EV2A 2A8WA 4A7ZA 1QWJA 2BO6A 1I1BA 4GOYA 3V8YA 3VT1A 4ASJA 5J49A 1JLXA 2BFHA 5BP5A 3SX8A 1MD6A 2ZU9A 1WSZA 3E8LC 2YCMA 4HO5A 1IJTA 3WINC 2QYIB 5EHAA 1GWVA 3OH1A 1FO8A 5CMHA 2JCLA 3CRIA 4J23B 5FZYA 2RSTA 1TW1A 1R7VA 3IOHA 3F62B 1QGSA 1H7QA 3LLPA 1YP2A 5CQNX 2MZBA 3I0KA 3S8KA 2DS0A 4UEGA 5E24E 3SXAA 1VICA 3R3IA 2R9KB 5DDVA 1IRAX 1JLYA 1JVGA 4Y62A 5FU8A 4ZGRB 2Y9WC 3USRA 5C36A 1DZDA 2UUSA 4B3UA 1WBAA 3CKOA 4XFUA 5C4DA 4Y7GA 5IDSA 1ZCVA 3F1YA 4ZDQA 2X2SA 1QGQA 1H5RB 4HG6A 1I52A 1BFGA 2VSIA 4FVVA 2XWNA 3BAVA 4D11C 1QXMA 2AFGA 4I4OA 1ILR1 4LW3A 4LO2A 3CRHA 1VH1A 1SR4A 5FNXA 3E26A 3WO2A 1N4KA 1TVYA 3CU1B 2I5EA 1PUUB 5F8WA 3CQAA 1ISYA 1BLDA 1MC9A 2NXVA 2RJ5A 3CA6A 1DQOA 3VEQA 2ZU8A 1WBCA 4JKQA 3I0IX 4LO7C 4X38A 4NAKA 5BXRA 2WEEA 3V90A 4OWKA 4FRMA 1IHKA 3UDAA 1YYNA 1BARA 3OJ2A 2HWAA 1VGWA 1DJSB 2VSEA 1ZI1A 5BXSA 5AJNA 3UD8A 3JRRA 3SXGA 1K5VA 4Y6UA 5C4CA 1E0OA 5D61A 1SS9A 2Y7AA 3Q7UA 2F2FA 1JYKA 4I1EA 4MYBA 3O49A 4QD2C 3OAMA 3T7MA 3LTQA 3I29B 2YQJA 3TC2A 3BA5A 1S4NA 2VXMA 3R2WA 2Y4MA 1V6VA 4HO4A 1PC8B 1IT0A 3NBCA 2KI6B 5D63A 1HIBA 3O44A 1LL2A 4FCUA 4FRHA 4R7PA 4QC4A 4USPA 3JTJA 3I2AA 3OC9A 5FYEA 4FRDA 3HBWA 3SXBA 3U0XA 1H4CA 4HO9A 4AN6A 3T7OA 3FJIA 4BMAA 1DQGA 2KH2A 4Q9PA 2ZQNA 3IIRA 4IONA 3CA5A 4IQPA 1EYRA 3C9ZA 4Y64A 5FUHA 1W3GA 1ZDFA 2Y9FA 1ZIZA 2GO2A 4CVHA 3OGFA 3Q80A 2OEFA 3UJ0A 4ZA3B 4I4RA 5B2HA 1H5TB 1W3FA 2WVLA 4LO1C 2K8RA 3SXDA 1QQLA 4OEFA 2O1GA 5BOWA 4B5BA 4EE3A 2I7BA 5F90A 3O4OA 2VXRA 3PHZA 4J2YA 4X37A 2FDBM 3POLA 3I0DA 3U2WA 3HALA 5F8YA 3SNVA 5C4EA 2RIZA 1GGPB 1ABRB 4EFPA 1FRWA 4EFQA 1TZFA 1NHEB 1H5SA 5C1HA 3FJDA 1TTUA 3CKVA 2AM4A 5FNWA 4I4VA 1HM8A 1O7QA 2JCOA 2Y9GA 4KEKA 4YOLA 5HS2A 1TW5A 1ZJ0A 4LO7B 4EE5A 5CQMX 5FU0A 4EEOA 3U2UA 2OI7A 2HW9A 4FROA 5C38A 2D7RA 1XZ6A 2GGQA 1UPSA 1MP3A 3AKHA 2NM1A 3WA1A 1OQLB 7I1BA 2VFZA 2WGZA 1V84A 1V6WA 1MP4A 3F1RA 1ZI3A 4HO3A 3V0LA 1GX4A 5DSSB 2PX7A 4KNXA 1HM0A 4HO8A 4FRQA 5BXTA 4QD2B 3V0NA 4L4IA 2Z86A 4FRAA 5CQOA 4QBCA 2QN4A 3V0MA 3Q7WA 2AM5A 2ZR1B 1EPWA 1O7OA 2AAIB 1GQCA 1FWVA 2GGOA 2NZ9A 2WRYA 1HWPB 4XKIA 3IAGC 2OEGA 4KC1A 1BFFA 1HJJA 2XWMA 5CMIA 2BEAA 2FO1A 2FYBA 3AH4A 4DCKC 4QBVA 2VXLA 3BA7A 4KPZA 3AZVA 1Z90A 2X65A 4I4YA 1FR9A 4FRPA 3V8ZA 4B4GA 1G9AA 4J18A 1ZHJA 1IIMA 1WT2A 4I96A 5C3BA 1ISVA 3BCVA 1G95A 4EVWA 1WD4A 1ZJ2A 3BB2A 3FJ8A 2FYCB 2X5ZA 2PGYA 1R81A 1INJA 4GP0A 3POKA 3OH3A 1HJLA 2VU9A 3OBTA 1G2VA 4ISRA 5I1FA 3PG0A 1AXMA 4FRBA 1S0DA 3HMYA 2FYAA 4MNDA 5AJPA 5C47A 3W9TA 3O4DA 4JQ0A 3AKIA 4II0A 4M2BA 1NWGB 2KLLA 1HCEA 4DE7A 4EKXB 2RJ6A 2ICXA 1FMMS 1JT7A 2FGFA 1W3AA 4P02A 3K8DA 1S0CA 2RG9B 2BO4A 1AVUA 1A8DA 1BLAA 1I1EA 2DREA 3JUJA 2ESUA 4B42A 1LL0A 1M16A 2PGVA 3AKFA 2AGDA 1VGTA 5I1BA 1JV3A 1JVDA 2MIBA 3CAHA 4G3QA 4Y63A 4LO8B 1IOBA 2V0LA 1MC3A 4BQHA 2E4MA 3RMWA 4D0ZA 3SPTA 4JKXB 21BIA 5AJOA 5D62A 3H6SE 2D22A 4JRAA 3V0OA 1RG8A 4HO2A 1GWWA 3PNNA 5IFYA 4I6IA 3GUEA 4I7IA 4P0KA 3OH2A 5FZUA 2WE9A 2DPWA 1G3LA 4QO3A 3R4SA 2VS4A 4I37A 1YP3A 1L2HA 2YQCA 3E25A 1II4A 4KPXA 2RIXA 5C49A 3A22A 1YXWA 4LO0C 4DENA 4ZLBB 3V0BA 1H5SC 3AJ5A 1WT0A 2IWTB 3Q7YA 2W0WA 4ZFYB 1R82A 1CE7B 2UX8A 3K1XA 4ECMA 1H4DA 1JV1A 2Q3NB 3A21A 1RY7A 1G93A 1ONKB 1G8OA 4Q91A 2QKXA 4G6MA 3CKQA 4I8MA 1YP4A 3A23A 1TIEA 4J2XA 1FXJA 1ZCUA 1QQKA 3QYDA 3OGGA 2Y4JA 3ZGFA 3OH4A 1FGXA 3BAHA 4G9MA 4I4UA 5EG6C 5IDTA 3V0PA 5DVHA 1KNMA 3N7KA 1PWAA 4H9WA 4TLPA 3VT2A 4IZEA 1J0SA 1H7FA 3I0JA 3OKRA 1GQ9A 2AM3A 1BFCA 3QR5A 2Y6PA 4IRPA 2FFUA 5G00A 1LVWA 2D43A 3NGWA 5HPZA 2DRZA 3P6JA 1JT4A 4P6AA 1WT1A 3H6RA 4LO3A 2W0VA 3V0AA 4M4KA 4Y9XA 1TOOA 5CMGX 4KEJA 1V83A 3P53A 2Y4LA 1Q1UA 2XOAA 1GX0A 4EE4A 3PUBA 4A7KA 3TQDA 4Y6NA 5JQQA 2WVMA 2AXMA 3HN1A 1ZJ3A 4ZKTB 4KC2A 3SX3A 3BAOA 3NBNA 3FJFA 3FUQA 2RITA 1XHBA 3HL3A 1HWOB 2XMHA 3VUOA 2WVKA 5BXPA 3D8VA 1EYLA 2Q9XA 3FJCA 1PUMB 3CA3A 1JTCA 4D8HA 1PZZA 2JCJA 4ZFUB 4G87A 3FJ9A 1FG5N 3B9UA 2AECA 3BA4A 1FXOA 2I5KA 4AN7B 4EEAA 3FJEA 2RJ7A 4NAIA 3PKPA 5CQLX 3BADA 2ZU7A 4C2SA 1WVCA 4LW6A 2P23A 3UD9A 1WT3A 3U0YA 2D1ZA 1VH3A 1H5SB 3WO3A 4D0TA 5BP5C 1NQIB 3UD7A 3VSZA 3NBDA 4EFRA 4IZXA 3I0CA 4XFTA 2FYDB 3HSMA 4KC3A 4AYLA 1FQ9A 4HO6A 5C8RA 1W57A 3JUKA 4CJBA 5JMCA 1FV3A 2RJ4A 4WBCA 4ASYA 3FGMA 4JISA 1DLLA 2DRYA 3T8SA 4CJMA 1S0FA 2ZQOA 2QH5A 41BIA 2E4MC 2KI4A 3A07A 4KXOA 1T9FA 3S8JA 1F31A 3BRDA 1R8NA 4X39A 1R7YA 2V0IA 1AFCA 2XWLA 5FV9A 4DEPA 1G23A 1H7HA 2VS5A 5C48A 1H7EA 3IOJA 3O3QA 3OGZA 3OH0A 3QVBA 1D0HA 2Z87A 4GP3A 1ZI5A 1NUNA 3CU0A 1ZI4A 3CA1A 3CA0A 3U2XA 2RQ9A 4QKRA 4Y7UA 4GAIA 3KIAA 5FTSA 2VXTI 4KRVA 1AVWB 1VCLA 5FZZA 4LO2C 1BA7A 2MLLB 4NANA 1SR4C 5CMJA 3WMUA 1Z2VA 3ZC8A 1YROB 5L6SA 3O3PA 5BXCA 1XG6A 4Z9WB 2V0JA 1JY0A 4FRLA 1ZCTA 3ZLLA 4IY8A 3O5WB 1Z4SA 3I0EA 1RZOB 4I4XA 2J3PA 1R8OA 4H04A 2YC5A 4P00A 2D44A 1FWYA 4I3NA 1XYFA 2BO7A 4HA2A 4ARWA 5C4FA 1LL3A 2L5XA 4B4MA 3ZLKA 4IHZA 3I0GA 3FFZA 1W77A 3R4UA 2RIYA 1SZ6B 2F2FC 5DUYA 3V0QA 2APCA 1O0RA 1FR8A 1CVSA 2E3DA 2P6WA 3I0FA 1JQZA 3MALA 1NKHB 3RTJB 3FJHA 5C1GA 2RJ8A 1FZWA 2IHOA 1EZIA 4GOVA 5FTVA 1TWEA 3Q7XA 1S0LA 1XZZA 4ZOTA 3TZTA 4OEGA 1DFQA 1FN0A 4I0YA 1K5UA 1M2TB 1IINA 3AH1A 2RJ9A 1RMLA 2VD4A 3O4CA 5CQPA 1YF8B 2RJ0A 3ZX7A 1K4VA 1BASA 4EB2B 9ILBA 5BQUA 1AF9A 4KEIA 2BO8A 3O4AA 4KNRA 1ITBA 3CRGA 3T7NA 2NVHA 2K43A 3FJKA 1KWSA 1AVXB 4F34A 5C1LA 4LO1A 4P0JA 4ZBVB 1ZJ1A 2FY7A 3V91A 3NBEA 1H7TA 2I1BA 1ISWA 4KBBA 1VZXA 1LZ7A 3V0BB 1S4PA 5EIYA 1ISXA 2HZ9A 2VUAA 1DIWA 4I1BA 3FJAA 4HCQA 4Y7TA 5EJ1A 4OUJA 2RJ1A 3CGXA 1VZUA 3I0HA 1FGAA 3WO4A 3OBRA 1LZ0A 3RSJA 3ZXDA 1FMZA 2VSAA 1V6UA 1VZTA 2KKIA 2V0KA 3U2VA 4F83A 1VGZA 2D7IA 2AH9A 2BEBA 3JUTA 2NYYA 2P39A 3P6IA 3SXCA 1HWNB 3H6QA 4B4BA 1ISZA 2Z48A 4OWLA 3ZC9A 1HKNA 3UJ4A 1G0RA 4G1RA 2WBCA 1W55A 5L6VA 2NTDA 2Y9XE 4Z8SB 3I2XA 3ST8A 1JYLA 4M2AA 4I4SA 2ET2A 1ZJPA 2D0JA 1H3MA 1G97A 3CKNA 4IYBA 1R7TA 3RMVA 3I0LA 4E1KA 3BRFA 3N7MA 4FGFA 3BAUA 4HR6C 3H6RB 3RSBA 2D20A 3NJ5A 2VLCA 3V0AB 2YQSA 1MP5A 1LZJA 1ON8A 3AH2A 4QALA 4XFSA 3Q4SA 4I2SA 2YC3A 2O1FA 3N7JA 3DUVA 3VT0A 1ON6A 3ZGGA 3RMYA 1H5RA 4M28A 3SXEA 4CJCA 3IM7A 3BRKX 4P0LA 1Q04A 4KQLA 3FJBA 3BX1C 2MC2A 1NZKA 3FOQA 3FUOA 1JT5A 1WD3A 3RMXA 4JPZA 2AESA 3MPPG 1LZIA 3PMEA 4ZFWB 8I1BA 3FJJA 4R6UB 5C3AA 1VPAA 5C4BA 1HM9A 2VS3A 3N9WA 4USOA 1OMZA 1H7LA 4OW4A 2CU2A 3IM5A 5BVPI 5EJZA 3AJ6A 4G6JA 2PA4A 1TFMB 4FQWA 3CA4A 2AE7A 2VSHA 4KC4A 4XWIA 1S0GA 3OJMA 3WMVA 1YBIA 1IRPA 4AAWA 1FGGA 2V0HA 4EEEB 2Y4KA 2ICYA 2D23A 2X60A 4CJ8A 3V79C 1Z0HA 2YUGA 4OEEA 1G9CA 3WINA 1AVAC 2P73A 2XMEA 4JP0A 3IOIA 4IY9A 1YTOA 2LIQA 2LIEA 3VSFA 1G9BA 1GA8A 2M49A 3HOMA 4I4PA 1OQMB 1V82A 3DK5A 3ILAA 4K6RA 4AC3A 1R7XA 1VGUA 2F8XC 1V6XA 4G9NA 2OI5A 1DFCA 5BQUC 1NMMB 2YQHA 3USQA 4FCEA 3BTAA 2OI6A 4B2XA 2O1HA 3RTIB 4ENDA 3N7LA 3O4BA 2P72A 3AKGA 4Q9GA 3ZXGA 2K4AB 1JT3A 1DZCA 4AYJA 4EEMA 2X2TA 3OJVA 1BFBA 3PKQA 3SX5A 2QGIA 2ERMA 1H5TA 1ZDGA 1NF5B 4HO0A 4JAWA 3AZWA 4J2KA 2E8BA 1FV2A 1TP0A 3CKJA 4KT7A 3U2TA 1FO9A 1Q03A 4NALA 1EVTA 1VM8A 1G82A 4QKSA 1ZCYA 4D11A 4LO0A 4A7YA 3D5NA 4HJJA 4GAFA 3K8EA 4B2WA 1R7UA 5DZUA 1P63A 4I4QA 4OWJA 2A8UA 4GBPA 1H4EA 4Y7VA 2JCKA 4Y7FA 3BAGA 4G3SA 1E5KA 4JD0A 1FWUA 2FFVA 5JLVA 1G9RA 4YS8A 5DDTA 2Z49A 4J2SA 5F8SA 5CMFX 2AQZA 2D24A 3IM6A 4EEGA 1FOAA 1H5SD 3KMVA 3EF2A 1PZTA 1TWMA 3VWCA 6I1BA 1R80A 3SX7A 3D7WB 2WAWA 3N0KA 4L41C 2Q4JA
chains in the Genus database with same CATH superfamily
3F1CA 2NS2A 1INIA 2X5SA 1S0BA 1HWMB 4LO3C 1T4QA 1G9DA 1G1LA 4HOCA 1S0EA 3ZF8A 5C3DA 4DDZA 4PC4A 1IILA 1HCDA 3BRGC 3DJ4A 3EE5A 4L4HA 4X3AA 1S4OA 4FREA 1H7GA 3BAQA 4H75A 4DECA 5EC5A 4D48A 3FWWA 1ZJOA 2HWMA 1PZYB 1HV9A 1O23B 5GAQA 3LW6A 2NP0A 4IRQA 1OMXA 31BIA 4ISQA 2GZBA 1QG8A 2YESA 3D98A 4G3PA 1EV2A 2A8WA 4A7ZA 1QWJA 2BO6A 1I1BA 4GOYA 3V8YA 3VT1A 4ASJA 5J49A 1JLXA 2BFHA 5BP5A 3SX8A 1MD6A 2ZU9A 1WSZA 3E8LC 2YCMA 4HO5A 1IJTA 3WINC 2QYIB 5EHAA 1GWVA 3OH1A 1FO8A 5CMHA 2JCLA 3CRIA 4J23B 5FZYA 2RSTA 1TW1A 1R7VA 3IOHA 3F62B 1QGSA 1H7QA 3LLPA 1YP2A 5CQNX 2MZBA 3I0KA 3S8KA 2DS0A 4UEGA 5E24E 3SXAA 1VICA 3R3IA 2R9KB 5DDVA 1IRAX 1JLYA 1JVGA 4Y62A 5FU8A 4ZGRB 2Y9WC 3USRA 5C36A 1DZDA 2UUSA 4B3UA 1WBAA 3CKOA 4XFUA 5C4DA 4Y7GA 5IDSA 1ZCVA 3F1YA 4ZDQA 2X2SA 1QGQA 1H5RB 4HG6A 1I52A 1BFGA 2VSIA 4FVVA 2XWNA 3BAVA 4D11C 1QXMA 2AFGA 4I4OA 1ILR1 4LW3A 4LO2A 3CRHA 1VH1A 1SR4A 5FNXA 3E26A 3WO2A 1N4KA 1TVYA 3CU1B 2I5EA 1PUUB 5F8WA 3CQAA 1ISYA 1BLDA 1MC9A 2NXVA 2RJ5A 3CA6A 1DQOA 3VEQA 2ZU8A 1WBCA 4JKQA 3I0IX 4LO7C 4X38A 4NAKA 5BXRA 2WEEA 3V90A 4OWKA 4FRMA 1IHKA 3UDAA 1YYNA 2VK9A 1BARA 3OJ2A 2HWAA 1VGWA 1DJSB 2VSEA 1ZI1A 5BXSA 5AJNA 3UD8A 3JRRA 3SXGA 1K5VA 4Y6UA 5C4CA 1E0OA 5D61A 1SS9A 2Y7AA 3Q7UA 2F2FA 1JYKA 4I1EA 4MYBA 3O49A 4QD2C 3OAMA 3T7MA 3LTQA 3I29B 2YQJA 3TC2A 3BA5A 1S4NA 2VXMA 3R2WA 2Y4MA 1V6VA 4HO4A 1PC8B 1IT0A 3NBCA 2KI6B 5D63A 1HIBA 3O44A 1LL2A 4FCUA 4FRHA 4R7PA 4QC4A 4USPA 3JTJA 3I2AA 3OC9A 5FYEA 4FRDA 3HBWA 3SXBA 3U0XA 1H4CA 4HO9A 4AN6A 3T7OA 3FJIA 4BMAA 1DQGA 4FIYA 2KH2A 4Q9PA 2ZQNA 3IIRA 4IONA 3CA5A 4IQPA 1EYRA 3C9ZA 4Y64A 5FUHA 1W3GA 1ZDFA 2Y9FA 1ZIZA 2GO2A 4CVHA 3OGFA 3Q80A 2OEFA 3UJ0A 4ZA3B 4I4RA 5B2HA 1H5TB 1W3FA 2WVLA 4LO1C 2K8RA 3SXDA 1QQLA 4OEFA 2O1GA 5BOWA 4B5BA 4EE3A 2I7BA 5F90A 3O4OA 2VXRA 3PHZA 4J2YA 4X37A 2FDBM 3POLA 3I0DA 3U2WA 3HALA 5F8YA 3SNVA 5C4EA 2RIZA 1GGPB 1ABRB 4EFPA 1FRWA 4EFQA 1TZFA 1NHEB 1H5SA 5C1HA 3FJDA 1TTUA 3CKVA 2AM4A 5FNWA 4I4VA 1HM8A 1O7QA 2JCOA 2Y9GA 4KEKA 4YOLA 5HS2A 1TW5A 1ZJ0A 4LO7B 4EE5A 5CQMX 5FU0A 4EEOA 3U2UA 2OI7A 2HW9A 4FROA 5C38A 2D7RA 1XZ6A 2GGQA 1UPSA 1MP3A 3AKHA 2NM1A 3WA1A 1OQLB 7I1BA 2VFZA 2WGZA 1V84A 1V6WA 1MP4A 3F1RA 1ZI3A 4HO3A 3V0LA 1GX4A 5DSSB 2PX7A 4KNXA 1HM0A 4HO8A 4FRQA 5BXTA 4QD2B 3V0NA 4L4IA 2Z86A 4FRAA 5CQOA 4QBCA 2QN4A 3V0MA 3Q7WA 2AM5A 2ZR1B 1EPWA 1O7OA 2AAIB 1GQCA 1FWVA 2GGOA 2NZ9A 2WRYA 1HWPB 4XKIA 3IAGC 2OEGA 4KC1A 1BFFA 1HJJA 2XWMA 4MZHA 5CMIA 2BEAA 2FO1A 2FYBA 3AH4A 4DCKC 4QBVA 2VXLA 3BA7A 4KPZA 3AZVA 1Z90A 2X65A 4I4YA 1FR9A 4FRPA 3V8ZA 4B4GA 1G9AA 4J18A 1ZHJA 1IIMA 1WT2A 4I96A 5C3BA 1ISVA 3BCVA 1G95A 4FIXA 4EVWA 1WD4A 1ZJ2A 3BB2A 3FJ8A 2FYCB 2X5ZA 2PGYA 1R81A 1INJA 4GP0A 3POKA 3OH3A 1HJLA 2VU9A 3OBTA 1G2VA 4ISRA 5I1FA 3PG0A 1AXMA 4FRBA 1S0DA 3HMYA 2FYAA 4MNDA 5AJPA 5C47A 3W9TA 3O4DA 4JQ0A 3AKIA 4II0A 4Q7CA 4M2BA 1NWGB 2KLLA 1HCEA 4DE7A 4EKXB 2RJ6A 2ICXA 1FMMS 1JT7A 2FGFA 1W3AA 4P02A 3K8DA 1S0CA 2RG9B 2BO4A 1AVUA 1A8DA 1BLAA 1I1EA 2DREA 3JUJA 2ESUA 4B42A 1LL0A 1M16A 2PGVA 3AKFA 2AGDA 1VGTA 5I1BA 1JV3A 1JVDA 2MIBA 3CAHA 4G3QA 4Y63A 4LO8B 1IOBA 2V0LA 1MC3A 4BQHA 2E4MA 3RMWA 4D0ZA 3SPTA 4JKXB 21BIA 2J0BA 5AJOA 5D62A 3H6SE 2D22A 4JRAA 3V0OA 1RG8A 4HO2A 1GWWA 3PNNA 5IFYA 4I6IA 3GUEA 4I7IA 4P0KA 3OH2A 5FZUA 2WE9A 2DPWA 1G3LA 4QO3A 3R4SA 2VS4A 4I37A 1YP3A 1L2HA 2YQCA 3E25A 1II4A 4KPXA 2RIXA 5C49A 3A22A 1YXWA 4LO0C 4DENA 4ZLBB 3V0BA 1H5SC 3AJ5A 1WT0A 2IWTB 3Q7YA 4O6MA 2W0WA 4ZFYB 1R82A 1CE7B 2UX8A 3K1XA 4ECMA 1H4DA 1JV1A 2Q3NB 3A21A 1RY7A 1G93A 2J0AA 1ONKB 1G8OA 4Q91A 2QKXA 4G6MA 3CKQA 4I8MA 1YP4A 3A23A 1TIEA 4J2XA 1FXJA 1ZCUA 1QQKA 3QYDA 3OGGA 2Y4JA 3ZGFA 3OH4A 1FGXA 3BAHA 4G9MA 4I4UA 5EG6C 5IDTA 3V0PA 5DVHA 1KNMA 3N7KA 1PWAA 4H9WA 4TLPA 3VT2A 4IZEA 1J0SA 1H7FA 3I0JA 3OKRA 1GQ9A 2AM3A 1BFCA 3QR5A 2Y6PA 4IRPA 2FFUA 5G00A 1LVWA 2D43A 3NGWA 5HPZA 2DRZA 3P6JA 1JT4A 4P6AA 1WT1A 3H6RA 4LO3A 2W0VA 3V0AA 4M4KA 4Y9XA 1TOOA 5CMGX 4KEJA 1V83A 3P53A 2Y4LA 1Q1UA 2XOAA 1GX0A 4EE4A 3PUBA 4A7KA 3TQDA 4Y6NA 5D92A 2WVMA 2AXMA 5JQQA 3HN1A 1ZJ3A 4ZKTB 4KC2A 3SX3A 3BAOA 3NBNA 3FJFA 3FUQA 2RITA 1XHBA 3HL3A 1HWOB 2XMHA 3VUOA 2WVKA 5BXPA 3D8VA 1EYLA 2Q9XA 3FJCA 1PUMB 3CA3A 1JTCA 4D8HA 1PZZA 2JCJA 4ZFUB 4G87A 3FJ9A 1FG5N 3B9UA 2AECA 3BA4A 1FXOA 2I5KA 4AN7B 4EEAA 3FJEA 2RJ7A 4NAIA 4MZFB 3PKPA 3BADA 2ZU7A 5CQLX 1WVCA 4LW6A 4C2SA 2P23A 3UD9A 1WT3A 3U0YA 2D1ZA 1VH3A 1H5SB 3WO3A 4D0TA 5BP5C 1NQIB 4O6NA 3UD7A 3VSZA 5D91A 3NBDA 4EFRA 4IZXA 3I0CA 4XFTA 2FYDB 3HSMA 4KC3A 4AYLA 1FQ9A 4HO6A 5C8RA 1W57A 4MZGB 3JUKA 4CJBA 5JMCA 1FV3A 2RJ4A 4WBCA 4ASYA 3FGMA 4JISA 1DLLA 2DRYA 3T8SA 4CJMA 1S0FA 2ZQOA 2QH5A 41BIA 2E4MC 2KI4A 3A07A 4KXOA 1T9FA 3S8JA 1F31A 3BRDA 1R8NA 4X39A 1R7YA 2V0IA 1AFCA 2XWLA 5FV9A 4DEPA 1G23A 1H7HA 2VS5A 5C48A 1H7EA 3IOJA 3O3QA 3OGZA 3OH0A 3QVBA 1D0HA 2Z87A 4GP3A 1ZI5A 1NUNA 3CU0A 1ZI4A 3CA1A 3CA0A 3U2XA 2RQ9A 4QKRA 4Y7UA 4GAIA 3KIAA 5FTSA 2VXTI 4KRVA 1AVWB 1VCLA 5FZZA 4LO2C 1BA7A 2MLLB 4NANA 1SR4C 5CMJA 3WMUA 1Z2VA 3ZC8A 1YROB 4MIXA 5L6SA 3O3PA 5BXCA 1XG6A 4Z9WB 2V0JA 1JY0A 4FRLA 1ZCTA 3ZLLA 4IY8A 3O5WB 1Z4SA 3I0EA 2C0NA 1RZOB 4I4XA 2J3PA 1R8OA 4H04A 2YC5A 4P00A 2D44A 1FWYA 4I3NA 1XYFA 2BO7A 4HA2A 4ARWA 5C4FA 1LL3A 2L5XA 4B4MA 3ZLKA 4IHZA 3I0GA 3FFZA 1W77A 3R4UA 2RIYA 1SZ6B 2F2FC 5DUYA 3V0QA 2APCA 1O0RA 1FR8A 1CVSA 2E3DA 2P6WA 3I0FA 1JQZA 3MALA 1NKHB 3RTJB 3FJHA 5C1GA 2RJ8A 1FZWA 2IHOA 1EZIA 4UY4A 4GOVA 5FTVA 1TWEA 3Q7XA 1S0LA 1XZZA 4ZOTA 3TZTA 4OEGA 1DFQA 1FN0A 4I0YA 1K5UA 1M2TB 1IINA 3AH1A 2RJ9A 1RMLA 2VD4A 3O4CA 5CQPA 1YF8B 2RJ0A 3ZX7A 1K4VA 1BASA 4EB2B 9ILBA 5BQUA 1AF9A 4KEIA 2BO8A 3O4AA 4KNRA 1ITBA 3CRGA 3T7NA 2NVHA 2K43A 3FJKA 1KWSA 1AVXB 4F34A 5C1LA 4LO1A 4P0JA 4ZBVB 1ZJ1A 2FY7A 3V91A 3NBEA 1H7TA 2I1BA 1ISWA 4KBBA 1VZXA 1LZ7A 3V0BB 1S4PA 5EIYA 1ISXA 2HZ9A 2VUAA 1DIWA 4I1BA 3FJAA 4HCQA 4Y7TA 5EJ1A 4OUJA 2RJ1A 3CGXA 1VZUA 3I0HA 1FGAA 3WO4A 3OBRA 1LZ0A 3RSJA 3ZXDA 1FMZA 2VSAA 1V6UA 1VZTA 2KKIA 2V0KA 3U2VA 4F83A 1VGZA 2D7IA 2AH9A 2BEBA 3JUTA 2NYYA 2P39A 3P6IA 3SXCA 1HWNB 3H6QA 4B4BA 1ISZA 2Z48A 4OWLA 3ZC9A 1HKNA 3UJ4A 1G0RA 4G1RA 2WBCA 1W55A 5L6VA 2NTDA 2Y9XE 4Z8SB 3I2XA 3ST8A 1JYLA 4M2AA 4I4SA 2ET2A 1ZJPA 2D0JA 1H3MA 1G97A 3CKNA 4IYBA 1R7TA 3RMVA 3I0LA 4E1KA 3BRFA 3N7MA 4FGFA 3BAUA 4HR6C 3H6RB 3RSBA 2D20A 3NJ5A 2VLCA 3V0AB 2YQSA 1MP5A 1LZJA 1ON8A 3AH2A 4QALA 4XFSA 3Q4SA 4I2SA 2YC3A 2O1FA 3N7JA 3DUVA 3VT0A 1ON6A 3ZGGA 3RMYA 1H5RA 4M28A 3SXEA 4CJCA 3IM7A 3BRKX 4P0LA 1Q04A 4KQLA 3FJBA 3BX1C 2MC2A 1NZKA 3FOQA 3FUOA 1JT5A 1WD3A 3RMXA 4JPZA 2AESA 3MPPG 1LZIA 3PMEA 4ZFWB 8I1BA 3FJJA 4R6UB 5C3AA 1VPAA 5C4BA 1HM9A 2VS3A 3N9WA 4USOA 1OMZA 1H7LA 4OW4A 2CU2A 3IM5A 5BVPI 5EJZA 3AJ6A 4G6JA 2PA4A 1TFMB 4FQWA 3CA4A 2AE7A 2VSHA 4KC4A 4XWIA 1S0GA 3OJMA 3WMVA 1YBIA 1IRPA 4AAWA 1FGGA 2V0HA 4EEEB 2Y4KA 2ICYA 2D23A 2X60A 4CJ8A 3V79C 1Z0HA 2YUGA 4OEEA 1G9CA 3WINA 1AVAC 2P73A 2XMEA 4JP0A 3IOIA 4IY9A 1YTOA 2LIQA 2LIEA 3VSFA 1G9BA 1GA8A 2M49A 3HOMA 4I4PA 1OQMB 1V82A 3DK5A 3ILAA 4K6RA 4AC3A 1R7XA 1VGUA 2F8XC 1V6XA 4G9NA 2OI5A 1DFCA 5BQUC 1NMMB 2YQHA 3USQA 4FCEA 3BTAA 2OI6A 4B2XA 2O1HA 3RTIB 4ENDA 3N7LA 3O4BA 2P72A 3AKGA 4Q9GA 3ZXGA 2K4AB 1JT3A 1DZCA 4AYJA 4EEMA 2X2TA 3OJVA 1BFBA 3PKQA 3SX5A 2QGIA 2ERMA 1H5TA 1ZDGA 1NF5B 4HO0A 4JAWA 3AZWA 4J2KA 2E8BA 1FV2A 1TP0A 3CKJA 4KT7A 3U2TA 1FO9A 1Q03A 4NALA 1EVTA 1VM8A 1G82A 4QKSA 1ZCYA 4D11A 4LO0A 4A7YA 3D5NA 4HJJA 4GAFA 3K8EA 4B2WA 1R7UA 5DZUA 1P63A 4I4QA 4OWJA 2A8UA 4GBPA 1H4EA 4Y7VA 2JCKA 4Y7FA 3BAGA 4G3SA 1E5KA 4JD0A 1FWUA 2FFVA 5JLVA 1G9RA 4YS8A 5DDTA 2Z49A 4J2SA 5F8SA 5CMFX 2AQZA 2D24A 3IM6A 4EEGA 1FOAA 1H5SD 3KMVA 3EF2A 1PZTA 1TWMA 3VWCA 6I1BA 1R80A 3SX7A 3D7WB 2WAWA 3N0KA 4L41C 2Q4JA
chains in the Genus database with same CATH topology
3F1CA 2NS2A 1INIA 2X5SA 1S0BA 1HWMB 4LO3C 1T4QA 1G9DA 1G1LA 4HOCA 1S0EA 3ZF8A 5C3DA 4DDZA 4PC4A 1IILA 1HCDA 3BRGC 3DJ4A 3EE5A 4L4HA 4X3AA 1S4OA 4FREA 1H7GA 3BAQA 4H75A 4DECA 5EC5A 4D48A 3FWWA 1ZJOA 2HWMA 1PZYB 1HV9A 1O23B 5GAQA 3LW6A 2NP0A 4IRQA 1OMXA 31BIA 4ISQA 2GZBA 1QG8A 2YESA 3D98A 4G3PA 1EV2A 2A8WA 4A7ZA 1QWJA 2BO6A 1I1BA 4GOYA 3V8YA 3VT1A 4ASJA 5J49A 1JLXA 2BFHA 5BP5A 3SX8A 1MD6A 2ZU9A 1WSZA 3E8LC 2YCMA 4HO5A 1IJTA 3WINC 2QYIB 5EHAA 1GWVA 3OH1A 1FO8A 5CMHA 2JCLA 3CRIA 4J23B 5FZYA 2RSTA 1TW1A 1R7VA 3IOHA 3F62B 1QGSA 1H7QA 3LLPA 1YP2A 5CQNX 2MZBA 3I0KA 3S8KA 2DS0A 4UEGA 5E24E 3SXAA 1VICA 3R3IA 2R9KB 5DDVA 1IRAX 1JLYA 1JVGA 4Y62A 5FU8A 4ZGRB 2Y9WC 3USRA 5C36A 1DZDA 2UUSA 4B3UA 1WBAA 3CKOA 4XFUA 5C4DA 4Y7GA 5IDSA 1ZCVA 3F1YA 4ZDQA 2X2SA 1QGQA 1H5RB 4HG6A 1I52A 1BFGA 2VSIA 4FVVA 2XWNA 3BAVA 4D11C 1QXMA 2AFGA 4I4OA 1ILR1 4LW3A 4LO2A 3CRHA 1VH1A 1SR4A 5FNXA 3E26A 3WO2A 1N4KA 1TVYA 3CU1B 2I5EA 1PUUB 5F8WA 3CQAA 1ISYA 1BLDA 1MC9A 2NXVA 2RJ5A 3CA6A 1DQOA 3VEQA 2ZU8A 1WBCA 4JKQA 3I0IX 4LO7C 4X38A 4NAKA 5BXRA 2WEEA 3V90A 4OWKA 4FRMA 1IHKA 3UDAA 1YYNA 2VK9A 1BARA 3OJ2A 2HWAA 1VGWA 1DJSB 2VSEA 1ZI1A 5BXSA 5AJNA 3UD8A 3JRRA 3SXGA 1K5VA 4Y6UA 5C4CA 1E0OA 5D61A 1SS9A 2Y7AA 3Q7UA 2F2FA 1JYKA 4I1EA 4MYBA 3O49A 4QD2C 3OAMA 3T7MA 3LTQA 3I29B 2YQJA 3TC2A 3BA5A 1S4NA 2VXMA 3R2WA 2Y4MA 1V6VA 4HO4A 1PC8B 1IT0A 3NBCA 2KI6B 5D63A 1HIBA 3O44A 1LL2A 4FCUA 4FRHA 4R7PA 4QC4A 4USPA 3JTJA 3I2AA 3OC9A 5FYEA 4FRDA 3HBWA 3SXBA 3U0XA 1H4CA 4HO9A 4AN6A 3T7OA 3FJIA 4BMAA 1DQGA 4FIYA 2KH2A 4Q9PA 2ZQNA 3IIRA 4IONA 3CA5A 4IQPA 1EYRA 3C9ZA 4Y64A 5FUHA 1W3GA 1ZDFA 2Y9FA 1ZIZA 2GO2A 4CVHA 3OGFA 3Q80A 2OEFA 3UJ0A 4ZA3B 4I4RA 5B2HA 1H5TB 1W3FA 2WVLA 4LO1C 2K8RA 3SXDA 1QQLA 4OEFA 2O1GA 5BOWA 4B5BA 4EE3A 2I7BA 5F90A 3O4OA 2VXRA 3PHZA 4J2YA 4X37A 2FDBM 3POLA 3I0DA 3U2WA 3HALA 5F8YA 3SNVA 5C4EA 2RIZA 1GGPB 1ABRB 4EFPA 1FRWA 4EFQA 1TZFA 1NHEB 1H5SA 5C1HA 3FJDA 1TTUA 3CKVA 2AM4A 5FNWA 4I4VA 1HM8A 1O7QA 2JCOA 2Y9GA 4KEKA 4YOLA 5HS2A 1TW5A 1ZJ0A 4LO7B 4EE5A 5CQMX 5FU0A 4EEOA 3U2UA 2OI7A 2HW9A 4FROA 5C38A 2D7RA 1XZ6A 2GGQA 1UPSA 1MP3A 3AKHA 2NM1A 3WA1A 1OQLB 7I1BA 2VFZA 2WGZA 1V84A 1V6WA 1MP4A 3F1RA 1ZI3A 4HO3A 3V0LA 1GX4A 5DSSB 2PX7A 4KNXA 1HM0A 4HO8A 4FRQA 5BXTA 4QD2B 3V0NA 4L4IA 2Z86A 4FRAA 5CQOA 4QBCA 2QN4A 3V0MA 3Q7WA 2AM5A 2ZR1B 1EPWA 1O7OA 2AAIB 1GQCA 1FWVA 2GGOA 2NZ9A 2WRYA 1HWPB 4XKIA 3IAGC 2OEGA 4KC1A 1BFFA 1HJJA 2XWMA 4MZHA 5CMIA 2BEAA 2FO1A 2FYBA 3AH4A 4DCKC 4QBVA 2VXLA 3BA7A 4KPZA 3AZVA 1Z90A 2X65A 4I4YA 1FR9A 4FRPA 3V8ZA 4B4GA 1G9AA 4J18A 1ZHJA 1IIMA 1WT2A 4I96A 5C3BA 1ISVA 3BCVA 1G95A 4FIXA 4EVWA 1WD4A 1ZJ2A 3BB2A 3FJ8A 2FYCB 2X5ZA 2PGYA 1R81A 1INJA 4GP0A 3POKA 3OH3A 1HJLA 2VU9A 3OBTA 1G2VA 4ISRA 5I1FA 3PG0A 1AXMA 4FRBA 1S0DA 3HMYA 2FYAA 4MNDA 5AJPA 5C47A 3W9TA 3O4DA 4JQ0A 3AKIA 4II0A 4Q7CA 4M2BA 1NWGB 2KLLA 1HCEA 4DE7A 4EKXB 2RJ6A 2ICXA 1FMMS 1JT7A 2FGFA 1W3AA 4P02A 3K8DA 1S0CA 2RG9B 2BO4A 1AVUA 1A8DA 1BLAA 1I1EA 2DREA 3JUJA 2ESUA 4B42A 1LL0A 1M16A 2PGVA 3AKFA 2AGDA 1VGTA 5I1BA 1JV3A 1JVDA 2MIBA 3CAHA 4G3QA 4Y63A 4LO8B 1IOBA 2V0LA 1MC3A 4BQHA 2E4MA 3RMWA 4D0ZA 3SPTA 4JKXB 21BIA 2J0BA 5AJOA 5D62A 3H6SE 2D22A 4JRAA 3V0OA 1RG8A 4HO2A 1GWWA 3PNNA 5IFYA 4I6IA 3GUEA 4I7IA 4P0KA 3OH2A 5FZUA 2WE9A 2DPWA 1G3LA 4QO3A 3R4SA 2VS4A 4I37A 1YP3A 1L2HA 2YQCA 3E25A 1II4A 4KPXA 2RIXA 5C49A 3A22A 1YXWA 4LO0C 4DENA 4ZLBB 3V0BA 1H5SC 3AJ5A 1WT0A 2IWTB 3Q7YA 4O6MA 2W0WA 4ZFYB 1R82A 1CE7B 2UX8A 3K1XA 4ECMA 1H4DA 1JV1A 2Q3NB 3A21A 1RY7A 1G93A 2J0AA 1ONKB 1G8OA 4Q91A 2QKXA 4G6MA 3CKQA 4I8MA 1YP4A 3A23A 1TIEA 4J2XA 1FXJA 1ZCUA 1QQKA 3QYDA 3OGGA 2Y4JA 3ZGFA 3OH4A 1FGXA 3BAHA 4G9MA 4I4UA 5EG6C 5IDTA 3V0PA 5DVHA 1KNMA 3N7KA 1PWAA 4H9WA 4TLPA 3VT2A 4IZEA 1J0SA 1H7FA 3I0JA 3OKRA 1GQ9A 2AM3A 1BFCA 3QR5A 2Y6PA 4IRPA 2FFUA 5G00A 1LVWA 2D43A 3NGWA 5HPZA 2DRZA 3P6JA 1JT4A 4P6AA 1WT1A 3H6RA 4LO3A 2W0VA 3V0AA 4M4KA 4Y9XA 1TOOA 5CMGX 4KEJA 1V83A 3P53A 2Y4LA 1Q1UA 2XOAA 1GX0A 4EE4A 3PUBA 4A7KA 3TQDA 4Y6NA 5D92A 2WVMA 2AXMA 5JQQA 3HN1A 1ZJ3A 4ZKTB 4KC2A 3SX3A 3BAOA 3NBNA 3FJFA 3FUQA 2RITA 1XHBA 3HL3A 1HWOB 2XMHA 3VUOA 2WVKA 5BXPA 3D8VA 1EYLA 2Q9XA 3FJCA 1PUMB 3CA3A 1JTCA 4D8HA 1PZZA 2JCJA 4ZFUB 4G87A 3FJ9A 1FG5N 3B9UA 2AECA 3BA4A 1FXOA 2I5KA 4AN7B 4EEAA 3FJEA 2RJ7A 4NAIA 4MZFB 3PKPA 3BADA 2ZU7A 5CQLX 1WVCA 4LW6A 4C2SA 2P23A 3UD9A 1WT3A 3U0YA 2D1ZA 1VH3A 1H5SB 3WO3A 4D0TA 5BP5C 1NQIB 4O6NA 3UD7A 3VSZA 5D91A 3NBDA 4EFRA 4IZXA 3I0CA 4XFTA 2FYDB 3HSMA 4KC3A 4AYLA 1FQ9A 4HO6A 5C8RA 1W57A 4MZGB 3JUKA 4CJBA 5JMCA 1FV3A 2RJ4A 4WBCA 4ASYA 3FGMA 4JISA 1DLLA 2DRYA 3T8SA 4CJMA 1S0FA 2ZQOA 2QH5A 41BIA 2E4MC 2KI4A 3A07A 4KXOA 1T9FA 3S8JA 1F31A 3BRDA 1R8NA 4X39A 1R7YA 2V0IA 1AFCA 2XWLA 5FV9A 4DEPA 1G23A 1H7HA 2VS5A 5C48A 1H7EA 3IOJA 3O3QA 3OGZA 3OH0A 3QVBA 1D0HA 2Z87A 4GP3A 1ZI5A 1NUNA 3CU0A 1ZI4A 3CA1A 3CA0A 3U2XA 2RQ9A 4QKRA 4Y7UA 4GAIA 3KIAA 5FTSA 2VXTI 4KRVA 1AVWB 1VCLA 5FZZA 4LO2C 1BA7A 2MLLB 4NANA 1SR4C 5CMJA 3WMUA 1Z2VA 3ZC8A 1YROB 4MIXA 5L6SA 3O3PA 5BXCA 1XG6A 4Z9WB 2V0JA 1JY0A 4FRLA 1ZCTA 3ZLLA 4IY8A 3O5WB 1Z4SA 3I0EA 2C0NA 1RZOB 4I4XA 2J3PA 1R8OA 4H04A 2YC5A 4P00A 2D44A 1FWYA 4I3NA 1XYFA 2BO7A 4HA2A 4ARWA 5C4FA 1LL3A 2L5XA 4B4MA 3ZLKA 4IHZA 3I0GA 3FFZA 1W77A 3R4UA 2RIYA 1SZ6B 2F2FC 5DUYA 3V0QA 2APCA 1O0RA 1FR8A 1CVSA 2E3DA 2P6WA 3I0FA 1JQZA 3MALA 1NKHB 3RTJB 3FJHA 5C1GA 2RJ8A 1FZWA 2IHOA 1EZIA 4UY4A 4GOVA 5FTVA 1TWEA 3Q7XA 1S0LA 1XZZA 4ZOTA 3TZTA 4OEGA 1DFQA 1FN0A 4I0YA 1K5UA 1M2TB 1IINA 3AH1A 2RJ9A 1RMLA 2VD4A 3O4CA 5CQPA 1YF8B 2RJ0A 3ZX7A 1K4VA 1BASA 4EB2B 9ILBA 5BQUA 1AF9A 4KEIA 2BO8A 3O4AA 4KNRA 1ITBA 3CRGA 3T7NA 2NVHA 2K43A 3FJKA 1KWSA 1AVXB 4F34A 5C1LA 4LO1A 4P0JA 4ZBVB 1ZJ1A 2FY7A 3V91A 3NBEA 1H7TA 2I1BA 1ISWA 4KBBA 1VZXA 1LZ7A 3V0BB 1S4PA 5EIYA 1ISXA 2HZ9A 2VUAA 1DIWA 4I1BA 3FJAA 4HCQA 4Y7TA 5EJ1A 4OUJA 2RJ1A 3CGXA 1VZUA 3I0HA 1FGAA 3WO4A 3OBRA 1LZ0A 3RSJA 3ZXDA 1FMZA 2VSAA 1V6UA 1VZTA 2KKIA 2V0KA 3U2VA 4F83A 1VGZA 2D7IA 2AH9A 2BEBA 3JUTA 2NYYA 2P39A 3P6IA 3SXCA 1HWNB 3H6QA 4B4BA 1ISZA 2Z48A 4OWLA 3ZC9A 1HKNA 3UJ4A 1G0RA 4G1RA 2WBCA 1W55A 5L6VA 2NTDA 2Y9XE 4Z8SB 3I2XA 3ST8A 1JYLA 4M2AA 4I4SA 2ET2A 1ZJPA 2D0JA 1H3MA 1G97A 3CKNA 4IYBA 1R7TA 3RMVA 3I0LA 4E1KA 3BRFA 3N7MA 4FGFA 3BAUA 4HR6C 3H6RB 3RSBA 2D20A 3NJ5A 2VLCA 3V0AB 2YQSA 1MP5A 1LZJA 1ON8A 3AH2A 4QALA 4XFSA 3Q4SA 4I2SA 2YC3A 2O1FA 3N7JA 3DUVA 3VT0A 1ON6A 3ZGGA 3RMYA 1H5RA 4M28A 3SXEA 4CJCA 3IM7A 3BRKX 4P0LA 1Q04A 4KQLA 3FJBA 3BX1C 2MC2A 1NZKA 3FOQA 3FUOA 1JT5A 1WD3A 3RMXA 4JPZA 2AESA 3MPPG 1LZIA 3PMEA 4ZFWB 8I1BA 3FJJA 4R6UB 5C3AA 1VPAA 5C4BA 1HM9A 2VS3A 3N9WA 4USOA 1OMZA 1H7LA 4OW4A 2CU2A 3IM5A 5BVPI 5EJZA 3AJ6A 4G6JA 2PA4A 1TFMB 4FQWA 3CA4A 2AE7A 2VSHA 4KC4A 4XWIA 1S0GA 3OJMA 3WMVA 1YBIA 1IRPA 4AAWA 1FGGA 2V0HA 4EEEB 2Y4KA 2ICYA 2D23A 2X60A 4CJ8A 3V79C 1Z0HA 2YUGA 4OEEA 1G9CA 3WINA 1AVAC 2P73A 2XMEA 4JP0A 3IOIA 4IY9A 1YTOA 2LIQA 2LIEA 3VSFA 1G9BA 1GA8A 2M49A 3HOMA 4I4PA 1OQMB 1V82A 3DK5A 3ILAA 4K6RA 4AC3A 1R7XA 1VGUA 2F8XC 1V6XA 4G9NA 2OI5A 1DFCA 5BQUC 1NMMB 2YQHA 3USQA 4FCEA 3BTAA 2OI6A 4B2XA 2O1HA 3RTIB 4ENDA 3N7LA 3O4BA 2P72A 3AKGA 4Q9GA 3ZXGA 2K4AB 1JT3A 1DZCA 4AYJA 4EEMA 2X2TA 3OJVA 1BFBA 3PKQA 3SX5A 2QGIA 2ERMA 1H5TA 1ZDGA 1NF5B 4HO0A 4JAWA 3AZWA 4J2KA 2E8BA 1FV2A 1TP0A 3CKJA 4KT7A 3U2TA 1FO9A 1Q03A 4NALA 1EVTA 1VM8A 1G82A 4QKSA 1ZCYA 4D11A 4LO0A 4A7YA 3D5NA 4HJJA 4GAFA 3K8EA 4B2WA 1R7UA 5DZUA 1P63A 4I4QA 4OWJA 2A8UA 4GBPA 1H4EA 4Y7VA 2JCKA 4Y7FA 3BAGA 4G3SA 1E5KA 4JD0A 1FWUA 2FFVA 5JLVA 1G9RA 4YS8A 5DDTA 2Z49A 4J2SA 5F8SA 5CMFX 2AQZA 2D24A 3IM6A 4EEGA 1FOAA 1H5SD 3KMVA 3EF2A 1PZTA 1TWMA 3VWCA 6I1BA 1R80A 3SX7A 3D7WB 2WAWA 3N0KA 4L41C 2Q4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F1C A;  1INI A;  2X5S A;  1S0B A;  1HWM B;  4LO3 C;  1T4Q A;  1G9D A;  1G1L A;  4HOC A;  1S0E A;  3ZF8 A;  5C3D A;  4DDZ A;  4PC4 A;  1IIL A;  1HCD A;  3BRG C;  3DJ4 A;  3EE5 A;  4L4H A;  4X3A A;  1S4O A;  4FRE A;  1H7G A;  3BAQ A;  4DEC A;  5EC5 A;  4D48 A;  3FWW A;  1ZJO A;  2HWM A;  1PZY B;  1HV9 A;  1O23 B;  5GAQ A;  3LW6 A;  2NP0 A;  4IRQ A;  1OMX A;  31BI A;  4ISQ A;  2GZB A;  1QG8 A;  2YES A;  3D98 A;  4G3P A;  1EV2 A;  2A8W A;  4A7Z A;  1QWJ A;  2BO6 A;  1I1B A;  4GOY A;  3V8Y A;  3VT1 A;  4ASJ A;  5J49 A;  1JLX A;  2BFH A;  5BP5 A;  3SX8 A;  1MD6 A;  2ZU9 A;  1WSZ A;  3E8L C;  2YCM A;  4HO5 A;  1IJT A;  3WIN C;  2QYI B;  5EHA A;  1GWV A;  3OH1 A;  1FO8 A;  5CMH A;  2JCL A;  3CRI A;  4J23 B;  5FZY A;  2RST A;  1TW1 A;  1R7V A;  3IOH A;  3F62 B;  1QGS A;  1H7Q A;  3LLP A;  1YP2 A;  5CQN X;  2MZB A;  3I0K A;  3S8K A;  2DS0 A;  4UEG A;  5E24 E;  3SXA A;  1VIC A;  3R3I A;  2R9K B;  5DDV A;  1IRA X;  1JLY A;  1JVG A;  4Y62 A;  5FU8 A;  4ZGR B;  2Y9W C;  3USR A;  5C36 A;  1DZD A;  2UUS A;  4B3U A;  1WBA A;  3CKO A;  4XFU A;  5C4D A;  4Y7G A;  5IDS A;  1ZCV A;  3F1Y A;  4ZDQ A;  2X2S A;  1QGQ A;  1H5R B;  4HG6 A;  1I52 A;  1BFG A;  2VSI A;  4FVV A;  2XWN A;  3BAV A;  4D11 C;  1QXM A;  2AFG A;  4I4O A;  1ILR 1;  4LW3 A;  4LO2 A;  3CRH A;  1VH1 A;  1SR4 A;  5FNX A;  3E26 A;  3WO2 A;  1N4K A;  1TVY A;  3CU1 B;  2I5E A;  1PUU B;  5F8W A;  3CQA A;  1ISY A;  1BLD A;  1MC9 A;  2NXV A;  2RJ5 A;  3CA6 A;  1DQO A;  3VEQ A;  2ZU8 A;  1WBC A;  4JKQ A;  3I0I X;  4LO7 C;  4X38 A;  4NAK A;  5BXR A;  2WEE A;  3V90 A;  4OWK A;  4FRM A;  1IHK A;  3UDA A;  1YYN A;  1BAR A;  3OJ2 A;  2HWA A;  1VGW A;  1DJS B;  2VSE A;  1ZI1 A;  5BXS A;  5AJN A;  3UD8 A;  3JRR A;  3SXG A;  1K5V A;  4Y6U A;  5C4C A;  1E0O A;  5D61 A;  1SS9 A;  2Y7A A;  3Q7U A;  2F2F A;  1JYK A;  4I1E A;  4MYB A;  3O49 A;  4QD2 C;  3OAM A;  3T7M A;  3LTQ A;  3I29 B;  2YQJ A;  3TC2 A;  3BA5 A;  1S4N A;  2VXM A;  3R2W A;  2Y4M A;  1V6V A;  4HO4 A;  1PC8 B;  1IT0 A;  3NBC A;  2KI6 B;  5D63 A;  1HIB A;  3O44 A;  1LL2 A;  4FCU A;  4FRH A;  4R7P A;  4QC4 A;  4USP A;  3JTJ A;  3I2A A;  3OC9 A;  5FYE A;  4FRD A;  3HBW A;  3SXB A;  3U0X A;  1H4C A;  4HO9 A;  4AN6 A;  3T7O A;  3FJI A;  4BMA A;  1DQG A;  2KH2 A;  4Q9P A;  2ZQN A;  3IIR A;  4ION A;  3CA5 A;  4IQP A;  1EYR A;  3C9Z A;  4Y64 A;  5FUH A;  1W3G A;  1ZDF A;  2Y9F A;  1ZIZ A;  2GO2 A;  4CVH A;  3OGF A;  3Q80 A;  2OEF A;  3UJ0 A;  4ZA3 B;  4I4R A;  5B2H A;  1H5T B;  1W3F A;  2WVL A;  4LO1 C;  2K8R A;  3SXD A;  1QQL A;  4OEF A;  2O1G A;  5BOW A;  4B5B A;  4EE3 A;  2I7B A;  5F90 A;  3O4O A;  2VXR A;  3PHZ A;  4J2Y A;  4X37 A;  2FDB M;  3POL A;  3I0D A;  3U2W A;  3HAL A;  5F8Y A;  3SNV A;  5C4E A;  2RIZ A;  1GGP B;  1ABR B;  4EFP A;  1FRW A;  4EFQ A;  1TZF A;  1NHE B;  1H5S A;  5C1H A;  3FJD A;  1TTU A;  3CKV A;  2AM4 A;  5FNW A;  4I4V A;  1HM8 A;  1O7Q A;  2JCO A;  2Y9G A;  4KEK A;  4YOL A;  5HS2 A;  1TW5 A;  1ZJ0 A;  4LO7 B;  4EE5 A;  5CQM X;  5FU0 A;  4EEO A;  3U2U A;  2OI7 A;  2HW9 A;  4FRO A;  5C38 A;  2D7R A;  1XZ6 A;  2GGQ A;  1UPS A;  1MP3 A;  3AKH A;  2NM1 A;  3WA1 A;  1OQL B;  7I1B A;  2VFZ A;  2WGZ A;  1V84 A;  1V6W A;  1MP4 A;  3F1R A;  1ZI3 A;  4HO3 A;  3V0L A;  1GX4 A;  5DSS B;  2PX7 A;  4KNX A;  1HM0 A;  4HO8 A;  4FRQ A;  5BXT A;  4QD2 B;  3V0N A;  4L4I A;  2Z86 A;  4FRA A;  5CQO A;  4QBC A;  2QN4 A;  3V0M A;  3Q7W A;  2AM5 A;  2ZR1 B;  1EPW A;  1O7O A;  2AAI B;  1GQC A;  1FWV A;  2GGO A;  2NZ9 A;  2WRY A;  1HWP B;  4XKI A;  3IAG C;  2OEG A;  4KC1 A;  1BFF A;  1HJJ A;  2XWM A;  5CMI A;  2BEA A;  2FO1 A;  2FYB A;  3AH4 A;  4DCK C;  4QBV A;  2VXL A;  3BA7 A;  4KPZ A;  3AZV A;  1Z90 A;  2X65 A;  4I4Y A;  1FR9 A;  4FRP A;  3V8Z A;  4B4G A;  1G9A A;  4J18 A;  1ZHJ A;  1IIM A;  1WT2 A;  4I96 A;  5C3B A;  1ISV A;  3BCV A;  1G95 A;  4EVW A;  1WD4 A;  1ZJ2 A;  3BB2 A;  3FJ8 A;  2FYC B;  2X5Z A;  2PGY A;  1R81 A;  1INJ A;  4GP0 A;  3POK A;  3OH3 A;  1HJL A;  2VU9 A;  3OBT A;  1G2V A;  4ISR A;  5I1F A;  3PG0 A;  1AXM A;  4FRB A;  1S0D A;  3HMY A;  2FYA A;  4MND A;  5AJP A;  5C47 A;  3W9T A;  3O4D A;  4JQ0 A;  3AKI A;  4II0 A;  4M2B A;  1NWG B;  2KLL A;  1HCE A;  4DE7 A;  4EKX B;  2RJ6 A;  2ICX A;  1FMM S;  1JT7 A;  2FGF A;  1W3A A;  4P02 A;  3K8D A;  1S0C A;  2RG9 B;  2BO4 A;  1AVU A;  1A8D A;  1BLA A;  1I1E A;  2DRE A;  3JUJ A;  2ESU A;  4B42 A;  1LL0 A;  1M16 A;  2PGV A;  3AKF A;  2AGD A;  1VGT A;  5I1B A;  1JV3 A;  1JVD A;  2MIB A;  3CAH A;  4G3Q A;  4Y63 A;  4LO8 B;  1IOB A;  2V0L A;  1MC3 A;  4BQH A;  2E4M A;  3RMW A;  4D0Z A;  3SPT A;  4JKX B;  21BI A;  5AJO A;  5D62 A;  3H6S E;  2D22 A;  4JRA A;  3V0O A;  1RG8 A;  4HO2 A;  1GWW A;  3PNN A;  5IFY A;  4I6I A;  3GUE A;  4I7I A;  4P0K A;  3OH2 A;  5FZU A;  2WE9 A;  2DPW A;  1G3L A;  4QO3 A;  3R4S A;  2VS4 A;  4I37 A;  1YP3 A;  1L2H A;  2YQC A;  3E25 A;  1II4 A;  4KPX A;  2RIX A;  5C49 A;  3A22 A;  1YXW A;  4LO0 C;  4DEN A;  4ZLB B;  3V0B A;  1H5S C;  3AJ5 A;  1WT0 A;  2IWT B;  3Q7Y A;  2W0W A;  4ZFY B;  1R82 A;  1CE7 B;  2UX8 A;  3K1X A;  4ECM A;  1H4D A;  1JV1 A;  2Q3N B;  3A21 A;  1RY7 A;  1G93 A;  1ONK B;  1G8O A;  4Q91 A;  2QKX A;  4G6M A;  3CKQ A;  4I8M A;  1YP4 A;  3A23 A;  1TIE A;  4J2X A;  1FXJ A;  1ZCU A;  1QQK A;  3QYD A;  3OGG A;  2Y4J A;  3ZGF A;  3OH4 A;  1FGX A;  3BAH A;  4G9M A;  4I4U A;  5EG6 C;  5IDT A;  3V0P A;  5DVH A;  1KNM A;  3N7K A;  1PWA A;  4H9W A;  4TLP A;  3VT2 A;  4IZE A;  1J0S A;  1H7F A;  3I0J A;  3OKR A;  1GQ9 A;  2AM3 A;  1BFC A;  3QR5 A;  2Y6P A;  4IRP A;  2FFU A;  5G00 A;  1LVW A;  2D43 A;  3NGW A;  5HPZ A;  2DRZ A;  3P6J A;  1JT4 A;  4P6A A;  1WT1 A;  3H6R A;  4LO3 A;  2W0V A;  3V0A A;  4M4K A;  4Y9X A;  1TOO A;  5CMG X;  4KEJ A;  1V83 A;  3P53 A;  2Y4L A;  1Q1U A;  2XOA A;  1GX0 A;  4EE4 A;  3PUB A;  4A7K A;  3TQD A;  4Y6N A;  5JQQ A;  2WVM A;  2AXM A;  3HN1 A;  1ZJ3 A;  4ZKT B;  4KC2 A;  3SX3 A;  3BAO A;  3NBN A;  3FJF A;  3FUQ A;  2RIT A;  1XHB A;  3HL3 A;  1HWO B;  2XMH A;  3VUO A;  2WVK A;  5BXP A;  3D8V A;  1EYL A;  2Q9X A;  3FJC A;  1PUM B;  3CA3 A;  1JTC A;  4D8H A;  1PZZ A;  2JCJ A;  4ZFU B;  4G87 A;  3FJ9 A;  1FG5 N;  3B9U A;  2AEC A;  3BA4 A;  1FXO A;  2I5K A;  4AN7 B;  4EEA A;  3FJE A;  2RJ7 A;  4NAI A;  3PKP A;  5CQL X;  3BAD A;  2ZU7 A;  4C2S A;  1WVC A;  4LW6 A;  2P23 A;  3UD9 A;  1WT3 A;  3U0Y A;  2D1Z A;  1VH3 A;  1H5S B;  3WO3 A;  4D0T A;  5BP5 C;  1NQI B;  3UD7 A;  3VSZ A;  3NBD A;  4EFR A;  4IZX A;  3I0C A;  4XFT A;  2FYD B;  3HSM A;  4KC3 A;  4AYL A;  1FQ9 A;  4HO6 A;  5C8R A;  1W57 A;  3JUK A;  4CJB A;  5JMC A;  1FV3 A;  2RJ4 A;  4WBC A;  4ASY A;  3FGM A;  4JIS A;  1DLL A;  2DRY A;  3T8S A;  4CJM A;  1S0F A;  2ZQO A;  2QH5 A;  41BI A;  2E4M C;  2KI4 A;  3A07 A;  4KXO A;  1T9F A;  3S8J A;  1F31 A;  3BRD A;  1R8N A;  4X39 A;  1R7Y A;  2V0I A;  1AFC A;  2XWL A;  5FV9 A;  4DEP A;  1G23 A;  1H7H A;  2VS5 A;  5C48 A;  1H7E A;  3IOJ A;  3O3Q A;  3OGZ A;  3OH0 A;  3QVB A;  1D0H A;  2Z87 A;  4GP3 A;  1ZI5 A;  1NUN A;  3CU0 A;  1ZI4 A;  3CA1 A;  3CA0 A;  3U2X A;  2RQ9 A;  4QKR A;  4Y7U A;  4GAI A;  3KIA A;  5FTS A;  2VXT I;  4KRV A;  1AVW B;  1VCL A;  5FZZ A;  4LO2 C;  1BA7 A;  2MLL B;  4NAN A;  1SR4 C;  5CMJ A;  3WMU A;  1Z2V A;  3ZC8 A;  1YRO B;  5L6S A;  3O3P A;  5BXC A;  1XG6 A;  4Z9W B;  2V0J A;  1JY0 A;  4FRL A;  1ZCT A;  3ZLL A;  4IY8 A;  3O5W B;  1Z4S A;  3I0E A;  1RZO B;  4I4X A;  2J3P A;  1R8O A;  4H04 A;  2YC5 A;  4P00 A;  2D44 A;  1FWY A;  4I3N A;  1XYF A;  2BO7 A;  4HA2 A;  4ARW A;  5C4F A;  1LL3 A;  2L5X A;  4B4M A;  3ZLK A;  4IHZ A;  3I0G A;  3FFZ A;  1W77 A;  3R4U A;  2RIY A;  1SZ6 B;  2F2F C;  5DUY A;  3V0Q A;  2APC A;  1O0R A;  1FR8 A;  1CVS A;  2E3D A;  2P6W A;  3I0F A;  1JQZ A;  3MAL A;  1NKH B;  3RTJ B;  3FJH A;  5C1G A;  2RJ8 A;  1FZW A;  2IHO A;  1EZI A;  4GOV A;  5FTV A;  1TWE A;  3Q7X A;  1S0L A;  1XZZ A;  4ZOT A;  3TZT A;  4OEG A;  1DFQ A;  1FN0 A;  4I0Y A;  1K5U A;  1M2T B;  1IIN A;  3AH1 A;  2RJ9 A;  1RML A;  2VD4 A;  3O4C A;  5CQP A;  1YF8 B;  2RJ0 A;  3ZX7 A;  1K4V A;  1BAS A;  4EB2 B;  9ILB A;  5BQU A;  1AF9 A;  4KEI A;  2BO8 A;  3O4A A;  4KNR A;  1ITB A;  3CRG A;  3T7N A;  2NVH A;  2K43 A;  3FJK A;  1KWS A;  1AVX B;  4F34 A;  5C1L A;  4LO1 A;  4P0J A;  4ZBV B;  1ZJ1 A;  2FY7 A;  3V91 A;  3NBE A;  1H7T A;  2I1B A;  1ISW A;  4KBB A;  1VZX A;  1LZ7 A;  3V0B B;  1S4P A;  5EIY A;  1ISX A;  2HZ9 A;  2VUA A;  1DIW A;  4I1B A;  3FJA A;  4HCQ A;  4Y7T A;  5EJ1 A;  4OUJ A;  2RJ1 A;  3CGX A;  1VZU A;  3I0H A;  1FGA A;  3WO4 A;  3OBR A;  1LZ0 A;  3RSJ A;  3ZXD A;  1FMZ A;  2VSA A;  1V6U A;  1VZT A;  2KKI A;  2V0K A;  3U2V A;  4F83 A;  1VGZ A;  2D7I A;  2AH9 A;  2BEB A;  3JUT A;  2NYY A;  2P39 A;  3P6I A;  3SXC A;  1HWN B;  3H6Q A;  4B4B A;  1ISZ A;  2Z48 A;  4OWL A;  3ZC9 A;  1HKN A;  3UJ4 A;  1G0R A;  4G1R A;  2WBC A;  1W55 A;  5L6V A;  2NTD A;  2Y9X E;  4Z8S B;  3I2X A;  3ST8 A;  1JYL A;  4M2A A;  4I4S A;  2ET2 A;  1ZJP A;  2D0J A;  1H3M A;  1G97 A;  3CKN A;  4IYB A;  1R7T A;  3RMV A;  3I0L A;  4E1K A;  3BRF A;  3N7M A;  4FGF A;  3BAU A;  4HR6 C;  3H6R B;  3RSB A;  2D20 A;  3NJ5 A;  2VLC A;  3V0A B;  2YQS A;  1MP5 A;  1LZJ A;  1ON8 A;  3AH2 A;  4QAL A;  4XFS A;  3Q4S A;  4I2S A;  2YC3 A;  2O1F A;  3N7J A;  3DUV A;  3VT0 A;  1ON6 A;  3ZGG A;  3RMY A;  1H5R A;  4M28 A;  3SXE A;  4CJC A;  3IM7 A;  3BRK X;  4P0L A;  1Q04 A;  4KQL A;  3FJB A;  3BX1 C;  2MC2 A;  1NZK A;  3FOQ A;  3FUO A;  1JT5 A;  1WD3 A;  3RMX A;  4JPZ A;  2AES A;  3MPP G;  1LZI A;  3PME A;  4ZFW B;  8I1B A;  3FJJ A;  4R6U B;  5C3A A;  1VPA A;  5C4B A;  1HM9 A;  2VS3 A;  3N9W A;  4USO A;  1OMZ A;  1H7L A;  4OW4 A;  2CU2 A;  3IM5 A;  5BVP I;  5EJZ A;  3AJ6 A;  4G6J A;  2PA4 A;  1TFM B;  4FQW A;  3CA4 A;  2AE7 A;  2VSH A;  4KC4 A;  4XWI A;  1S0G A;  3OJM A;  3WMV A;  1YBI A;  1IRP A;  4AAW A;  1FGG A;  2V0H A;  4EEE B;  2Y4K A;  2ICY A;  2D23 A;  2X60 A;  4CJ8 A;  3V79 C;  1Z0H A;  2YUG A;  4OEE A;  1G9C A;  3WIN A;  1AVA C;  2P73 A;  2XME A;  4JP0 A;  3IOI A;  4IY9 A;  1YTO A;  2LIQ A;  2LIE A;  3VSF A;  1G9B A;  1GA8 A;  2M49 A;  3HOM A;  4I4P A;  1OQM B;  1V82 A;  3DK5 A;  3ILA A;  4K6R A;  4AC3 A;  1R7X A;  1VGU A;  2F8X C;  1V6X A;  4G9N A;  2OI5 A;  1DFC A;  5BQU C;  1NMM B;  2YQH A;  3USQ A;  4FCE A;  3BTA A;  2OI6 A;  4B2X A;  2O1H A;  3RTI B;  4END A;  3N7L A;  3O4B A;  2P72 A;  3AKG A;  4Q9G A;  3ZXG A;  2K4A B;  1JT3 A;  1DZC A;  4AYJ A;  4EEM A;  2X2T A;  3OJV A;  1BFB A;  3PKQ A;  3SX5 A;  2QGI A;  2ERM A;  1H5T A;  1ZDG A;  1NF5 B;  4HO0 A;  4JAW A;  3AZW A;  4J2K A;  2E8B A;  1FV2 A;  1TP0 A;  3CKJ A;  4KT7 A;  3U2T A;  1FO9 A;  1Q03 A;  4NAL A;  1EVT A;  1VM8 A;  1G82 A;  4QKS A;  1ZCY A;  4D11 A;  4LO0 A;  4A7Y A;  3D5N A;  4HJJ A;  4GAF A;  3K8E A;  4B2W A;  1R7U A;  5DZU A;  1P63 A;  4I4Q A;  4OWJ A;  2A8U A;  4GBP A;  1H4E A;  4Y7V A;  2JCK A;  4Y7F A;  3BAG A;  4G3S A;  1E5K A;  4JD0 A;  1FWU A;  2FFV A;  5JLV A;  1G9R A;  4YS8 A;  5DDT A;  2Z49 A;  4J2S A;  5F8S A;  5CMF X;  2AQZ A;  2D24 A;  3IM6 A;  4EEG A;  1FOA A;  1H5S D;  3KMV A;  3EF2 A;  1PZT A;  1TWM A;  3VWC A;  6I1B A;  1R80 A;  3SX7 A;  3D7W B;  2WAW A;  3N0K A;  4L41 C;  2Q4J A; 
#chains in the Genus database with same CATH topology
 3F1C A;  2NS2 A;  1INI A;  2X5S A;  1S0B A;  1HWM B;  4LO3 C;  1T4Q A;  1G9D A;  1G1L A;  4HOC A;  1S0E A;  3ZF8 A;  5C3D A;  4DDZ A;  4PC4 A;  1IIL A;  1HCD A;  3BRG C;  3DJ4 A;  3EE5 A;  4L4H A;  4X3A A;  1S4O A;  4FRE A;  1H7G A;  3BAQ A;  4H75 A;  4DEC A;  5EC5 A;  4D48 A;  3FWW A;  1ZJO A;  2HWM A;  1PZY B;  1HV9 A;  1O23 B;  5GAQ A;  3LW6 A;  2NP0 A;  4IRQ A;  1OMX A;  31BI A;  4ISQ A;  2GZB A;  1QG8 A;  2YES A;  3D98 A;  4G3P A;  1EV2 A;  2A8W A;  4A7Z A;  1QWJ A;  2BO6 A;  1I1B A;  4GOY A;  3V8Y A;  3VT1 A;  4ASJ A;  5J49 A;  1JLX A;  2BFH A;  5BP5 A;  3SX8 A;  1MD6 A;  2ZU9 A;  1WSZ A;  3E8L C;  2YCM A;  4HO5 A;  1IJT A;  3WIN C;  2QYI B;  5EHA A;  1GWV A;  3OH1 A;  1FO8 A;  5CMH A;  2JCL A;  3CRI A;  4J23 B;  5FZY A;  2RST A;  1TW1 A;  1R7V A;  3IOH A;  3F62 B;  1QGS A;  1H7Q A;  3LLP A;  1YP2 A;  5CQN X;  2MZB A;  3I0K A;  3S8K A;  2DS0 A;  4UEG A;  5E24 E;  3SXA A;  1VIC A;  3R3I A;  2R9K B;  5DDV A;  1IRA X;  1JLY A;  1JVG A;  4Y62 A;  5FU8 A;  4ZGR B;  2Y9W C;  3USR A;  5C36 A;  1DZD A;  2UUS A;  4B3U A;  1WBA A;  3CKO A;  4XFU A;  5C4D A;  4Y7G A;  5IDS A;  1ZCV A;  3F1Y A;  4ZDQ A;  2X2S A;  1QGQ A;  1H5R B;  4HG6 A;  1I52 A;  1BFG A;  2VSI A;  4FVV A;  2XWN A;  3BAV A;  4D11 C;  1QXM A;  2AFG A;  4I4O A;  1ILR 1;  4LW3 A;  4LO2 A;  3CRH A;  1VH1 A;  1SR4 A;  5FNX A;  3E26 A;  3WO2 A;  1N4K A;  1TVY A;  3CU1 B;  2I5E A;  1PUU B;  5F8W A;  3CQA A;  1ISY A;  1BLD A;  1MC9 A;  2NXV A;  2RJ5 A;  3CA6 A;  1DQO A;  3VEQ A;  2ZU8 A;  1WBC A;  4JKQ A;  3I0I X;  4LO7 C;  4X38 A;  4NAK A;  5BXR A;  2WEE A;  3V90 A;  4OWK A;  4FRM A;  1IHK A;  3UDA A;  1YYN A;  2VK9 A;  1BAR A;  3OJ2 A;  2HWA A;  1VGW A;  1DJS B;  2VSE A;  1ZI1 A;  5BXS A;  5AJN A;  3UD8 A;  3JRR A;  3SXG A;  1K5V A;  4Y6U A;  5C4C A;  1E0O A;  5D61 A;  1SS9 A;  2Y7A A;  3Q7U A;  2F2F A;  1JYK A;  4I1E A;  4MYB A;  3O49 A;  4QD2 C;  3OAM A;  3T7M A;  3LTQ A;  3I29 B;  2YQJ A;  3TC2 A;  3BA5 A;  1S4N A;  2VXM A;  3R2W A;  2Y4M A;  1V6V A;  4HO4 A;  1PC8 B;  1IT0 A;  3NBC A;  2KI6 B;  5D63 A;  1HIB A;  3O44 A;  1LL2 A;  4FCU A;  4FRH A;  4R7P A;  4QC4 A;  4USP A;  3JTJ A;  3I2A A;  3OC9 A;  5FYE A;  4FRD A;  3HBW A;  3SXB A;  3U0X A;  1H4C A;  4HO9 A;  4AN6 A;  3T7O A;  3FJI A;  4BMA A;  1DQG A;  4FIY A;  2KH2 A;  4Q9P A;  2ZQN A;  3IIR A;  4ION A;  3CA5 A;  4IQP A;  1EYR A;  3C9Z A;  4Y64 A;  5FUH A;  1W3G A;  1ZDF A;  2Y9F A;  1ZIZ A;  2GO2 A;  4CVH A;  3OGF A;  3Q80 A;  2OEF A;  3UJ0 A;  4ZA3 B;  4I4R A;  5B2H A;  1H5T B;  1W3F A;  2WVL A;  4LO1 C;  2K8R A;  3SXD A;  1QQL A;  4OEF A;  2O1G A;  5BOW A;  4B5B A;  4EE3 A;  2I7B A;  5F90 A;  3O4O A;  2VXR A;  3PHZ A;  4J2Y A;  4X37 A;  2FDB M;  3POL A;  3I0D A;  3U2W A;  3HAL A;  5F8Y A;  3SNV A;  5C4E A;  2RIZ A;  1GGP B;  1ABR B;  4EFP A;  1FRW A;  4EFQ A;  1TZF A;  1NHE B;  1H5S A;  5C1H A;  3FJD A;  1TTU A;  3CKV A;  2AM4 A;  5FNW A;  4I4V A;  1HM8 A;  1O7Q A;  2JCO A;  2Y9G A;  4KEK A;  4YOL A;  5HS2 A;  1TW5 A;  1ZJ0 A;  4LO7 B;  4EE5 A;  5CQM X;  5FU0 A;  4EEO A;  3U2U A;  2OI7 A;  2HW9 A;  4FRO A;  5C38 A;  2D7R A;  1XZ6 A;  2GGQ A;  1UPS A;  1MP3 A;  3AKH A;  2NM1 A;  3WA1 A;  1OQL B;  7I1B A;  2VFZ A;  2WGZ A;  1V84 A;  1V6W A;  1MP4 A;  3F1R A;  1ZI3 A;  4HO3 A;  3V0L A;  1GX4 A;  5DSS B;  2PX7 A;  4KNX A;  1HM0 A;  4HO8 A;  4FRQ A;  5BXT A;  4QD2 B;  3V0N A;  4L4I A;  2Z86 A;  4FRA A;  5CQO A;  4QBC A;  2QN4 A;  3V0M A;  3Q7W A;  2AM5 A;  2ZR1 B;  1EPW A;  1O7O A;  2AAI B;  1GQC A;  1FWV A;  2GGO A;  2NZ9 A;  2WRY A;  1HWP B;  4XKI A;  3IAG C;  2OEG A;  4KC1 A;  1BFF A;  1HJJ A;  2XWM A;  4MZH A;  5CMI A;  2BEA A;  2FO1 A;  2FYB A;  3AH4 A;  4DCK C;  4QBV A;  2VXL A;  3BA7 A;  4KPZ A;  3AZV A;  1Z90 A;  2X65 A;  4I4Y A;  1FR9 A;  4FRP A;  3V8Z A;  4B4G A;  1G9A A;  4J18 A;  1ZHJ A;  1IIM A;  1WT2 A;  4I96 A;  5C3B A;  1ISV A;  3BCV A;  1G95 A;  4FIX A;  4EVW A;  1WD4 A;  1ZJ2 A;  3BB2 A;  3FJ8 A;  2FYC B;  2X5Z A;  2PGY A;  1R81 A;  1INJ A;  4GP0 A;  3POK A;  3OH3 A;  1HJL A;  2VU9 A;  3OBT A;  1G2V A;  4ISR A;  5I1F A;  3PG0 A;  1AXM A;  4FRB A;  1S0D A;  3HMY A;  2FYA A;  4MND A;  5AJP A;  5C47 A;  3W9T A;  3O4D A;  4JQ0 A;  3AKI A;  4II0 A;  4Q7C A;  4M2B A;  1NWG B;  2KLL A;  1HCE A;  4DE7 A;  4EKX B;  2RJ6 A;  2ICX A;  1FMM S;  1JT7 A;  2FGF A;  1W3A A;  4P02 A;  3K8D A;  1S0C A;  2RG9 B;  2BO4 A;  1AVU A;  1A8D A;  1BLA A;  1I1E A;  2DRE A;  3JUJ A;  2ESU A;  4B42 A;  1LL0 A;  1M16 A;  2PGV A;  3AKF A;  2AGD A;  1VGT A;  5I1B A;  1JV3 A;  1JVD A;  2MIB A;  3CAH A;  4G3Q A;  4Y63 A;  4LO8 B;  1IOB A;  2V0L A;  1MC3 A;  4BQH A;  2E4M A;  3RMW A;  4D0Z A;  3SPT A;  4JKX B;  21BI A;  2J0B A;  5AJO A;  5D62 A;  3H6S E;  2D22 A;  4JRA A;  3V0O A;  1RG8 A;  4HO2 A;  1GWW A;  3PNN A;  5IFY A;  4I6I A;  3GUE A;  4I7I A;  4P0K A;  3OH2 A;  5FZU A;  2WE9 A;  2DPW A;  1G3L A;  4QO3 A;  3R4S A;  2VS4 A;  4I37 A;  1YP3 A;  1L2H A;  2YQC A;  3E25 A;  1II4 A;  4KPX A;  2RIX A;  5C49 A;  3A22 A;  1YXW A;  4LO0 C;  4DEN A;  4ZLB B;  3V0B A;  1H5S C;  3AJ5 A;  1WT0 A;  2IWT B;  3Q7Y A;  4O6M A;  2W0W A;  4ZFY B;  1R82 A;  1CE7 B;  2UX8 A;  3K1X A;  4ECM A;  1H4D A;  1JV1 A;  2Q3N B;  3A21 A;  1RY7 A;  1G93 A;  2J0A A;  1ONK B;  1G8O A;  4Q91 A;  2QKX A;  4G6M A;  3CKQ A;  4I8M A;  1YP4 A;  3A23 A;  1TIE A;  4J2X A;  1FXJ A;  1ZCU A;  1QQK A;  3QYD A;  3OGG A;  2Y4J A;  3ZGF A;  3OH4 A;  1FGX A;  3BAH A;  4G9M A;  4I4U A;  5EG6 C;  5IDT A;  3V0P A;  5DVH A;  1KNM A;  3N7K A;  1PWA A;  4H9W A;  4TLP A;  3VT2 A;  4IZE A;  1J0S A;  1H7F A;  3I0J A;  3OKR A;  1GQ9 A;  2AM3 A;  1BFC A;  3QR5 A;  2Y6P A;  4IRP A;  2FFU A;  5G00 A;  1LVW A;  2D43 A;  3NGW A;  5HPZ A;  2DRZ A;  3P6J A;  1JT4 A;  4P6A A;  1WT1 A;  3H6R A;  4LO3 A;  2W0V A;  3V0A A;  4M4K A;  4Y9X A;  1TOO A;  5CMG X;  4KEJ A;  1V83 A;  3P53 A;  2Y4L A;  1Q1U A;  2XOA A;  1GX0 A;  4EE4 A;  3PUB A;  4A7K A;  3TQD A;  4Y6N A;  5D92 A;  2WVM A;  2AXM A;  5JQQ A;  3HN1 A;  1ZJ3 A;  4ZKT B;  4KC2 A;  3SX3 A;  3BAO A;  3NBN A;  3FJF A;  3FUQ A;  2RIT A;  1XHB A;  3HL3 A;  1HWO B;  2XMH A;  3VUO A;  2WVK A;  5BXP A;  3D8V A;  1EYL A;  2Q9X A;  3FJC A;  1PUM B;  3CA3 A;  1JTC A;  4D8H A;  1PZZ A;  2JCJ A;  4ZFU B;  4G87 A;  3FJ9 A;  1FG5 N;  3B9U A;  2AEC A;  3BA4 A;  1FXO A;  2I5K A;  4AN7 B;  4EEA A;  3FJE A;  2RJ7 A;  4NAI A;  4MZF B;  3PKP A;  3BAD A;  2ZU7 A;  5CQL X;  1WVC A;  4LW6 A;  4C2S A;  2P23 A;  3UD9 A;  1WT3 A;  3U0Y A;  2D1Z A;  1VH3 A;  1H5S B;  3WO3 A;  4D0T A;  5BP5 C;  1NQI B;  4O6N A;  3UD7 A;  3VSZ A;  5D91 A;  3NBD A;  4EFR A;  4IZX A;  3I0C A;  4XFT A;  2FYD B;  3HSM A;  4KC3 A;  4AYL A;  1FQ9 A;  4HO6 A;  5C8R A;  1W57 A;  4MZG B;  3JUK A;  4CJB A;  5JMC A;  1FV3 A;  2RJ4 A;  4WBC A;  4ASY A;  3FGM A;  4JIS A;  1DLL A;  2DRY A;  3T8S A;  4CJM A;  1S0F A;  2ZQO A;  2QH5 A;  41BI A;  2E4M C;  2KI4 A;  3A07 A;  4KXO A;  1T9F A;  3S8J A;  1F31 A;  3BRD A;  1R8N A;  4X39 A;  1R7Y A;  2V0I A;  1AFC A;  2XWL A;  5FV9 A;  4DEP A;  1G23 A;  1H7H A;  2VS5 A;  5C48 A;  1H7E A;  3IOJ A;  3O3Q A;  3OGZ A;  3OH0 A;  3QVB A;  1D0H A;  2Z87 A;  4GP3 A;  1ZI5 A;  1NUN A;  3CU0 A;  1ZI4 A;  3CA1 A;  3CA0 A;  3U2X A;  2RQ9 A;  4QKR A;  4Y7U A;  4GAI A;  3KIA A;  5FTS A;  2VXT I;  4KRV A;  1AVW B;  1VCL A;  5FZZ A;  4LO2 C;  1BA7 A;  2MLL B;  4NAN A;  1SR4 C;  5CMJ A;  3WMU A;  1Z2V A;  3ZC8 A;  1YRO B;  4MIX A;  5L6S A;  3O3P A;  5BXC A;  1XG6 A;  4Z9W B;  2V0J A;  1JY0 A;  4FRL A;  1ZCT A;  3ZLL A;  4IY8 A;  3O5W B;  1Z4S A;  3I0E A;  2C0N A;  1RZO B;  4I4X A;  2J3P A;  1R8O A;  4H04 A;  2YC5 A;  4P00 A;  2D44 A;  1FWY A;  4I3N A;  1XYF A;  2BO7 A;  4HA2 A;  4ARW A;  5C4F A;  1LL3 A;  2L5X A;  4B4M A;  3ZLK A;  4IHZ A;  3I0G A;  3FFZ A;  1W77 A;  3R4U A;  2RIY A;  1SZ6 B;  2F2F C;  5DUY A;  3V0Q A;  2APC A;  1O0R A;  1FR8 A;  1CVS A;  2E3D A;  2P6W A;  3I0F A;  1JQZ A;  3MAL A;  1NKH B;  3RTJ B;  3FJH A;  5C1G A;  2RJ8 A;  1FZW A;  2IHO A;  1EZI A;  4UY4 A;  4GOV A;  5FTV A;  1TWE A;  3Q7X A;  1S0L A;  1XZZ A;  4ZOT A;  3TZT A;  4OEG A;  1DFQ A;  1FN0 A;  4I0Y A;  1K5U A;  1M2T B;  1IIN A;  3AH1 A;  2RJ9 A;  1RML A;  2VD4 A;  3O4C A;  5CQP A;  1YF8 B;  2RJ0 A;  3ZX7 A;  1K4V A;  1BAS A;  4EB2 B;  9ILB A;  5BQU A;  1AF9 A;  4KEI A;  2BO8 A;  3O4A A;  4KNR A;  1ITB A;  3CRG A;  3T7N A;  2NVH A;  2K43 A;  3FJK A;  1KWS A;  1AVX B;  4F34 A;  5C1L A;  4LO1 A;  4P0J A;  4ZBV B;  1ZJ1 A;  2FY7 A;  3V91 A;  3NBE A;  1H7T A;  2I1B A;  1ISW A;  4KBB A;  1VZX A;  1LZ7 A;  3V0B B;  1S4P A;  5EIY A;  1ISX A;  2HZ9 A;  2VUA A;  1DIW A;  4I1B A;  3FJA A;  4HCQ A;  4Y7T A;  5EJ1 A;  4OUJ A;  2RJ1 A;  3CGX A;  1VZU A;  3I0H A;  1FGA A;  3WO4 A;  3OBR A;  1LZ0 A;  3RSJ A;  3ZXD A;  1FMZ A;  2VSA A;  1V6U A;  1VZT A;  2KKI A;  2V0K A;  3U2V A;  4F83 A;  1VGZ A;  2D7I A;  2AH9 A;  2BEB A;  3JUT A;  2NYY A;  2P39 A;  3P6I A;  3SXC A;  1HWN B;  3H6Q A;  4B4B A;  1ISZ A;  2Z48 A;  4OWL A;  3ZC9 A;  1HKN A;  3UJ4 A;  1G0R A;  4G1R A;  2WBC A;  1W55 A;  5L6V A;  2NTD A;  2Y9X E;  4Z8S B;  3I2X A;  3ST8 A;  1JYL A;  4M2A A;  4I4S A;  2ET2 A;  1ZJP A;  2D0J A;  1H3M A;  1G97 A;  3CKN A;  4IYB A;  1R7T A;  3RMV A;  3I0L A;  4E1K A;  3BRF A;  3N7M A;  4FGF A;  3BAU A;  4HR6 C;  3H6R B;  3RSB A;  2D20 A;  3NJ5 A;  2VLC A;  3V0A B;  2YQS A;  1MP5 A;  1LZJ A;  1ON8 A;  3AH2 A;  4QAL A;  4XFS A;  3Q4S A;  4I2S A;  2YC3 A;  2O1F A;  3N7J A;  3DUV A;  3VT0 A;  1ON6 A;  3ZGG A;  3RMY A;  1H5R A;  4M28 A;  3SXE A;  4CJC A;  3IM7 A;  3BRK X;  4P0L A;  1Q04 A;  4KQL A;  3FJB A;  3BX1 C;  2MC2 A;  1NZK A;  3FOQ A;  3FUO A;  1JT5 A;  1WD3 A;  3RMX A;  4JPZ A;  2AES A;  3MPP G;  1LZI A;  3PME A;  4ZFW B;  8I1B A;  3FJJ A;  4R6U B;  5C3A A;  1VPA A;  5C4B A;  1HM9 A;  2VS3 A;  3N9W A;  4USO A;  1OMZ A;  1H7L A;  4OW4 A;  2CU2 A;  3IM5 A;  5BVP I;  5EJZ A;  3AJ6 A;  4G6J A;  2PA4 A;  1TFM B;  4FQW A;  3CA4 A;  2AE7 A;  2VSH A;  4KC4 A;  4XWI A;  1S0G A;  3OJM A;  3WMV A;  1YBI A;  1IRP A;  4AAW A;  1FGG A;  2V0H A;  4EEE B;  2Y4K A;  2ICY A;  2D23 A;  2X60 A;  4CJ8 A;  3V79 C;  1Z0H A;  2YUG A;  4OEE A;  1G9C A;  3WIN A;  1AVA C;  2P73 A;  2XME A;  4JP0 A;  3IOI A;  4IY9 A;  1YTO A;  2LIQ A;  2LIE A;  3VSF A;  1G9B A;  1GA8 A;  2M49 A;  3HOM A;  4I4P A;  1OQM B;  1V82 A;  3DK5 A;  3ILA A;  4K6R A;  4AC3 A;  1R7X A;  1VGU A;  2F8X C;  1V6X A;  4G9N A;  2OI5 A;  1DFC A;  5BQU C;  1NMM B;  2YQH A;  3USQ A;  4FCE A;  3BTA A;  2OI6 A;  4B2X A;  2O1H A;  3RTI B;  4END A;  3N7L A;  3O4B A;  2P72 A;  3AKG A;  4Q9G A;  3ZXG A;  2K4A B;  1JT3 A;  1DZC A;  4AYJ A;  4EEM A;  2X2T A;  3OJV A;  1BFB A;  3PKQ A;  3SX5 A;  2QGI A;  2ERM A;  1H5T A;  1ZDG A;  1NF5 B;  4HO0 A;  4JAW A;  3AZW A;  4J2K A;  2E8B A;  1FV2 A;  1TP0 A;  3CKJ A;  4KT7 A;  3U2T A;  1FO9 A;  1Q03 A;  4NAL A;  1EVT A;  1VM8 A;  1G82 A;  4QKS A;  1ZCY A;  4D11 A;  4LO0 A;  4A7Y A;  3D5N A;  4HJJ A;  4GAF A;  3K8E A;  4B2W A;  1R7U A;  5DZU A;  1P63 A;  4I4Q A;  4OWJ A;  2A8U A;  4GBP A;  1H4E A;  4Y7V A;  2JCK A;  4Y7F A;  3BAG A;  4G3S A;  1E5K A;  4JD0 A;  1FWU A;  2FFV A;  5JLV A;  1G9R A;  4YS8 A;  5DDT A;  2Z49 A;  4J2S A;  5F8S A;  5CMF X;  2AQZ A;  2D24 A;  3IM6 A;  4EEG A;  1FOA A;  1H5S D;  3KMV A;  3EF2 A;  1PZT A;  1TWM A;  3VWC A;  6I1B A;  1R80 A;  3SX7 A;  3D7W B;  2WAW A;  3N0K A;  4L41 C;  2Q4J A; 
#chains in the Genus database with same CATH homology
 3F1C A;  2NS2 A;  1INI A;  2X5S A;  1S0B A;  1HWM B;  4LO3 C;  1T4Q A;  1G9D A;  1G1L A;  4HOC A;  1S0E A;  3ZF8 A;  5C3D A;  4DDZ A;  4PC4 A;  1IIL A;  1HCD A;  3BRG C;  3DJ4 A;  3EE5 A;  4L4H A;  4X3A A;  1S4O A;  4FRE A;  1H7G A;  3BAQ A;  4H75 A;  4DEC A;  5EC5 A;  4D48 A;  3FWW A;  1ZJO A;  2HWM A;  1PZY B;  1HV9 A;  1O23 B;  5GAQ A;  3LW6 A;  2NP0 A;  4IRQ A;  1OMX A;  31BI A;  4ISQ A;  2GZB A;  1QG8 A;  2YES A;  3D98 A;  4G3P A;  1EV2 A;  2A8W A;  4A7Z A;  1QWJ A;  2BO6 A;  1I1B A;  4GOY A;  3V8Y A;  3VT1 A;  4ASJ A;  5J49 A;  1JLX A;  2BFH A;  5BP5 A;  3SX8 A;  1MD6 A;  2ZU9 A;  1WSZ A;  3E8L C;  2YCM A;  4HO5 A;  1IJT A;  3WIN C;  2QYI B;  5EHA A;  1GWV A;  3OH1 A;  1FO8 A;  5CMH A;  2JCL A;  3CRI A;  4J23 B;  5FZY A;  2RST A;  1TW1 A;  1R7V A;  3IOH A;  3F62 B;  1QGS A;  1H7Q A;  3LLP A;  1YP2 A;  5CQN X;  2MZB A;  3I0K A;  3S8K A;  2DS0 A;  4UEG A;  5E24 E;  3SXA A;  1VIC A;  3R3I A;  2R9K B;  5DDV A;  1IRA X;  1JLY A;  1JVG A;  4Y62 A;  5FU8 A;  4ZGR B;  2Y9W C;  3USR A;  5C36 A;  1DZD A;  2UUS A;  4B3U A;  1WBA A;  3CKO A;  4XFU A;  5C4D A;  4Y7G A;  5IDS A;  1ZCV A;  3F1Y A;  4ZDQ A;  2X2S A;  1QGQ A;  1H5R B;  4HG6 A;  1I52 A;  1BFG A;  2VSI A;  4FVV A;  2XWN A;  3BAV A;  4D11 C;  1QXM A;  2AFG A;  4I4O A;  1ILR 1;  4LW3 A;  4LO2 A;  3CRH A;  1VH1 A;  1SR4 A;  5FNX A;  3E26 A;  3WO2 A;  1N4K A;  1TVY A;  3CU1 B;  2I5E A;  1PUU B;  5F8W A;  3CQA A;  1ISY A;  1BLD A;  1MC9 A;  2NXV A;  2RJ5 A;  3CA6 A;  1DQO A;  3VEQ A;  2ZU8 A;  1WBC A;  4JKQ A;  3I0I X;  4LO7 C;  4X38 A;  4NAK A;  5BXR A;  2WEE A;  3V90 A;  4OWK A;  4FRM A;  1IHK A;  3UDA A;  1YYN A;  2VK9 A;  1BAR A;  3OJ2 A;  2HWA A;  1VGW A;  1DJS B;  2VSE A;  1ZI1 A;  5BXS A;  5AJN A;  3UD8 A;  3JRR A;  3SXG A;  1K5V A;  4Y6U A;  5C4C A;  1E0O A;  5D61 A;  1SS9 A;  2Y7A A;  3Q7U A;  2F2F A;  1JYK A;  4I1E A;  4MYB A;  3O49 A;  4QD2 C;  3OAM A;  3T7M A;  3LTQ A;  3I29 B;  2YQJ A;  3TC2 A;  3BA5 A;  1S4N A;  2VXM A;  3R2W A;  2Y4M A;  1V6V A;  4HO4 A;  1PC8 B;  1IT0 A;  3NBC A;  2KI6 B;  5D63 A;  1HIB A;  3O44 A;  1LL2 A;  4FCU A;  4FRH A;  4R7P A;  4QC4 A;  4USP A;  3JTJ A;  3I2A A;  3OC9 A;  5FYE A;  4FRD A;  3HBW A;  3SXB A;  3U0X A;  1H4C A;  4HO9 A;  4AN6 A;  3T7O A;  3FJI A;  4BMA A;  1DQG A;  4FIY A;  2KH2 A;  4Q9P A;  2ZQN A;  3IIR A;  4ION A;  3CA5 A;  4IQP A;  1EYR A;  3C9Z A;  4Y64 A;  5FUH A;  1W3G A;  1ZDF A;  2Y9F A;  1ZIZ A;  2GO2 A;  4CVH A;  3OGF A;  3Q80 A;  2OEF A;  3UJ0 A;  4ZA3 B;  4I4R A;  5B2H A;  1H5T B;  1W3F A;  2WVL A;  4LO1 C;  2K8R A;  3SXD A;  1QQL A;  4OEF A;  2O1G A;  5BOW A;  4B5B A;  4EE3 A;  2I7B A;  5F90 A;  3O4O A;  2VXR A;  3PHZ A;  4J2Y A;  4X37 A;  2FDB M;  3POL A;  3I0D A;  3U2W A;  3HAL A;  5F8Y A;  3SNV A;  5C4E A;  2RIZ A;  1GGP B;  1ABR B;  4EFP A;  1FRW A;  4EFQ A;  1TZF A;  1NHE B;  1H5S A;  5C1H A;  3FJD A;  1TTU A;  3CKV A;  2AM4 A;  5FNW A;  4I4V A;  1HM8 A;  1O7Q A;  2JCO A;  2Y9G A;  4KEK A;  4YOL A;  5HS2 A;  1TW5 A;  1ZJ0 A;  4LO7 B;  4EE5 A;  5CQM X;  5FU0 A;  4EEO A;  3U2U A;  2OI7 A;  2HW9 A;  4FRO A;  5C38 A;  2D7R A;  1XZ6 A;  2GGQ A;  1UPS A;  1MP3 A;  3AKH A;  2NM1 A;  3WA1 A;  1OQL B;  7I1B A;  2VFZ A;  2WGZ A;  1V84 A;  1V6W A;  1MP4 A;  3F1R A;  1ZI3 A;  4HO3 A;  3V0L A;  1GX4 A;  5DSS B;  2PX7 A;  4KNX A;  1HM0 A;  4HO8 A;  4FRQ A;  5BXT A;  4QD2 B;  3V0N A;  4L4I A;  2Z86 A;  4FRA A;  5CQO A;  4QBC A;  2QN4 A;  3V0M A;  3Q7W A;  2AM5 A;  2ZR1 B;  1EPW A;  1O7O A;  2AAI B;  1GQC A;  1FWV A;  2GGO A;  2NZ9 A;  2WRY A;  1HWP B;  4XKI A;  3IAG C;  2OEG A;  4KC1 A;  1BFF A;  1HJJ A;  2XWM A;  4MZH A;  5CMI A;  2BEA A;  2FO1 A;  2FYB A;  3AH4 A;  4DCK C;  4QBV A;  2VXL A;  3BA7 A;  4KPZ A;  3AZV A;  1Z90 A;  2X65 A;  4I4Y A;  1FR9 A;  4FRP A;  3V8Z A;  4B4G A;  1G9A A;  4J18 A;  1ZHJ A;  1IIM A;  1WT2 A;  4I96 A;  5C3B A;  1ISV A;  3BCV A;  1G95 A;  4FIX A;  4EVW A;  1WD4 A;  1ZJ2 A;  3BB2 A;  3FJ8 A;  2FYC B;  2X5Z A;  2PGY A;  1R81 A;  1INJ A;  4GP0 A;  3POK A;  3OH3 A;  1HJL A;  2VU9 A;  3OBT A;  1G2V A;  4ISR A;  5I1F A;  3PG0 A;  1AXM A;  4FRB A;  1S0D A;  3HMY A;  2FYA A;  4MND A;  5AJP A;  5C47 A;  3W9T A;  3O4D A;  4JQ0 A;  3AKI A;  4II0 A;  4Q7C A;  4M2B A;  1NWG B;  2KLL A;  1HCE A;  4DE7 A;  4EKX B;  2RJ6 A;  2ICX A;  1FMM S;  1JT7 A;  2FGF A;  1W3A A;  4P02 A;  3K8D A;  1S0C A;  2RG9 B;  2BO4 A;  1AVU A;  1A8D A;  1BLA A;  1I1E A;  2DRE A;  3JUJ A;  2ESU A;  4B42 A;  1LL0 A;  1M16 A;  2PGV A;  3AKF A;  2AGD A;  1VGT A;  5I1B A;  1JV3 A;  1JVD A;  2MIB A;  3CAH A;  4G3Q A;  4Y63 A;  4LO8 B;  1IOB A;  2V0L A;  1MC3 A;  4BQH A;  2E4M A;  3RMW A;  4D0Z A;  3SPT A;  4JKX B;  21BI A;  2J0B A;  5AJO A;  5D62 A;  3H6S E;  2D22 A;  4JRA A;  3V0O A;  1RG8 A;  4HO2 A;  1GWW A;  3PNN A;  5IFY A;  4I6I A;  3GUE A;  4I7I A;  4P0K A;  3OH2 A;  5FZU A;  2WE9 A;  2DPW A;  1G3L A;  4QO3 A;  3R4S A;  2VS4 A;  4I37 A;  1YP3 A;  1L2H A;  2YQC A;  3E25 A;  1II4 A;  4KPX A;  2RIX A;  5C49 A;  3A22 A;  1YXW A;  4LO0 C;  4DEN A;  4ZLB B;  3V0B A;  1H5S C;  3AJ5 A;  1WT0 A;  2IWT B;  3Q7Y A;  4O6M A;  2W0W A;  4ZFY B;  1R82 A;  1CE7 B;  2UX8 A;  3K1X A;  4ECM A;  1H4D A;  1JV1 A;  2Q3N B;  3A21 A;  1RY7 A;  1G93 A;  2J0A A;  1ONK B;  1G8O A;  4Q91 A;  2QKX A;  4G6M A;  3CKQ A;  4I8M A;  1YP4 A;  3A23 A;  1TIE A;  4J2X A;  1FXJ A;  1ZCU A;  1QQK A;  3QYD A;  3OGG A;  2Y4J A;  3ZGF A;  3OH4 A;  1FGX A;  3BAH A;  4G9M A;  4I4U A;  5EG6 C;  5IDT A;  3V0P A;  5DVH A;  1KNM A;  3N7K A;  1PWA A;  4H9W A;  4TLP A;  3VT2 A;  4IZE A;  1J0S A;  1H7F A;  3I0J A;  3OKR A;  1GQ9 A;  2AM3 A;  1BFC A;  3QR5 A;  2Y6P A;  4IRP A;  2FFU A;  5G00 A;  1LVW A;  2D43 A;  3NGW A;  5HPZ A;  2DRZ A;  3P6J A;  1JT4 A;  4P6A A;  1WT1 A;  3H6R A;  4LO3 A;  2W0V A;  3V0A A;  4M4K A;  4Y9X A;  1TOO A;  5CMG X;  4KEJ A;  1V83 A;  3P53 A;  2Y4L A;  1Q1U A;  2XOA A;  1GX0 A;  4EE4 A;  3PUB A;  4A7K A;  3TQD A;  4Y6N A;  5D92 A;  2WVM A;  2AXM A;  5JQQ A;  3HN1 A;  1ZJ3 A;  4ZKT B;  4KC2 A;  3SX3 A;  3BAO A;  3NBN A;  3FJF A;  3FUQ A;  2RIT A;  1XHB A;  3HL3 A;  1HWO B;  2XMH A;  3VUO A;  2WVK A;  5BXP A;  3D8V A;  1EYL A;  2Q9X A;  3FJC A;  1PUM B;  3CA3 A;  1JTC A;  4D8H A;  1PZZ A;  2JCJ A;  4ZFU B;  4G87 A;  3FJ9 A;  1FG5 N;  3B9U A;  2AEC A;  3BA4 A;  1FXO A;  2I5K A;  4AN7 B;  4EEA A;  3FJE A;  2RJ7 A;  4NAI A;  4MZF B;  3PKP A;  3BAD A;  2ZU7 A;  5CQL X;  1WVC A;  4LW6 A;  4C2S A;  2P23 A;  3UD9 A;  1WT3 A;  3U0Y A;  2D1Z A;  1VH3 A;  1H5S B;  3WO3 A;  4D0T A;  5BP5 C;  1NQI B;  4O6N A;  3UD7 A;  3VSZ A;  5D91 A;  3NBD A;  4EFR A;  4IZX A;  3I0C A;  4XFT A;  2FYD B;  3HSM A;  4KC3 A;  4AYL A;  1FQ9 A;  4HO6 A;  5C8R A;  1W57 A;  4MZG B;  3JUK A;  4CJB A;  5JMC A;  1FV3 A;  2RJ4 A;  4WBC A;  4ASY A;  3FGM A;  4JIS A;  1DLL A;  2DRY A;  3T8S A;  4CJM A;  1S0F A;  2ZQO A;  2QH5 A;  41BI A;  2E4M C;  2KI4 A;  3A07 A;  4KXO A;  1T9F A;  3S8J A;  1F31 A;  3BRD A;  1R8N A;  4X39 A;  1R7Y A;  2V0I A;  1AFC A;  2XWL A;  5FV9 A;  4DEP A;  1G23 A;  1H7H A;  2VS5 A;  5C48 A;  1H7E A;  3IOJ A;  3O3Q A;  3OGZ A;  3OH0 A;  3QVB A;  1D0H A;  2Z87 A;  4GP3 A;  1ZI5 A;  1NUN A;  3CU0 A;  1ZI4 A;  3CA1 A;  3CA0 A;  3U2X A;  2RQ9 A;  4QKR A;  4Y7U A;  4GAI A;  3KIA A;  5FTS A;  2VXT I;  4KRV A;  1AVW B;  1VCL A;  5FZZ A;  4LO2 C;  1BA7 A;  2MLL B;  4NAN A;  1SR4 C;  5CMJ A;  3WMU A;  1Z2V A;  3ZC8 A;  1YRO B;  4MIX A;  5L6S A;  3O3P A;  5BXC A;  1XG6 A;  4Z9W B;  2V0J A;  1JY0 A;  4FRL A;  1ZCT A;  3ZLL A;  4IY8 A;  3O5W B;  1Z4S A;  3I0E A;  2C0N A;  1RZO B;  4I4X A;  2J3P A;  1R8O A;  4H04 A;  2YC5 A;  4P00 A;  2D44 A;  1FWY A;  4I3N A;  1XYF A;  2BO7 A;  4HA2 A;  4ARW A;  5C4F A;  1LL3 A;  2L5X A;  4B4M A;  3ZLK A;  4IHZ A;  3I0G A;  3FFZ A;  1W77 A;  3R4U A;  2RIY A;  1SZ6 B;  2F2F C;  5DUY A;  3V0Q A;  2APC A;  1O0R A;  1FR8 A;  1CVS A;  2E3D A;  2P6W A;  3I0F A;  1JQZ A;  3MAL A;  1NKH B;  3RTJ B;  3FJH A;  5C1G A;  2RJ8 A;  1FZW A;  2IHO A;  1EZI A;  4UY4 A;  4GOV A;  5FTV A;  1TWE A;  3Q7X A;  1S0L A;  1XZZ A;  4ZOT A;  3TZT A;  4OEG A;  1DFQ A;  1FN0 A;  4I0Y A;  1K5U A;  1M2T B;  1IIN A;  3AH1 A;  2RJ9 A;  1RML A;  2VD4 A;  3O4C A;  5CQP A;  1YF8 B;  2RJ0 A;  3ZX7 A;  1K4V A;  1BAS A;  4EB2 B;  9ILB A;  5BQU A;  1AF9 A;  4KEI A;  2BO8 A;  3O4A A;  4KNR A;  1ITB A;  3CRG A;  3T7N A;  2NVH A;  2K43 A;  3FJK A;  1KWS A;  1AVX B;  4F34 A;  5C1L A;  4LO1 A;  4P0J A;  4ZBV B;  1ZJ1 A;  2FY7 A;  3V91 A;  3NBE A;  1H7T A;  2I1B A;  1ISW A;  4KBB A;  1VZX A;  1LZ7 A;  3V0B B;  1S4P A;  5EIY A;  1ISX A;  2HZ9 A;  2VUA A;  1DIW A;  4I1B A;  3FJA A;  4HCQ A;  4Y7T A;  5EJ1 A;  4OUJ A;  2RJ1 A;  3CGX A;  1VZU A;  3I0H A;  1FGA A;  3WO4 A;  3OBR A;  1LZ0 A;  3RSJ A;  3ZXD A;  1FMZ A;  2VSA A;  1V6U A;  1VZT A;  2KKI A;  2V0K A;  3U2V A;  4F83 A;  1VGZ A;  2D7I A;  2AH9 A;  2BEB A;  3JUT A;  2NYY A;  2P39 A;  3P6I A;  3SXC A;  1HWN B;  3H6Q A;  4B4B A;  1ISZ A;  2Z48 A;  4OWL A;  3ZC9 A;  1HKN A;  3UJ4 A;  1G0R A;  4G1R A;  2WBC A;  1W55 A;  5L6V A;  2NTD A;  2Y9X E;  4Z8S B;  3I2X A;  3ST8 A;  1JYL A;  4M2A A;  4I4S A;  2ET2 A;  1ZJP A;  2D0J A;  1H3M A;  1G97 A;  3CKN A;  4IYB A;  1R7T A;  3RMV A;  3I0L A;  4E1K A;  3BRF A;  3N7M A;  4FGF A;  3BAU A;  4HR6 C;  3H6R B;  3RSB A;  2D20 A;  3NJ5 A;  2VLC A;  3V0A B;  2YQS A;  1MP5 A;  1LZJ A;  1ON8 A;  3AH2 A;  4QAL A;  4XFS A;  3Q4S A;  4I2S A;  2YC3 A;  2O1F A;  3N7J A;  3DUV A;  3VT0 A;  1ON6 A;  3ZGG A;  3RMY A;  1H5R A;  4M28 A;  3SXE A;  4CJC A;  3IM7 A;  3BRK X;  4P0L A;  1Q04 A;  4KQL A;  3FJB A;  3BX1 C;  2MC2 A;  1NZK A;  3FOQ A;  3FUO A;  1JT5 A;  1WD3 A;  3RMX A;  4JPZ A;  2AES A;  3MPP G;  1LZI A;  3PME A;  4ZFW B;  8I1B A;  3FJJ A;  4R6U B;  5C3A A;  1VPA A;  5C4B A;  1HM9 A;  2VS3 A;  3N9W A;  4USO A;  1OMZ A;  1H7L A;  4OW4 A;  2CU2 A;  3IM5 A;  5BVP I;  5EJZ A;  3AJ6 A;  4G6J A;  2PA4 A;  1TFM B;  4FQW A;  3CA4 A;  2AE7 A;  2VSH A;  4KC4 A;  4XWI A;  1S0G A;  3OJM A;  3WMV A;  1YBI A;  1IRP A;  4AAW A;  1FGG A;  2V0H A;  4EEE B;  2Y4K A;  2ICY A;  2D23 A;  2X60 A;  4CJ8 A;  3V79 C;  1Z0H A;  2YUG A;  4OEE A;  1G9C A;  3WIN A;  1AVA C;  2P73 A;  2XME A;  4JP0 A;  3IOI A;  4IY9 A;  1YTO A;  2LIQ A;  2LIE A;  3VSF A;  1G9B A;  1GA8 A;  2M49 A;  3HOM A;  4I4P A;  1OQM B;  1V82 A;  3DK5 A;  3ILA A;  4K6R A;  4AC3 A;  1R7X A;  1VGU A;  2F8X C;  1V6X A;  4G9N A;  2OI5 A;  1DFC A;  5BQU C;  1NMM B;  2YQH A;  3USQ A;  4FCE A;  3BTA A;  2OI6 A;  4B2X A;  2O1H A;  3RTI B;  4END A;  3N7L A;  3O4B A;  2P72 A;  3AKG A;  4Q9G A;  3ZXG A;  2K4A B;  1JT3 A;  1DZC A;  4AYJ A;  4EEM A;  2X2T A;  3OJV A;  1BFB A;  3PKQ A;  3SX5 A;  2QGI A;  2ERM A;  1H5T A;  1ZDG A;  1NF5 B;  4HO0 A;  4JAW A;  3AZW A;  4J2K A;  2E8B A;  1FV2 A;  1TP0 A;  3CKJ A;  4KT7 A;  3U2T A;  1FO9 A;  1Q03 A;  4NAL A;  1EVT A;  1VM8 A;  1G82 A;  4QKS A;  1ZCY A;  4D11 A;  4LO0 A;  4A7Y A;  3D5N A;  4HJJ A;  4GAF A;  3K8E A;  4B2W A;  1R7U A;  5DZU A;  1P63 A;  4I4Q A;  4OWJ A;  2A8U A;  4GBP A;  1H4E A;  4Y7V A;  2JCK A;  4Y7F A;  3BAG A;  4G3S A;  1E5K A;  4JD0 A;  1FWU A;  2FFV A;  5JLV A;  1G9R A;  4YS8 A;  5DDT A;  2Z49 A;  4J2S A;  5F8S A;  5CMF X;  2AQZ A;  2D24 A;  3IM6 A;  4EEG A;  1FOA A;  1H5S D;  3KMV A;  3EF2 A;  1PZT A;  1TWM A;  3VWC A;  6I1B A;  1R80 A;  3SX7 A;  3D7W B;  2WAW A;  3N0K A;  4L41 C;  2Q4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...