3P6JA

Crystal structure of symfoil-4t permutation #3: de novo designed beta-trefoil architecture with symmetric primary structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
125
structure length
125
Chain Sequence
KGDTHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDTHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDTHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Permutations study of de novo designed symmetric beta-trefoil architecture
rcsb
molecule keywords de novo designed beta-trefoil architecture with symmetric pr
molecule tags De novo protein
total genus 34
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3p6jA00
1S0DA 4ISRA 3BA7A 5EC5A 1Z2VA 1HWNB 3LTQA 5BVPI 1WBAA 3FJDA 4J23B 1HWPB 4QO3A 2VSAA 3PUBA 4A7KA 3SNVA 4KEKA 5I1BA 1YYNA 4G6MA 4GAIA 1G9AA 3A21A 4OWLA 3BAQA 3UD7A 4I1EA 1Z4SA 4IY8A 2D1ZA 1YBIA 3R4SA 1BLDA 2K4AB 3QYDA 2KKIA 2ZQOA 3ZXGA 3S8JA 1VCLA 1IHKA 3NJ5A 2D7RA 1WBCA 2FO1A 2RSTA 1XZZA 2D23A 3Q7WA 4EFRA 1RY7A 4OEEA 3CRGA 3MPPG 3UD8A 1TIEA 1FMZA 1K5UA 2P39A 3FUQA 1FGAA 4D0TA 3D7WB 4I96A 1ISWA 2HZ9A 1HIBA 3KMVA 4USPA 1IILA 4EFQA 3AJ6A 4DENA 2HWMA 3AKFA 3IM6A 4GOYA 3ZX7A 3IIRA 1ITBA 1QXMA 3C9ZA 4KEJA 3BAVA 3CA6A 3K1XA 3OBRA 2Z49A 4QD2C 2I1BA 3A23A 1N4KA 2KI6B 3I2XA 4QALA 1SZ6B 4GP3A 1JY0A 4IONA 1SR4C 3WO3A 1CE7B 2ERMA 4P0JA 4FGFA 2WRYA 3I29B 3CAHA 4ENDA 3AKGA 3TC2A 3OGFA 4ZBVB 1S0EA 2D7IA 3CA5A 4H04A 2P23A 3CA0A 4Q91A 3VSZA 3MALA 3QR5A 4I4QA 4QBCA 4WBCA 1AVUA 3BAGA 3VT0A 3VWCA 2FFVA 1EYLA 3HALA 2VSEA 4I4RA 1OQLB 3FJ9A 5DSSB 2J3PA 4ZA3B 2YUGA 3FJHA 4ZKTB 2Q3NB 1R8OA 4OWKA 1M16A 4QC4A 3BX1C 5FZYA 2Y9GA 1V6WA 1CVSA 3ILAA 4DCKC 1JTCA 3R4UA 4X38A 3P53A 5F8SA 1RZOB 3I2AA 4OWJA 5D61A 3UD9A 1QQLA 3NBCA 5F8WA 3RMYA 1EVTA 5DUYA 1DQOA 4JRAA 3FFZA 2ZR1B 2ET2A 3OJVA 4I4OA 1IT0A 4OW4A 3BRFA 4P6AA 1P63A 4QBVA 2LIEA 4EKXB 3FUOA 2VLCA 1T4QA 2ZQNA 2GO2A 4IYBA 4H9WA 3JUTA 3A22A 4P0LA 1WD4A 4Q9PA 4ZOTA 3AH1A 1NUNA 3O4CA 3HOMA 1FV2A 5HPZA 2ESUA 2KLLA 1I1EA 3VSFA 4JKXB 2MIBA 1G9CA 2D22A 5JLVA 4L4IA 1JT7A 2FFUA 1AF9A 1I1BA 2HW9A 4G9NA 3OGGA 2D24A 1F31A 2GZBA 4EB2B 2QN4A 1UPSA 3F62B 2IWTB 3FJAA 2Y9FA 5F90A 2X2SA 3BA4A 1RG8A 1AXMA 3WINA 5BP5A 4I1BA 1JT3A 2FGFA 5E24E 4IZEA 4I2SA 4Q9GA 4Z8SB 1DIWA 1YTOA 3O44A 2AXMA 2Y9WC 3B9UA 4LO3A 4J2SA 2M49A 3CA4A 2IHOA 4GP0A 4I4PA 3O4OA 3UDAA 3WINC 5BP5C 1YXWA 2VU9A 3H6RA 4PC4A 3BTAA 4X37A 4JAWA 4LO3C 1DZDA 1BA7A 1FQ9A 1GGPB 2Q9XA 4KEIA 1WD3A 3FJ8A 2RG9B 3NBEA 1JLXA 3OJ2A 5B2HA 3IM7A 4I8MA 1YF8B 1G9BA 3O4DA 4F83A 4JQ0A 3ZC9A 1ONKB 3HSMA 4IY9A 3POKA 3FJBA 5BXRA 1FWUA 5DVHA 4ZGRB 2LIQA 1W3FA 1PWAA 5EG6C 1AVXB 1K5VA 3AZWA 1ISVA 4IZXA 1G82A 4JPZA 2DRZA 3ZC8A 2WBCA 4J2XA 3V0BB 1TFMB 2MLLB 4KBBA 3WA1A 4EEEB 1HCDA 4GOVA 3FJIA 2L5XA 1BARA 3UJ0A 2NTDA 1BLAA 3LLPA 4I4UA 1S0FA 4AN7B 4D8HA 4XFTA 4II0A 3BAUA 4OUJA 1V6XA 5D62A 3WO4A 1EV2A 3N7KA 4OEGA 2AAIB 1HWOB 1V6VA 1TTUA 4GAFA 2DRYA 3RTIB 4XFUA 1IOBA 3NBNA 3W9TA 3BA5A 2NYYA 4I3NA 2NP0A 21BIA 1Q03A 3CU1B 4A7YA 5FZUA 1TOOA 3VUOA 1J0SA 1AVAC 4R6UB 1S0GA 3O4BA 2BEBA 2D44A 1DLLA 3BB2A 2DS0A 4ZFYB 3H6RB 3WMVA 3V0BA 2RQ9A 5BOWA 3CRHA 5G00A 1AVWB 2QYIB 3BADA 2KH2A 7I1BA 4LO2A 4F34A 1IJTA 2D43A 2DREA 1FMMS 3P6JA 1II4A 2D20A 5F8YA 4I4SA 1ABRB 1DZCA 4IHZA 3V79C 2XOAA 3PG0A 4LO2C 4ZFWB 1TWEA 4J2YA 3VT2A 2K8RA 3HN1A 4LO7B 2MC2A 41BIA 8I1BA 4LO0A 2NM1A 5FNXA 4ZLBB 3Q7YA 1IRAX 4HR6C 3WO2A 4I4VA 1IRPA 3S8KA 1XG6A 1L2HA 1W3GA 3O3QA 3FJFA 5BXPA 3JRRA 4JKQA 3BRDA 4FVVA 5BQUA 1FN0A 1ISYA 4I6IA 5EHAA 4LO0C 1MC9A 4EFPA 1PC8B 3ZXDA 3V0AB 1JQZA 3N0KA 3RMXA 4A7ZA 6I1BA 1BASA 1AFCA 1DJSB 3WMUA 3PMEA 3F1RA 3H6SE 2AQZA 1TP0A 3AH2A 3T8SA 3HBWA 4XFSA 5BQUC 3UJ4A 1W3AA 4CJMA 4D0ZA 1RMLA 4I4YA 1PUUB 3O4AA 2FDBM 1FV3A 4USOA 1PUMB 1XHBA 1FWVA 4G6JA 1ISZA 4LO1A 4QKSA 3FJKA 4LO8B 5GAQA 1PZZA 3VEQA 1S0LA 4I37A 3RTJB 1Q04A 2VXTI 2F2FA 1SR4A 1V6UA 3FGMA 4P0KA 4IQPA 9ILBA 3FJCA 5BXSA 5FNWA 1ISXA 3CQAA 4LO1C 2X2TA 2VUAA 1BFGA 4Z9WB 4OEFA 2F2FC 4I0YA 4LO7C 4TLPA 3CA1A 3VT1A 3IAGC 3N7MA 2Z48A 1A8DA 3V0AA 2KI4A 3BAHA 1DQGA 3AJ5A 1KNMA 2AFGA 1JT4A 4G9MA 1G9DA 2VXRA 5D63A 3A07A 3AH4A 5DZUA 1BFFA 1JT5A 4QKRA 3N7LA 3OBTA 3O49A 3H6QA 4HJJA 2NZ9A 1R8NA 4X39A 3N7JA 3PHZA 1ILR1 5JMCA 1MD6A 1QQKA 1S0BA 3FJEA 5BXTA 4DEPA 1M2TB 3AKIA 3NBDA 1Z0HA 1D0HA 2NVHA 31BIA 3IM5A 3OJMA 4YOLA 2BEAA 4KC3A 1NZKA 3HMYA 3O5WB 1HKNA 3BAOA 1DFCA 3CA3A 3EF2A 2Y9XE 3AKHA 4ISQA 4L4HA 4AN6A 1HCEA 4XKIA 3BRGC 3Q7XA 5FZZA 4HA2A 2UUSA 4G1RA 3FJJA 3E8LC 1HWMB 1TWMA 1E0OA 4ZFUB 3AZVA 2K43A 2HWAA 1BFCA 1Q1UA 2E4MA 1JLYA 1S0CA 2BFHA 2F8XC 2R9KB 1DFQA 3P6IA 1EPWA 4JP0A 4I7IA 4I4XA 3CRIA 4J2KA 3RSJA 4QD2B 1XYFA 1T9FA 4X3AA 1BFBA 2E4MC
chains in the Genus database with same CATH superfamily
1S0DA 4ISRA 3BA7A 5EC5A 1Z2VA 1HWNB 3LTQA 5BVPI 1WBAA 3FJDA 4J23B 1HWPB 4QO3A 2VSAA 3PUBA 4A7KA 3SNVA 4KEKA 5I1BA 1YYNA 4G6MA 4GAIA 1G9AA 3A21A 4OWLA 3BAQA 3UD7A 4I1EA 1Z4SA 4IY8A 2D1ZA 1YBIA 3R4SA 1BLDA 2K4AB 3QYDA 2KKIA 2ZQOA 3ZXGA 3S8JA 1VCLA 1IHKA 3NJ5A 2D7RA 1WBCA 2FO1A 2RSTA 1XZZA 2D23A 3Q7WA 4EFRA 1RY7A 4OEEA 3CRGA 3MPPG 3UD8A 1TIEA 1FMZA 1K5UA 2P39A 3FUQA 1FGAA 4D0TA 3D7WB 4I96A 1ISWA 2HZ9A 1HIBA 3KMVA 4USPA 4MZHA 1IILA 4EFQA 3AJ6A 4DENA 2HWMA 3AKFA 3IM6A 4GOYA 3ZX7A 3IIRA 1ITBA 1QXMA 3C9ZA 4KEJA 3BAVA 3CA6A 3K1XA 3OBRA 2Z49A 4QD2C 2I1BA 3A23A 1N4KA 2KI6B 3I2XA 4QALA 1SZ6B 4GP3A 1JY0A 4IONA 1SR4C 3WO3A 1CE7B 2ERMA 4P0JA 4FGFA 2WRYA 3I29B 3CAHA 4ENDA 3AKGA 3TC2A 3OGFA 4ZBVB 1S0EA 2D7IA 3CA5A 4H04A 2P23A 3CA0A 4Q91A 3VSZA 3MALA 3QR5A 4I4QA 4QBCA 4WBCA 1AVUA 3BAGA 3VT0A 3VWCA 2FFVA 1EYLA 3HALA 2VSEA 4I4RA 1OQLB 3FJ9A 5DSSB 2J3PA 4ZA3B 2YUGA 3FJHA 4ZKTB 2Q3NB 1R8OA 4OWKA 1M16A 4QC4A 3BX1C 5FZYA 2Y9GA 1V6WA 1CVSA 3ILAA 4DCKC 1JTCA 3R4UA 4X38A 3P53A 5F8SA 1RZOB 3I2AA 4OWJA 5D61A 3UD9A 1QQLA 3NBCA 5F8WA 3RMYA 1EVTA 5DUYA 1DQOA 4JRAA 3FFZA 2ZR1B 4MZFB 2ET2A 3OJVA 4I4OA 1IT0A 4OW4A 3BRFA 4P6AA 1P63A 4QBVA 2LIEA 4EKXB 3FUOA 2VLCA 1T4QA 2ZQNA 2GO2A 4IYBA 4H9WA 3JUTA 3A22A 4P0LA 1WD4A 4Q9PA 4ZOTA 3AH1A 1NUNA 3O4CA 3HOMA 1FV2A 5HPZA 2ESUA 2KLLA 1I1EA 3VSFA 4JKXB 2MIBA 1G9CA 2D22A 5JLVA 4L4IA 1JT7A 2FFUA 1AF9A 1I1BA 2HW9A 4G9NA 3OGGA 2D24A 1F31A 2GZBA 4EB2B 2QN4A 1UPSA 3F62B 2IWTB 3FJAA 2Y9FA 5F90A 2X2SA 3BA4A 1RG8A 1AXMA 3WINA 5BP5A 4I1BA 1JT3A 2FGFA 5E24E 4IZEA 4I2SA 4Q9GA 4Z8SB 1DIWA 1YTOA 3O44A 2AXMA 2Y9WC 3B9UA 4LO3A 4J2SA 2M49A 3CA4A 2IHOA 4GP0A 4I4PA 3O4OA 3UDAA 3WINC 5BP5C 1YXWA 2VU9A 3H6RA 4PC4A 3BTAA 4X37A 4JAWA 4LO3C 1DZDA 1BA7A 1FQ9A 1GGPB 2Q9XA 4KEIA 1WD3A 3FJ8A 2RG9B 3NBEA 1JLXA 3OJ2A 5B2HA 3IM7A 4I8MA 1YF8B 1G9BA 3O4DA 4F83A 4JQ0A 3ZC9A 1ONKB 3HSMA 4IY9A 3POKA 3FJBA 5BXRA 1FWUA 5DVHA 4ZGRB 2LIQA 1W3FA 1PWAA 5EG6C 1AVXB 1K5VA 3AZWA 1ISVA 4IZXA 1G82A 4JPZA 2DRZA 3ZC8A 2WBCA 4J2XA 3V0BB 1TFMB 2MLLB 4KBBA 3WA1A 4EEEB 1HCDA 4GOVA 3FJIA 2L5XA 1BARA 3UJ0A 2NTDA 1BLAA 3LLPA 4I4UA 1S0FA 4AN7B 4D8HA 4XFTA 4II0A 3BAUA 4OUJA 1V6XA 5D62A 3WO4A 1EV2A 3N7KA 4OEGA 2AAIB 1HWOB 1V6VA 1TTUA 4GAFA 2DRYA 3RTIB 4XFUA 1IOBA 3NBNA 3W9TA 3BA5A 2NYYA 4I3NA 2NP0A 21BIA 1Q03A 3CU1B 4A7YA 5FZUA 1TOOA 3VUOA 1J0SA 1AVAC 4R6UB 1S0GA 3O4BA 2BEBA 2D44A 1DLLA 3BB2A 2DS0A 4ZFYB 3H6RB 3WMVA 4H75A 3V0BA 2RQ9A 5BOWA 3CRHA 5G00A 1AVWB 2QYIB 3BADA 2KH2A 7I1BA 4LO2A 4F34A 1IJTA 2D43A 2DREA 1FMMS 3P6JA 1II4A 2D20A 5F8YA 4I4SA 1ABRB 1DZCA 4IHZA 3V79C 2XOAA 3PG0A 4LO2C 4ZFWB 4UY4A 1TWEA 4J2YA 3VT2A 2K8RA 3HN1A 4LO7B 2MC2A 41BIA 8I1BA 4LO0A 2NM1A 5FNXA 4ZLBB 3Q7YA 1IRAX 4HR6C 3WO2A 4I4VA 1IRPA 3S8KA 1XG6A 1L2HA 1W3GA 3O3QA 3FJFA 5BXPA 3JRRA 4JKQA 3BRDA 4FVVA 5BQUA 1FN0A 1ISYA 4I6IA 5EHAA 4LO0C 1MC9A 4EFPA 1PC8B 3ZXDA 3V0AB 1JQZA 3N0KA 3RMXA 4A7ZA 6I1BA 1BASA 1AFCA 1DJSB 3WMUA 3PMEA 3F1RA 3H6SE 2AQZA 1TP0A 3AH2A 3T8SA 3HBWA 4XFSA 5BQUC 3UJ4A 1W3AA 4CJMA 4D0ZA 1RMLA 4I4YA 1PUUB 3O4AA 2FDBM 1FV3A 4USOA 1PUMB 1XHBA 1FWVA 4G6JA 1ISZA 4LO1A 4QKSA 3FJKA 4LO8B 5GAQA 1PZZA 3VEQA 1S0LA 4I37A 3RTJB 1Q04A 2VXTI 2F2FA 1SR4A 1V6UA 3FGMA 4P0KA 4IQPA 9ILBA 3FJCA 5BXSA 5FNWA 1ISXA 3CQAA 4LO1C 2X2TA 2VUAA 1BFGA 4Z9WB 4OEFA 2F2FC 4I0YA 4LO7C 4TLPA 3CA1A 3VT1A 3IAGC 3N7MA 2Z48A 1A8DA 3V0AA 2KI4A 3BAHA 1DQGA 3AJ5A 1KNMA 2AFGA 1JT4A 4G9MA 1G9DA 2VXRA 5D63A 3A07A 3AH4A 5DZUA 1BFFA 1JT5A 4QKRA 3N7LA 3OBTA 3O49A 3H6QA 4HJJA 2NZ9A 1R8NA 4X39A 3N7JA 3PHZA 1ILR1 5JMCA 1MD6A 1QQKA 1S0BA 3FJEA 5BXTA 4DEPA 1M2TB 3AKIA 3NBDA 1Z0HA 1D0HA 2NVHA 31BIA 3IM5A 3OJMA 4YOLA 2BEAA 4KC3A 1NZKA 3HMYA 3O5WB 1HKNA 3BAOA 1DFCA 3CA3A 3EF2A 2Y9XE 3AKHA 4ISQA 4L4HA 4AN6A 1HCEA 4XKIA 3BRGC 3Q7XA 5FZZA 4HA2A 4MZGB 2UUSA 4G1RA 3FJJA 3E8LC 1HWMB 1TWMA 1E0OA 4ZFUB 3AZVA 2K43A 2HWAA 1BFCA 1Q1UA 2E4MA 1JLYA 1S0CA 2BFHA 2F8XC 2R9KB 1DFQA 3P6IA 1EPWA 4JP0A 4I7IA 4I4XA 2NS2A 3CRIA 4J2KA 3RSJA 4QD2B 1XYFA 1T9FA 4X3AA 1BFBA 2E4MC
chains in the Genus database with same CATH topology
1S0DA 4ISRA 3BA7A 5EC5A 1Z2VA 1HWNB 3LTQA 5BVPI 1WBAA 3FJDA 4J23B 1HWPB 4QO3A 2VSAA 3PUBA 4A7KA 3SNVA 4KEKA 5I1BA 1YYNA 4G6MA 4GAIA 1G9AA 3A21A 4OWLA 3BAQA 3UD7A 4I1EA 1Z4SA 4IY8A 2D1ZA 1YBIA 3R4SA 1BLDA 2K4AB 3QYDA 2KKIA 2ZQOA 3ZXGA 3S8JA 1VCLA 1IHKA 3NJ5A 2D7RA 1WBCA 2FO1A 2RSTA 1XZZA 2D23A 3Q7WA 4EFRA 1RY7A 4OEEA 3CRGA 3MPPG 3UD8A 1TIEA 1FMZA 1K5UA 2P39A 3FUQA 1FGAA 4D0TA 3D7WB 4I96A 1ISWA 2HZ9A 1HIBA 3KMVA 4USPA 4MZHA 1IILA 4EFQA 3AJ6A 4DENA 2HWMA 3AKFA 3IM6A 4GOYA 3ZX7A 3IIRA 1ITBA 1QXMA 3C9ZA 4KEJA 3BAVA 3CA6A 3K1XA 3OBRA 2Z49A 4QD2C 2I1BA 3A23A 1N4KA 2KI6B 3I2XA 4QALA 1SZ6B 4GP3A 1JY0A 4IONA 1SR4C 3WO3A 1CE7B 2ERMA 4P0JA 4FGFA 2WRYA 3I29B 3CAHA 4ENDA 3AKGA 3TC2A 3OGFA 4ZBVB 1S0EA 2D7IA 3CA5A 4H04A 2P23A 3CA0A 4Q91A 3VSZA 3MALA 3QR5A 4I4QA 4QBCA 4WBCA 1AVUA 3BAGA 3VT0A 3VWCA 2FFVA 1EYLA 3HALA 2VSEA 4I4RA 1OQLB 3FJ9A 5DSSB 2J3PA 4ZA3B 2YUGA 3FJHA 4ZKTB 2Q3NB 1R8OA 4OWKA 1M16A 4QC4A 3BX1C 5FZYA 2Y9GA 1V6WA 1CVSA 3ILAA 4DCKC 1JTCA 3R4UA 4X38A 3P53A 5F8SA 1RZOB 3I2AA 4OWJA 5D61A 3UD9A 1QQLA 3NBCA 5F8WA 3RMYA 1EVTA 5DUYA 1DQOA 4JRAA 3FFZA 2ZR1B 4MZFB 2ET2A 3OJVA 4I4OA 1IT0A 4OW4A 3BRFA 4P6AA 1P63A 4QBVA 2LIEA 4EKXB 3FUOA 2VLCA 1T4QA 2ZQNA 2GO2A 4IYBA 4H9WA 3JUTA 3A22A 4P0LA 1WD4A 4Q9PA 4ZOTA 3AH1A 1NUNA 3O4CA 3HOMA 1FV2A 5HPZA 2ESUA 2KLLA 1I1EA 3VSFA 4JKXB 2MIBA 1G9CA 2D22A 5JLVA 4L4IA 1JT7A 2FFUA 1AF9A 1I1BA 2HW9A 4G9NA 3OGGA 2D24A 1F31A 2GZBA 4EB2B 2QN4A 1UPSA 3F62B 2IWTB 3FJAA 2Y9FA 5F90A 2X2SA 3BA4A 1RG8A 1AXMA 3WINA 5BP5A 4I1BA 1JT3A 2FGFA 5E24E 4IZEA 4I2SA 4Q9GA 4Z8SB 1DIWA 1YTOA 3O44A 2AXMA 2Y9WC 3B9UA 4LO3A 4J2SA 2M49A 3CA4A 2IHOA 4GP0A 4I4PA 3O4OA 3UDAA 3WINC 5BP5C 1YXWA 2VU9A 3H6RA 4PC4A 3BTAA 4X37A 4JAWA 4LO3C 1DZDA 1BA7A 1FQ9A 1GGPB 2Q9XA 4KEIA 1WD3A 3FJ8A 2RG9B 3NBEA 1JLXA 3OJ2A 5B2HA 3IM7A 4I8MA 1YF8B 1G9BA 3O4DA 4F83A 4JQ0A 3ZC9A 1ONKB 3HSMA 4IY9A 3POKA 3FJBA 5BXRA 1FWUA 5DVHA 4ZGRB 2LIQA 1W3FA 1PWAA 5EG6C 1AVXB 1K5VA 3AZWA 1ISVA 4IZXA 1G82A 4JPZA 2DRZA 3ZC8A 2WBCA 4J2XA 3V0BB 1TFMB 2MLLB 4KBBA 3WA1A 4EEEB 1HCDA 4GOVA 3FJIA 2L5XA 1BARA 3UJ0A 2NTDA 1BLAA 3LLPA 4I4UA 1S0FA 4AN7B 4D8HA 4XFTA 4II0A 3BAUA 4OUJA 1V6XA 5D62A 3WO4A 1EV2A 3N7KA 4OEGA 2AAIB 1HWOB 1V6VA 1TTUA 4GAFA 2DRYA 3RTIB 4XFUA 1IOBA 3NBNA 3W9TA 3BA5A 2NYYA 4I3NA 2NP0A 21BIA 1Q03A 3CU1B 4A7YA 5FZUA 1TOOA 3VUOA 1J0SA 1AVAC 4R6UB 1S0GA 3O4BA 2BEBA 2D44A 1DLLA 3BB2A 2DS0A 4ZFYB 3H6RB 3WMVA 4H75A 3V0BA 2RQ9A 5BOWA 3CRHA 5G00A 1AVWB 2QYIB 3BADA 2KH2A 7I1BA 4LO2A 4F34A 1IJTA 2D43A 2DREA 1FMMS 3P6JA 1II4A 2D20A 5F8YA 4I4SA 1ABRB 1DZCA 4IHZA 3V79C 2XOAA 3PG0A 4LO2C 4ZFWB 4UY4A 1TWEA 4J2YA 3VT2A 2K8RA 3HN1A 4LO7B 2MC2A 41BIA 8I1BA 4LO0A 2NM1A 5FNXA 4ZLBB 3Q7YA 1IRAX 4HR6C 3WO2A 4I4VA 1IRPA 3S8KA 1XG6A 1L2HA 1W3GA 3O3QA 3FJFA 5BXPA 3JRRA 4JKQA 3BRDA 4FVVA 5BQUA 1FN0A 1ISYA 4I6IA 5EHAA 4LO0C 1MC9A 4EFPA 1PC8B 3ZXDA 3V0AB 1JQZA 3N0KA 3RMXA 4A7ZA 6I1BA 1BASA 1AFCA 1DJSB 3WMUA 3PMEA 3F1RA 3H6SE 2AQZA 1TP0A 3AH2A 3T8SA 3HBWA 4XFSA 5BQUC 3UJ4A 1W3AA 4CJMA 4D0ZA 1RMLA 4I4YA 1PUUB 3O4AA 2FDBM 1FV3A 4USOA 1PUMB 1XHBA 1FWVA 4G6JA 1ISZA 4LO1A 4QKSA 3FJKA 4LO8B 5GAQA 1PZZA 3VEQA 1S0LA 4I37A 3RTJB 1Q04A 2VXTI 2F2FA 1SR4A 1V6UA 3FGMA 4P0KA 4IQPA 9ILBA 3FJCA 5BXSA 5FNWA 1ISXA 3CQAA 4LO1C 2X2TA 2VUAA 1BFGA 4Z9WB 4OEFA 2F2FC 4I0YA 4LO7C 4TLPA 3CA1A 3VT1A 3IAGC 3N7MA 2Z48A 1A8DA 3V0AA 2KI4A 3BAHA 1DQGA 3AJ5A 1KNMA 2AFGA 1JT4A 4G9MA 1G9DA 2VXRA 5D63A 3A07A 3AH4A 5DZUA 1BFFA 1JT5A 4QKRA 3N7LA 3OBTA 3O49A 3H6QA 4HJJA 2NZ9A 1R8NA 4X39A 3N7JA 3PHZA 1ILR1 5JMCA 1MD6A 1QQKA 1S0BA 3FJEA 5BXTA 4DEPA 1M2TB 3AKIA 3NBDA 1Z0HA 1D0HA 2NVHA 31BIA 3IM5A 3OJMA 4YOLA 2BEAA 4KC3A 1NZKA 3HMYA 3O5WB 1HKNA 3BAOA 1DFCA 3CA3A 3EF2A 2Y9XE 3AKHA 4ISQA 4L4HA 4AN6A 1HCEA 4XKIA 3BRGC 3Q7XA 5FZZA 4HA2A 4MZGB 2UUSA 4G1RA 3FJJA 3E8LC 1HWMB 1TWMA 1E0OA 4ZFUB 3AZVA 2K43A 2HWAA 1BFCA 1Q1UA 2E4MA 1JLYA 1S0CA 2BFHA 2F8XC 2R9KB 1DFQA 3P6IA 1EPWA 4JP0A 4I7IA 4I4XA 2NS2A 3CRIA 4J2KA 3RSJA 4QD2B 1XYFA 1T9FA 4X3AA 1BFBA 2E4MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0D A;  4ISR A;  3BA7 A;  5EC5 A;  1Z2V A;  1HWN B;  3LTQ A;  5BVP I;  1WBA A;  3FJD A;  4J23 B;  1HWP B;  4QO3 A;  2VSA A;  3PUB A;  4A7K A;  3SNV A;  4KEK A;  5I1B A;  1YYN A;  4G6M A;  4GAI A;  1G9A A;  3A21 A;  4OWL A;  3BAQ A;  3UD7 A;  4I1E A;  1Z4S A;  4IY8 A;  2D1Z A;  1YBI A;  3R4S A;  1BLD A;  2K4A B;  3QYD A;  2KKI A;  2ZQO A;  3ZXG A;  3S8J A;  1VCL A;  1IHK A;  3NJ5 A;  2D7R A;  1WBC A;  2FO1 A;  2RST A;  1XZZ A;  2D23 A;  3Q7W A;  4EFR A;  1RY7 A;  4OEE A;  3CRG A;  3MPP G;  3UD8 A;  1TIE A;  1FMZ A;  1K5U A;  2P39 A;  3FUQ A;  1FGA A;  4D0T A;  3D7W B;  4I96 A;  1ISW A;  2HZ9 A;  1HIB A;  3KMV A;  4USP A;  1IIL A;  4EFQ A;  3AJ6 A;  4DEN A;  2HWM A;  3AKF A;  3IM6 A;  4GOY A;  3ZX7 A;  3IIR A;  1ITB A;  1QXM A;  3C9Z A;  4KEJ A;  3BAV A;  3CA6 A;  3K1X A;  3OBR A;  2Z49 A;  4QD2 C;  2I1B A;  3A23 A;  1N4K A;  2KI6 B;  3I2X A;  4QAL A;  1SZ6 B;  4GP3 A;  1JY0 A;  4ION A;  1SR4 C;  3WO3 A;  1CE7 B;  2ERM A;  4P0J A;  4FGF A;  2WRY A;  3I29 B;  3CAH A;  4END A;  3AKG A;  3TC2 A;  3OGF A;  4ZBV B;  1S0E A;  2D7I A;  3CA5 A;  4H04 A;  2P23 A;  3CA0 A;  4Q91 A;  3VSZ A;  3MAL A;  3QR5 A;  4I4Q A;  4QBC A;  4WBC A;  1AVU A;  3BAG A;  3VT0 A;  3VWC A;  2FFV A;  1EYL A;  3HAL A;  2VSE A;  4I4R A;  1OQL B;  3FJ9 A;  5DSS B;  2J3P A;  4ZA3 B;  2YUG A;  3FJH A;  4ZKT B;  2Q3N B;  1R8O A;  4OWK A;  1M16 A;  4QC4 A;  3BX1 C;  5FZY A;  2Y9G A;  1V6W A;  1CVS A;  3ILA A;  4DCK C;  1JTC A;  3R4U A;  4X38 A;  3P53 A;  5F8S A;  1RZO B;  3I2A A;  4OWJ A;  5D61 A;  3UD9 A;  1QQL A;  3NBC A;  5F8W A;  3RMY A;  1EVT A;  5DUY A;  1DQO A;  4JRA A;  3FFZ A;  2ZR1 B;  2ET2 A;  3OJV A;  4I4O A;  1IT0 A;  4OW4 A;  3BRF A;  4P6A A;  1P63 A;  4QBV A;  2LIE A;  4EKX B;  3FUO A;  2VLC A;  1T4Q A;  2ZQN A;  2GO2 A;  4IYB A;  4H9W A;  3JUT A;  3A22 A;  4P0L A;  1WD4 A;  4Q9P A;  4ZOT A;  3AH1 A;  1NUN A;  3O4C A;  3HOM A;  1FV2 A;  5HPZ A;  2ESU A;  2KLL A;  1I1E A;  3VSF A;  4JKX B;  2MIB A;  1G9C A;  2D22 A;  5JLV A;  4L4I A;  1JT7 A;  2FFU A;  1AF9 A;  1I1B A;  2HW9 A;  4G9N A;  3OGG A;  2D24 A;  1F31 A;  2GZB A;  4EB2 B;  2QN4 A;  1UPS A;  3F62 B;  2IWT B;  3FJA A;  2Y9F A;  5F90 A;  2X2S A;  3BA4 A;  1RG8 A;  1AXM A;  3WIN A;  5BP5 A;  4I1B A;  1JT3 A;  2FGF A;  5E24 E;  4IZE A;  4I2S A;  4Q9G A;  4Z8S B;  1DIW A;  1YTO A;  3O44 A;  2AXM A;  2Y9W C;  3B9U A;  4LO3 A;  4J2S A;  2M49 A;  3CA4 A;  2IHO A;  4GP0 A;  4I4P A;  3O4O A;  3UDA A;  3WIN C;  5BP5 C;  1YXW A;  2VU9 A;  3H6R A;  4PC4 A;  3BTA A;  4X37 A;  4JAW A;  4LO3 C;  1DZD A;  1BA7 A;  1FQ9 A;  1GGP B;  2Q9X A;  4KEI A;  1WD3 A;  3FJ8 A;  2RG9 B;  3NBE A;  1JLX A;  3OJ2 A;  5B2H A;  3IM7 A;  4I8M A;  1YF8 B;  1G9B A;  3O4D A;  4F83 A;  4JQ0 A;  3ZC9 A;  1ONK B;  3HSM A;  4IY9 A;  3POK A;  3FJB A;  5BXR A;  1FWU A;  5DVH A;  4ZGR B;  2LIQ A;  1W3F A;  1PWA A;  5EG6 C;  1AVX B;  1K5V A;  3AZW A;  1ISV A;  4IZX A;  1G82 A;  4JPZ A;  2DRZ A;  3ZC8 A;  2WBC A;  4J2X A;  3V0B B;  1TFM B;  2MLL B;  4KBB A;  3WA1 A;  4EEE B;  1HCD A;  4GOV A;  3FJI A;  2L5X A;  1BAR A;  3UJ0 A;  2NTD A;  1BLA A;  3LLP A;  4I4U A;  1S0F A;  4AN7 B;  4D8H A;  4XFT A;  4II0 A;  3BAU A;  4OUJ A;  1V6X A;  5D62 A;  3WO4 A;  1EV2 A;  3N7K A;  4OEG A;  2AAI B;  1HWO B;  1V6V A;  1TTU A;  4GAF A;  2DRY A;  3RTI B;  4XFU A;  1IOB A;  3NBN A;  3W9T A;  3BA5 A;  2NYY A;  4I3N A;  2NP0 A;  21BI A;  1Q03 A;  3CU1 B;  4A7Y A;  5FZU A;  1TOO A;  3VUO A;  1J0S A;  1AVA C;  4R6U B;  1S0G A;  3O4B A;  2BEB A;  2D44 A;  1DLL A;  3BB2 A;  2DS0 A;  4ZFY B;  3H6R B;  3WMV A;  3V0B A;  2RQ9 A;  5BOW A;  3CRH A;  5G00 A;  1AVW B;  2QYI B;  3BAD A;  2KH2 A;  7I1B A;  4LO2 A;  4F34 A;  1IJT A;  2D43 A;  2DRE A;  1FMM S;  3P6J A;  1II4 A;  2D20 A;  5F8Y A;  4I4S A;  1ABR B;  1DZC A;  4IHZ A;  3V79 C;  2XOA A;  3PG0 A;  4LO2 C;  4ZFW B;  1TWE A;  4J2Y A;  3VT2 A;  2K8R A;  3HN1 A;  4LO7 B;  2MC2 A;  41BI A;  8I1B A;  4LO0 A;  2NM1 A;  5FNX A;  4ZLB B;  3Q7Y A;  1IRA X;  4HR6 C;  3WO2 A;  4I4V A;  1IRP A;  3S8K A;  1XG6 A;  1L2H A;  1W3G A;  3O3Q A;  3FJF A;  5BXP A;  3JRR A;  4JKQ A;  3BRD A;  4FVV A;  5BQU A;  1FN0 A;  1ISY A;  4I6I A;  5EHA A;  4LO0 C;  1MC9 A;  4EFP A;  1PC8 B;  3ZXD A;  3V0A B;  1JQZ A;  3N0K A;  3RMX A;  4A7Z A;  6I1B A;  1BAS A;  1AFC A;  1DJS B;  3WMU A;  3PME A;  3F1R A;  3H6S E;  2AQZ A;  1TP0 A;  3AH2 A;  3T8S A;  3HBW A;  4XFS A;  5BQU C;  3UJ4 A;  1W3A A;  4CJM A;  4D0Z A;  1RML A;  4I4Y A;  1PUU B;  3O4A A;  2FDB M;  1FV3 A;  4USO A;  1PUM B;  1XHB A;  1FWV A;  4G6J A;  1ISZ A;  4LO1 A;  4QKS A;  3FJK A;  4LO8 B;  5GAQ A;  1PZZ A;  3VEQ A;  1S0L A;  4I37 A;  3RTJ B;  1Q04 A;  2VXT I;  2F2F A;  1SR4 A;  1V6U A;  3FGM A;  4P0K A;  4IQP A;  9ILB A;  3FJC A;  5BXS A;  5FNW A;  1ISX A;  3CQA A;  4LO1 C;  2X2T A;  2VUA A;  1BFG A;  4Z9W B;  4OEF A;  2F2F C;  4I0Y A;  4LO7 C;  4TLP A;  3CA1 A;  3VT1 A;  3IAG C;  3N7M A;  2Z48 A;  1A8D A;  3V0A A;  2KI4 A;  3BAH A;  1DQG A;  3AJ5 A;  1KNM A;  2AFG A;  1JT4 A;  4G9M A;  1G9D A;  2VXR A;  5D63 A;  3A07 A;  3AH4 A;  5DZU A;  1BFF A;  1JT5 A;  4QKR A;  3N7L A;  3OBT A;  3O49 A;  3H6Q A;  4HJJ A;  2NZ9 A;  1R8N A;  4X39 A;  3N7J A;  3PHZ A;  1ILR 1;  5JMC A;  1MD6 A;  1QQK A;  1S0B A;  3FJE A;  5BXT A;  4DEP A;  1M2T B;  3AKI A;  3NBD A;  1Z0H A;  1D0H A;  2NVH A;  31BI A;  3IM5 A;  3OJM A;  4YOL A;  2BEA A;  4KC3 A;  1NZK A;  3HMY A;  3O5W B;  1HKN A;  3BAO A;  1DFC A;  3CA3 A;  3EF2 A;  2Y9X E;  3AKH A;  4ISQ A;  4L4H A;  4AN6 A;  1HCE A;  4XKI A;  3BRG C;  3Q7X A;  5FZZ A;  4HA2 A;  2UUS A;  4G1R A;  3FJJ A;  3E8L C;  1HWM B;  1TWM A;  1E0O A;  4ZFU B;  3AZV A;  2K43 A;  2HWA A;  1BFC A;  1Q1U A;  2E4M A;  1JLY A;  1S0C A;  2BFH A;  2F8X C;  2R9K B;  1DFQ A;  3P6I A;  1EPW A;  4JP0 A;  4I7I A;  4I4X A;  3CRI A;  4J2K A;  3RSJ A;  4QD2 B;  1XYF A;  1T9F A;  4X3A A;  1BFB A;  2E4M C; 
#chains in the Genus database with same CATH topology
 1S0D A;  4ISR A;  3BA7 A;  5EC5 A;  1Z2V A;  1HWN B;  3LTQ A;  5BVP I;  1WBA A;  3FJD A;  4J23 B;  1HWP B;  4QO3 A;  2VSA A;  3PUB A;  4A7K A;  3SNV A;  4KEK A;  5I1B A;  1YYN A;  4G6M A;  4GAI A;  1G9A A;  3A21 A;  4OWL A;  3BAQ A;  3UD7 A;  4I1E A;  1Z4S A;  4IY8 A;  2D1Z A;  1YBI A;  3R4S A;  1BLD A;  2K4A B;  3QYD A;  2KKI A;  2ZQO A;  3ZXG A;  3S8J A;  1VCL A;  1IHK A;  3NJ5 A;  2D7R A;  1WBC A;  2FO1 A;  2RST A;  1XZZ A;  2D23 A;  3Q7W A;  4EFR A;  1RY7 A;  4OEE A;  3CRG A;  3MPP G;  3UD8 A;  1TIE A;  1FMZ A;  1K5U A;  2P39 A;  3FUQ A;  1FGA A;  4D0T A;  3D7W B;  4I96 A;  1ISW A;  2HZ9 A;  1HIB A;  3KMV A;  4USP A;  4MZH A;  1IIL A;  4EFQ A;  3AJ6 A;  4DEN A;  2HWM A;  3AKF A;  3IM6 A;  4GOY A;  3ZX7 A;  3IIR A;  1ITB A;  1QXM A;  3C9Z A;  4KEJ A;  3BAV A;  3CA6 A;  3K1X A;  3OBR A;  2Z49 A;  4QD2 C;  2I1B A;  3A23 A;  1N4K A;  2KI6 B;  3I2X A;  4QAL A;  1SZ6 B;  4GP3 A;  1JY0 A;  4ION A;  1SR4 C;  3WO3 A;  1CE7 B;  2ERM A;  4P0J A;  4FGF A;  2WRY A;  3I29 B;  3CAH A;  4END A;  3AKG A;  3TC2 A;  3OGF A;  4ZBV B;  1S0E A;  2D7I A;  3CA5 A;  4H04 A;  2P23 A;  3CA0 A;  4Q91 A;  3VSZ A;  3MAL A;  3QR5 A;  4I4Q A;  4QBC A;  4WBC A;  1AVU A;  3BAG A;  3VT0 A;  3VWC A;  2FFV A;  1EYL A;  3HAL A;  2VSE A;  4I4R A;  1OQL B;  3FJ9 A;  5DSS B;  2J3P A;  4ZA3 B;  2YUG A;  3FJH A;  4ZKT B;  2Q3N B;  1R8O A;  4OWK A;  1M16 A;  4QC4 A;  3BX1 C;  5FZY A;  2Y9G A;  1V6W A;  1CVS A;  3ILA A;  4DCK C;  1JTC A;  3R4U A;  4X38 A;  3P53 A;  5F8S A;  1RZO B;  3I2A A;  4OWJ A;  5D61 A;  3UD9 A;  1QQL A;  3NBC A;  5F8W A;  3RMY A;  1EVT A;  5DUY A;  1DQO A;  4JRA A;  3FFZ A;  2ZR1 B;  4MZF B;  2ET2 A;  3OJV A;  4I4O A;  1IT0 A;  4OW4 A;  3BRF A;  4P6A A;  1P63 A;  4QBV A;  2LIE A;  4EKX B;  3FUO A;  2VLC A;  1T4Q A;  2ZQN A;  2GO2 A;  4IYB A;  4H9W A;  3JUT A;  3A22 A;  4P0L A;  1WD4 A;  4Q9P A;  4ZOT A;  3AH1 A;  1NUN A;  3O4C A;  3HOM A;  1FV2 A;  5HPZ A;  2ESU A;  2KLL A;  1I1E A;  3VSF A;  4JKX B;  2MIB A;  1G9C A;  2D22 A;  5JLV A;  4L4I A;  1JT7 A;  2FFU A;  1AF9 A;  1I1B A;  2HW9 A;  4G9N A;  3OGG A;  2D24 A;  1F31 A;  2GZB A;  4EB2 B;  2QN4 A;  1UPS A;  3F62 B;  2IWT B;  3FJA A;  2Y9F A;  5F90 A;  2X2S A;  3BA4 A;  1RG8 A;  1AXM A;  3WIN A;  5BP5 A;  4I1B A;  1JT3 A;  2FGF A;  5E24 E;  4IZE A;  4I2S A;  4Q9G A;  4Z8S B;  1DIW A;  1YTO A;  3O44 A;  2AXM A;  2Y9W C;  3B9U A;  4LO3 A;  4J2S A;  2M49 A;  3CA4 A;  2IHO A;  4GP0 A;  4I4P A;  3O4O A;  3UDA A;  3WIN C;  5BP5 C;  1YXW A;  2VU9 A;  3H6R A;  4PC4 A;  3BTA A;  4X37 A;  4JAW A;  4LO3 C;  1DZD A;  1BA7 A;  1FQ9 A;  1GGP B;  2Q9X A;  4KEI A;  1WD3 A;  3FJ8 A;  2RG9 B;  3NBE A;  1JLX A;  3OJ2 A;  5B2H A;  3IM7 A;  4I8M A;  1YF8 B;  1G9B A;  3O4D A;  4F83 A;  4JQ0 A;  3ZC9 A;  1ONK B;  3HSM A;  4IY9 A;  3POK A;  3FJB A;  5BXR A;  1FWU A;  5DVH A;  4ZGR B;  2LIQ A;  1W3F A;  1PWA A;  5EG6 C;  1AVX B;  1K5V A;  3AZW A;  1ISV A;  4IZX A;  1G82 A;  4JPZ A;  2DRZ A;  3ZC8 A;  2WBC A;  4J2X A;  3V0B B;  1TFM B;  2MLL B;  4KBB A;  3WA1 A;  4EEE B;  1HCD A;  4GOV A;  3FJI A;  2L5X A;  1BAR A;  3UJ0 A;  2NTD A;  1BLA A;  3LLP A;  4I4U A;  1S0F A;  4AN7 B;  4D8H A;  4XFT A;  4II0 A;  3BAU A;  4OUJ A;  1V6X A;  5D62 A;  3WO4 A;  1EV2 A;  3N7K A;  4OEG A;  2AAI B;  1HWO B;  1V6V A;  1TTU A;  4GAF A;  2DRY A;  3RTI B;  4XFU A;  1IOB A;  3NBN A;  3W9T A;  3BA5 A;  2NYY A;  4I3N A;  2NP0 A;  21BI A;  1Q03 A;  3CU1 B;  4A7Y A;  5FZU A;  1TOO A;  3VUO A;  1J0S A;  1AVA C;  4R6U B;  1S0G A;  3O4B A;  2BEB A;  2D44 A;  1DLL A;  3BB2 A;  2DS0 A;  4ZFY B;  3H6R B;  3WMV A;  4H75 A;  3V0B A;  2RQ9 A;  5BOW A;  3CRH A;  5G00 A;  1AVW B;  2QYI B;  3BAD A;  2KH2 A;  7I1B A;  4LO2 A;  4F34 A;  1IJT A;  2D43 A;  2DRE A;  1FMM S;  3P6J A;  1II4 A;  2D20 A;  5F8Y A;  4I4S A;  1ABR B;  1DZC A;  4IHZ A;  3V79 C;  2XOA A;  3PG0 A;  4LO2 C;  4ZFW B;  4UY4 A;  1TWE A;  4J2Y A;  3VT2 A;  2K8R A;  3HN1 A;  4LO7 B;  2MC2 A;  41BI A;  8I1B A;  4LO0 A;  2NM1 A;  5FNX A;  4ZLB B;  3Q7Y A;  1IRA X;  4HR6 C;  3WO2 A;  4I4V A;  1IRP A;  3S8K A;  1XG6 A;  1L2H A;  1W3G A;  3O3Q A;  3FJF A;  5BXP A;  3JRR A;  4JKQ A;  3BRD A;  4FVV A;  5BQU A;  1FN0 A;  1ISY A;  4I6I A;  5EHA A;  4LO0 C;  1MC9 A;  4EFP A;  1PC8 B;  3ZXD A;  3V0A B;  1JQZ A;  3N0K A;  3RMX A;  4A7Z A;  6I1B A;  1BAS A;  1AFC A;  1DJS B;  3WMU A;  3PME A;  3F1R A;  3H6S E;  2AQZ A;  1TP0 A;  3AH2 A;  3T8S A;  3HBW A;  4XFS A;  5BQU C;  3UJ4 A;  1W3A A;  4CJM A;  4D0Z A;  1RML A;  4I4Y A;  1PUU B;  3O4A A;  2FDB M;  1FV3 A;  4USO A;  1PUM B;  1XHB A;  1FWV A;  4G6J A;  1ISZ A;  4LO1 A;  4QKS A;  3FJK A;  4LO8 B;  5GAQ A;  1PZZ A;  3VEQ A;  1S0L A;  4I37 A;  3RTJ B;  1Q04 A;  2VXT I;  2F2F A;  1SR4 A;  1V6U A;  3FGM A;  4P0K A;  4IQP A;  9ILB A;  3FJC A;  5BXS A;  5FNW A;  1ISX A;  3CQA A;  4LO1 C;  2X2T A;  2VUA A;  1BFG A;  4Z9W B;  4OEF A;  2F2F C;  4I0Y A;  4LO7 C;  4TLP A;  3CA1 A;  3VT1 A;  3IAG C;  3N7M A;  2Z48 A;  1A8D A;  3V0A A;  2KI4 A;  3BAH A;  1DQG A;  3AJ5 A;  1KNM A;  2AFG A;  1JT4 A;  4G9M A;  1G9D A;  2VXR A;  5D63 A;  3A07 A;  3AH4 A;  5DZU A;  1BFF A;  1JT5 A;  4QKR A;  3N7L A;  3OBT A;  3O49 A;  3H6Q A;  4HJJ A;  2NZ9 A;  1R8N A;  4X39 A;  3N7J A;  3PHZ A;  1ILR 1;  5JMC A;  1MD6 A;  1QQK A;  1S0B A;  3FJE A;  5BXT A;  4DEP A;  1M2T B;  3AKI A;  3NBD A;  1Z0H A;  1D0H A;  2NVH A;  31BI A;  3IM5 A;  3OJM A;  4YOL A;  2BEA A;  4KC3 A;  1NZK A;  3HMY A;  3O5W B;  1HKN A;  3BAO A;  1DFC A;  3CA3 A;  3EF2 A;  2Y9X E;  3AKH A;  4ISQ A;  4L4H A;  4AN6 A;  1HCE A;  4XKI A;  3BRG C;  3Q7X A;  5FZZ A;  4HA2 A;  4MZG B;  2UUS A;  4G1R A;  3FJJ A;  3E8L C;  1HWM B;  1TWM A;  1E0O A;  4ZFU B;  3AZV A;  2K43 A;  2HWA A;  1BFC A;  1Q1U A;  2E4M A;  1JLY A;  1S0C A;  2BFH A;  2F8X C;  2R9K B;  1DFQ A;  3P6I A;  1EPW A;  4JP0 A;  4I7I A;  4I4X A;  2NS2 A;  3CRI A;  4J2K A;  3RSJ A;  4QD2 B;  1XYF A;  1T9F A;  4X3A A;  1BFB A;  2E4M C; 
#chains in the Genus database with same CATH homology
 1S0D A;  4ISR A;  3BA7 A;  5EC5 A;  1Z2V A;  1HWN B;  3LTQ A;  5BVP I;  1WBA A;  3FJD A;  4J23 B;  1HWP B;  4QO3 A;  2VSA A;  3PUB A;  4A7K A;  3SNV A;  4KEK A;  5I1B A;  1YYN A;  4G6M A;  4GAI A;  1G9A A;  3A21 A;  4OWL A;  3BAQ A;  3UD7 A;  4I1E A;  1Z4S A;  4IY8 A;  2D1Z A;  1YBI A;  3R4S A;  1BLD A;  2K4A B;  3QYD A;  2KKI A;  2ZQO A;  3ZXG A;  3S8J A;  1VCL A;  1IHK A;  3NJ5 A;  2D7R A;  1WBC A;  2FO1 A;  2RST A;  1XZZ A;  2D23 A;  3Q7W A;  4EFR A;  1RY7 A;  4OEE A;  3CRG A;  3MPP G;  3UD8 A;  1TIE A;  1FMZ A;  1K5U A;  2P39 A;  3FUQ A;  1FGA A;  4D0T A;  3D7W B;  4I96 A;  1ISW A;  2HZ9 A;  1HIB A;  3KMV A;  4USP A;  4MZH A;  1IIL A;  4EFQ A;  3AJ6 A;  4DEN A;  2HWM A;  3AKF A;  3IM6 A;  4GOY A;  3ZX7 A;  3IIR A;  1ITB A;  1QXM A;  3C9Z A;  4KEJ A;  3BAV A;  3CA6 A;  3K1X A;  3OBR A;  2Z49 A;  4QD2 C;  2I1B A;  3A23 A;  1N4K A;  2KI6 B;  3I2X A;  4QAL A;  1SZ6 B;  4GP3 A;  1JY0 A;  4ION A;  1SR4 C;  3WO3 A;  1CE7 B;  2ERM A;  4P0J A;  4FGF A;  2WRY A;  3I29 B;  3CAH A;  4END A;  3AKG A;  3TC2 A;  3OGF A;  4ZBV B;  1S0E A;  2D7I A;  3CA5 A;  4H04 A;  2P23 A;  3CA0 A;  4Q91 A;  3VSZ A;  3MAL A;  3QR5 A;  4I4Q A;  4QBC A;  4WBC A;  1AVU A;  3BAG A;  3VT0 A;  3VWC A;  2FFV A;  1EYL A;  3HAL A;  2VSE A;  4I4R A;  1OQL B;  3FJ9 A;  5DSS B;  2J3P A;  4ZA3 B;  2YUG A;  3FJH A;  4ZKT B;  2Q3N B;  1R8O A;  4OWK A;  1M16 A;  4QC4 A;  3BX1 C;  5FZY A;  2Y9G A;  1V6W A;  1CVS A;  3ILA A;  4DCK C;  1JTC A;  3R4U A;  4X38 A;  3P53 A;  5F8S A;  1RZO B;  3I2A A;  4OWJ A;  5D61 A;  3UD9 A;  1QQL A;  3NBC A;  5F8W A;  3RMY A;  1EVT A;  5DUY A;  1DQO A;  4JRA A;  3FFZ A;  2ZR1 B;  4MZF B;  2ET2 A;  3OJV A;  4I4O A;  1IT0 A;  4OW4 A;  3BRF A;  4P6A A;  1P63 A;  4QBV A;  2LIE A;  4EKX B;  3FUO A;  2VLC A;  1T4Q A;  2ZQN A;  2GO2 A;  4IYB A;  4H9W A;  3JUT A;  3A22 A;  4P0L A;  1WD4 A;  4Q9P A;  4ZOT A;  3AH1 A;  1NUN A;  3O4C A;  3HOM A;  1FV2 A;  5HPZ A;  2ESU A;  2KLL A;  1I1E A;  3VSF A;  4JKX B;  2MIB A;  1G9C A;  2D22 A;  5JLV A;  4L4I A;  1JT7 A;  2FFU A;  1AF9 A;  1I1B A;  2HW9 A;  4G9N A;  3OGG A;  2D24 A;  1F31 A;  2GZB A;  4EB2 B;  2QN4 A;  1UPS A;  3F62 B;  2IWT B;  3FJA A;  2Y9F A;  5F90 A;  2X2S A;  3BA4 A;  1RG8 A;  1AXM A;  3WIN A;  5BP5 A;  4I1B A;  1JT3 A;  2FGF A;  5E24 E;  4IZE A;  4I2S A;  4Q9G A;  4Z8S B;  1DIW A;  1YTO A;  3O44 A;  2AXM A;  2Y9W C;  3B9U A;  4LO3 A;  4J2S A;  2M49 A;  3CA4 A;  2IHO A;  4GP0 A;  4I4P A;  3O4O A;  3UDA A;  3WIN C;  5BP5 C;  1YXW A;  2VU9 A;  3H6R A;  4PC4 A;  3BTA A;  4X37 A;  4JAW A;  4LO3 C;  1DZD A;  1BA7 A;  1FQ9 A;  1GGP B;  2Q9X A;  4KEI A;  1WD3 A;  3FJ8 A;  2RG9 B;  3NBE A;  1JLX A;  3OJ2 A;  5B2H A;  3IM7 A;  4I8M A;  1YF8 B;  1G9B A;  3O4D A;  4F83 A;  4JQ0 A;  3ZC9 A;  1ONK B;  3HSM A;  4IY9 A;  3POK A;  3FJB A;  5BXR A;  1FWU A;  5DVH A;  4ZGR B;  2LIQ A;  1W3F A;  1PWA A;  5EG6 C;  1AVX B;  1K5V A;  3AZW A;  1ISV A;  4IZX A;  1G82 A;  4JPZ A;  2DRZ A;  3ZC8 A;  2WBC A;  4J2X A;  3V0B B;  1TFM B;  2MLL B;  4KBB A;  3WA1 A;  4EEE B;  1HCD A;  4GOV A;  3FJI A;  2L5X A;  1BAR A;  3UJ0 A;  2NTD A;  1BLA A;  3LLP A;  4I4U A;  1S0F A;  4AN7 B;  4D8H A;  4XFT A;  4II0 A;  3BAU A;  4OUJ A;  1V6X A;  5D62 A;  3WO4 A;  1EV2 A;  3N7K A;  4OEG A;  2AAI B;  1HWO B;  1V6V A;  1TTU A;  4GAF A;  2DRY A;  3RTI B;  4XFU A;  1IOB A;  3NBN A;  3W9T A;  3BA5 A;  2NYY A;  4I3N A;  2NP0 A;  21BI A;  1Q03 A;  3CU1 B;  4A7Y A;  5FZU A;  1TOO A;  3VUO A;  1J0S A;  1AVA C;  4R6U B;  1S0G A;  3O4B A;  2BEB A;  2D44 A;  1DLL A;  3BB2 A;  2DS0 A;  4ZFY B;  3H6R B;  3WMV A;  4H75 A;  3V0B A;  2RQ9 A;  5BOW A;  3CRH A;  5G00 A;  1AVW B;  2QYI B;  3BAD A;  2KH2 A;  7I1B A;  4LO2 A;  4F34 A;  1IJT A;  2D43 A;  2DRE A;  1FMM S;  3P6J A;  1II4 A;  2D20 A;  5F8Y A;  4I4S A;  1ABR B;  1DZC A;  4IHZ A;  3V79 C;  2XOA A;  3PG0 A;  4LO2 C;  4ZFW B;  4UY4 A;  1TWE A;  4J2Y A;  3VT2 A;  2K8R A;  3HN1 A;  4LO7 B;  2MC2 A;  41BI A;  8I1B A;  4LO0 A;  2NM1 A;  5FNX A;  4ZLB B;  3Q7Y A;  1IRA X;  4HR6 C;  3WO2 A;  4I4V A;  1IRP A;  3S8K A;  1XG6 A;  1L2H A;  1W3G A;  3O3Q A;  3FJF A;  5BXP A;  3JRR A;  4JKQ A;  3BRD A;  4FVV A;  5BQU A;  1FN0 A;  1ISY A;  4I6I A;  5EHA A;  4LO0 C;  1MC9 A;  4EFP A;  1PC8 B;  3ZXD A;  3V0A B;  1JQZ A;  3N0K A;  3RMX A;  4A7Z A;  6I1B A;  1BAS A;  1AFC A;  1DJS B;  3WMU A;  3PME A;  3F1R A;  3H6S E;  2AQZ A;  1TP0 A;  3AH2 A;  3T8S A;  3HBW A;  4XFS A;  5BQU C;  3UJ4 A;  1W3A A;  4CJM A;  4D0Z A;  1RML A;  4I4Y A;  1PUU B;  3O4A A;  2FDB M;  1FV3 A;  4USO A;  1PUM B;  1XHB A;  1FWV A;  4G6J A;  1ISZ A;  4LO1 A;  4QKS A;  3FJK A;  4LO8 B;  5GAQ A;  1PZZ A;  3VEQ A;  1S0L A;  4I37 A;  3RTJ B;  1Q04 A;  2VXT I;  2F2F A;  1SR4 A;  1V6U A;  3FGM A;  4P0K A;  4IQP A;  9ILB A;  3FJC A;  5BXS A;  5FNW A;  1ISX A;  3CQA A;  4LO1 C;  2X2T A;  2VUA A;  1BFG A;  4Z9W B;  4OEF A;  2F2F C;  4I0Y A;  4LO7 C;  4TLP A;  3CA1 A;  3VT1 A;  3IAG C;  3N7M A;  2Z48 A;  1A8D A;  3V0A A;  2KI4 A;  3BAH A;  1DQG A;  3AJ5 A;  1KNM A;  2AFG A;  1JT4 A;  4G9M A;  1G9D A;  2VXR A;  5D63 A;  3A07 A;  3AH4 A;  5DZU A;  1BFF A;  1JT5 A;  4QKR A;  3N7L A;  3OBT A;  3O49 A;  3H6Q A;  4HJJ A;  2NZ9 A;  1R8N A;  4X39 A;  3N7J A;  3PHZ A;  1ILR 1;  5JMC A;  1MD6 A;  1QQK A;  1S0B A;  3FJE A;  5BXT A;  4DEP A;  1M2T B;  3AKI A;  3NBD A;  1Z0H A;  1D0H A;  2NVH A;  31BI A;  3IM5 A;  3OJM A;  4YOL A;  2BEA A;  4KC3 A;  1NZK A;  3HMY A;  3O5W B;  1HKN A;  3BAO A;  1DFC A;  3CA3 A;  3EF2 A;  2Y9X E;  3AKH A;  4ISQ A;  4L4H A;  4AN6 A;  1HCE A;  4XKI A;  3BRG C;  3Q7X A;  5FZZ A;  4HA2 A;  4MZG B;  2UUS A;  4G1R A;  3FJJ A;  3E8L C;  1HWM B;  1TWM A;  1E0O A;  4ZFU B;  3AZV A;  2K43 A;  2HWA A;  1BFC A;  1Q1U A;  2E4M A;  1JLY A;  1S0C A;  2BFH A;  2F8X C;  2R9K B;  1DFQ A;  3P6I A;  1EPW A;  4JP0 A;  4I7I A;  4I4X A;  2NS2 A;  3CRI A;  4J2K A;  3RSJ A;  4QD2 B;  1XYF A;  1T9F A;  4X3A A;  1BFB A;  2E4M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...