1QXMA

Crystal structure of a hemagglutinin component (ha1) from type c clostridium botulinum
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
283
structure length
283
Chain Sequence
TNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYISRNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HA1
publication title Structural analysis by X-ray crystallography and calorimetry of a haemagglutinin component (HA1) of the progenitor toxin from Clostridium botulinum.
pubmed doi rcsb
source organism Clostridium botulinum d phage
molecule tags Toxin
total genus 100
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1qxmA02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1qxmA01
3CRGA 5D61A 2X2TA 1IRAX 3P53A 4G1RA 4Z8SB 2E4MA 4LO1C 2FFVA 2D43A 21BIA 4ENDA 1HCDA 1AFCA 1WD3A 2D23A 3VT2A 3N0KA 4D0TA 1SZ6B 2LIQA 3V79C 3BB2A 1ITBA 4X38A 3E8LC 4ISRA 1HIBA 4PC4A 1BFGA 1PZZA 2VLCA 4USOA 4ZBVB 3R4SA 4H9WA 4QD2C 5BVPI 4XKIA 2F8XC 2XOAA 1JLYA 1CE7B 3AZVA 4JQ0A 3BAVA 3NBDA 2WRYA 1YYNA 3IM5A 5DZUA 5D63A 3O4CA 2DRZA 2AAIB 2D7RA 2FDBM 5EC5A 4I6IA 3CRIA 3NJ5A 4OUJA 2K4AB 3VSZA 5BP5A 3H6RB 2NYYA 1Q03A 3Q7YA 1AVAC 3FJ9A 3NBEA 4GAFA 5F90A 4I8MA 5BQUC 2ZQOA 4I4PA 3A07A 2QYIB 2RSTA 3FJEA 1YXWA 1TIEA 1E0OA 5BP5C 3WMVA 2D44A 1XHBA 3EF2A 3AKFA 3BAQA 3S8KA 4HR6C 3HMYA 5EG6C 3FJ8A 4I4OA 1R8OA 4I1EA 2DS0A 5BOWA 3CRHA 5B2HA 1Q1UA 5BXTA 2NTDA 2X2SA 3O4DA 4CJMA 1XZZA 3POKA 5FZZA 1AXMA 1PC8B 2FGFA 2AQZA 1QXMA 1JT5A 1FV2A 2I1BA 2VXTI 3HSMA 1PWAA 1WBCA 2LIEA 4ZOTA 4IHZA 1TWMA 4J2YA 1TP0A 4I4YA 1TWEA 3WO3A 4A7YA 4G9NA 2KH2A 4LO8B 1S0BA 1SR4C 2DRYA 2KKIA 3UD8A 1YF8B 4L4IA 1FMZA 3UJ0A 3CQAA 2D20A 1WD4A 4P6AA 3RMYA 4J2XA 1DFCA 4LO2C 5FNXA 2HW9A 2Y9WC 3W9TA 3ZX7A 4AN6A 3WINA 9ILBA 4LO7C 1JTCA 4J23B 1G9BA 3PHZA 4EEEB 4EFRA 3BADA 1V6UA 3BAOA 4LO3C 1IHKA 1FGAA 1RMLA 3A23A 1IRPA 3PG0A 4FGFA 4I96A 1D0HA 4G9MA 1FWUA 3WA1A 3FJJA 5D62A 4F83A 1JT4A 5EHAA 4ZGRB 4LO1A 1FV3A 3BA4A 3HOMA 3A21A 3D7WB 1TFMB 3S8JA 3VT1A 4J2KA 3AKGA 1RY7A 3I2XA 3HBWA 1BLDA 2KI6B 3WO4A 1FN0A 2ESUA 3O4BA 1BA7A 1ILR1 3FJCA 8I1BA 2RQ9A 3O4OA 1S0LA 2L5XA 41BIA 5FZYA 1N4KA 3AKHA 1XG6A 1IOBA 5BQUA 4GOYA 3O4AA 3RTIB 2FFUA 4DCKC 3JRRA 6I1BA 1KNMA 2GO2A 1DZDA 3BA5A 1YTOA 4I4UA 2FO1A 1AVXB 4I2SA 3NBCA 3MALA 2M49A 3AH1A 4ZFWB 3BRDA 1ONKB 1DIWA 3LTQA 5JMCA 3PUBA 3H6RA 2Y9FA 3O44A 5F8YA 1FWVA 3RTJB 4QKSA 3VSFA 3QYDA 1IT0A 3O49A 4JAWA 5FNWA 3BAUA 3O5WB 5DUYA 3UD9A 1F31A 2VSEA 3FJBA 1Z2VA 4ZFYB 4XFUA 2D24A 4USPA 2BFHA 31BIA 1WBAA 4L4HA 3FJIA 1BARA 4ISQA 3BRGC 3VEQA 1S0FA 1V6WA 1V6VA 4OEFA 2MC2A 4I37A 3OJVA 3LLPA 3FUQA 2D1ZA 1EPWA 4D8HA 4G6JA 1SR4A 1T4QA 1K5UA 1W3AA 1ABRB 4I4VA 3KMVA 3JUTA 4LO0C 4LO2A 5BXSA 3NBNA 2VXRA 1EVTA 4WBCA 3AH4A 4DEPA 4JKXB 3AJ5A 3OBRA 4QBVA 4P0KA 4I4QA 3ZXGA 3IM6A 2QN4A 3VUOA 2GZBA 1NZKA 4LO3A 3CA1A 2MLLB 4ZFUB 3BX1C 4HJJA 2AFGA 4GOVA 1HWPB 3FFZA 3V0AA 4XFSA 1S0CA 1EYLA 1HWOB 1QQKA 1I1EA 4ZLBB 1HCEA 1YBIA 4QO3A 5FZUA 4OWLA 3Q7XA 4HA2A 4OEEA 4R6UB 3CA0A 3N7JA 4I4RA 4I0YA 5E24E 4D0ZA 4GP0A 4QKRA 1W3FA 2R9KB 3V0BB 1Z4SA 1K5VA 3N7MA 2Z48A 4QALA 1JY0A 4H04A 3FJHA 5DSSB 3BRFA 3CA4A 3ILAA 5BXRA 3T8SA 1Q04A 4AN7B 4I3NA 1BFBA 3F1RA 1S0GA 3WMUA 2IWTB 3UD7A 3CU1B 3TC2A 4A7ZA 4OWKA 4JP0A 3PMEA 2NZ9A 3FUOA 1HWMB 1G9AA 4OEGA 3UDAA 3Q7WA 4QD2B 4ZA3B 1JQZA 2Q3NB 4G6MA 1HKNA 3H6SE 2BEAA 2NM1A 4KBBA 2BEBA 1AVUA 1MD6A 4Z9WB 1QQLA 1GGPB 1P63A 4IZEA 1A8DA 2P39A 2K8RA 3UJ4A 2AXMA 3RMXA 4FVVA 4ZKTB 4P0JA 3FJAA 1AVWB 4I4XA 3FJKA 3O3QA 2NP0A 3FJFA 5F8WA 4J2SA 3FJDA 1J0SA 4QC4A 2E4MC 1R8NA 4JRAA 1ISYA 2VSAA 1ISVA 3R4UA 7I1BA 3H6QA 1BLAA 1EV2A 1L2HA 4EB2B 3B9UA 2Y9XE 3CA5A 4P0LA 4EFPA 1Z0HA 4X39A 2WBCA 1TOOA 1JT7A 4KEIA 2UUSA 1DQGA 1S0EA 3VWCA 4F34A 2KI4A 1ISXA 1G9DA 3N7KA 5HPZA 3P6IA 4IY9A 3CAHA 2ZR1B 3K1XA 3C9ZA 3MPPG 1M16A 3OBTA 3OJ2A 4EFQA 2ERMA 2RG9B 3AKIA 4LO0A 5F8SA 3HALA 5GAQA 1JT3A 2Z49A 4KC3A 2DREA 3AJ6A 1CVSA 1IILA 4QBCA 3F62B 1VCLA 2MIBA 1BASA 2IHOA 1IJTA 2YUGA 3IIRA 1UPSA 2ET2A 1ISWA 4II0A 3P6JA 4I7IA 4KEJA 1G82A 2P23A 4TLPA 1MC9A 4JPZA 4YOLA 5I1BA 4OWJA 5DVHA 4X3AA 1PUUB 2HWMA 2HZ9A 3IAGC 2KLLA 3IM7A 4LO7B 3RSJA 2D22A 4KEKA 2D7IA 1S0DA 1T9FA 4IQPA 1V6XA 5JLVA 1FMMS 1M2TB 1RZOB 1JLXA 3BA7A 3FGMA 1BFFA 1XYFA 1DLLA 5BXPA 1ISZA 1RG8A 3OGGA 3ZC9A 3OGFA 4Q91A 4GAIA 1PUMB 2F2FA 4IONA 4IY8A 1DQOA 3QR5A 1II4A 3WO2A 3V0AB 1AF9A 1NUNA 3A22A 1TTUA 2Y9GA 3BAGA 4OW4A 3I29B 1FQ9A 3ZC8A 2K43A 3I2AA 4IZXA 3SNVA 3N7LA 1DJSB 4IYBA 2Q9XA 4X37A 3ZXDA 2F2FC 2J3PA 2VU9A 3OJMA 4Q9GA 1OQLB 4GP3A 4JKQA 4Q9PA 2VUAA 3V0BA 2ZQNA 1G9CA 3CA3A 1HWNB 3WINC 4DENA 4A7KA 3AZWA 1DFQA 1W3GA 1DZCA 4I4SA 3BTAA 5G00A 1I1BA 4XFTA 3HN1A 3AH2A 3VT0A 2NVHA 4I1BA 1BFCA 4EKXB 2HWAA 3BAHA 3CA6A
chains in the Genus database with same CATH superfamily
3CRGA 5D61A 2X2TA 1IRAX 3P53A 4G1RA 4Z8SB 2E4MA 4LO1C 2FFVA 2D43A 21BIA 4ENDA 1HCDA 1AFCA 1WD3A 2D23A 3VT2A 3N0KA 4D0TA 1SZ6B 2LIQA 3V79C 3BB2A 1ITBA 4X38A 3E8LC 4ISRA 1HIBA 4PC4A 1BFGA 1PZZA 2VLCA 4USOA 4ZBVB 3R4SA 4H9WA 4QD2C 5BVPI 4XKIA 2F8XC 2XOAA 1JLYA 1CE7B 3AZVA 4JQ0A 3BAVA 3NBDA 2WRYA 1YYNA 3IM5A 5DZUA 5D63A 3O4CA 2DRZA 2AAIB 2D7RA 2FDBM 5EC5A 4I6IA 3CRIA 3NJ5A 4OUJA 2K4AB 3VSZA 5BP5A 3H6RB 2NYYA 1Q03A 3Q7YA 1AVAC 3FJ9A 3NBEA 4GAFA 5F90A 4I8MA 5BQUC 2ZQOA 4I4PA 3A07A 2QYIB 2RSTA 3FJEA 1YXWA 1TIEA 1E0OA 5BP5C 3WMVA 2D44A 1XHBA 3EF2A 3AKFA 3BAQA 3S8KA 4HR6C 3HMYA 5EG6C 3FJ8A 4I4OA 1R8OA 4I1EA 2DS0A 5BOWA 3CRHA 5B2HA 1Q1UA 5BXTA 2NTDA 2X2SA 3O4DA 4CJMA 1XZZA 3POKA 5FZZA 1AXMA 1PC8B 2FGFA 2AQZA 1QXMA 1JT5A 1FV2A 2I1BA 2VXTI 3HSMA 1PWAA 1WBCA 2LIEA 4ZOTA 4IHZA 1TWMA 4J2YA 1TP0A 4I4YA 1TWEA 3WO3A 4A7YA 4G9NA 2KH2A 4LO8B 1S0BA 1SR4C 2DRYA 2KKIA 3UD8A 1YF8B 4L4IA 1FMZA 3UJ0A 3CQAA 2D20A 1WD4A 4P6AA 3RMYA 4J2XA 1DFCA 4LO2C 5FNXA 2HW9A 2Y9WC 3W9TA 3ZX7A 4AN6A 3WINA 9ILBA 4LO7C 1JTCA 4J23B 1G9BA 3PHZA 4EEEB 4EFRA 3BADA 1V6UA 3BAOA 4LO3C 1IHKA 1FGAA 1RMLA 3A23A 1IRPA 3PG0A 4FGFA 4I96A 1D0HA 4G9MA 1FWUA 3WA1A 3FJJA 5D62A 4F83A 1JT4A 5EHAA 4ZGRB 4LO1A 1FV3A 3BA4A 3HOMA 3A21A 3D7WB 1TFMB 3S8JA 3VT1A 4J2KA 3AKGA 1RY7A 3I2XA 3HBWA 1BLDA 2KI6B 3WO4A 1FN0A 2ESUA 3O4BA 1BA7A 1ILR1 3FJCA 8I1BA 2RQ9A 3O4OA 1S0LA 2L5XA 41BIA 5FZYA 1N4KA 3AKHA 1XG6A 1IOBA 5BQUA 4GOYA 3O4AA 3RTIB 2FFUA 4H75A 4DCKC 3JRRA 6I1BA 1KNMA 2GO2A 1DZDA 3BA5A 1YTOA 4I4UA 2FO1A 1AVXB 4I2SA 3NBCA 3MALA 2M49A 3AH1A 4ZFWB 3BRDA 1ONKB 1DIWA 3LTQA 5JMCA 3PUBA 3H6RA 2Y9FA 3O44A 5F8YA 1FWVA 3RTJB 4QKSA 3VSFA 3QYDA 1IT0A 3O49A 4JAWA 5FNWA 3BAUA 3O5WB 5DUYA 3UD9A 1F31A 2VSEA 3FJBA 1Z2VA 4ZFYB 4XFUA 2D24A 4USPA 2BFHA 31BIA 1WBAA 4L4HA 3FJIA 1BARA 4ISQA 3BRGC 3VEQA 1S0FA 1V6WA 1V6VA 4OEFA 2MC2A 4I37A 3OJVA 3LLPA 3FUQA 2D1ZA 1EPWA 4D8HA 4G6JA 1SR4A 1T4QA 1K5UA 1W3AA 1ABRB 4I4VA 3KMVA 3JUTA 4LO0C 4LO2A 5BXSA 3NBNA 2VXRA 1EVTA 4WBCA 3AH4A 4DEPA 4JKXB 3AJ5A 3OBRA 4QBVA 4P0KA 4I4QA 3ZXGA 3IM6A 2QN4A 3VUOA 2GZBA 1NZKA 4LO3A 3CA1A 2MLLB 4ZFUB 3BX1C 4HJJA 2AFGA 4GOVA 1HWPB 3FFZA 3V0AA 4XFSA 1S0CA 1EYLA 1HWOB 1QQKA 1I1EA 4ZLBB 1HCEA 1YBIA 4QO3A 5FZUA 4OWLA 3Q7XA 4HA2A 4OEEA 4R6UB 3CA0A 3N7JA 4I4RA 4I0YA 4UY4A 4D0ZA 5E24E 4GP0A 4QKRA 1W3FA 2R9KB 3V0BB 1Z4SA 1K5VA 3N7MA 2Z48A 4QALA 4MZGB 1JY0A 4H04A 3FJHA 5DSSB 3BRFA 4MZHA 2NS2A 3CA4A 3ILAA 5BXRA 3T8SA 1Q04A 4AN7B 4I3NA 1BFBA 3F1RA 1S0GA 3WMUA 2IWTB 3UD7A 3CU1B 3TC2A 4A7ZA 4OWKA 4JP0A 3PMEA 2NZ9A 3FUOA 1HWMB 1G9AA 4OEGA 3UDAA 3Q7WA 4QD2B 4ZA3B 1JQZA 2Q3NB 4G6MA 1HKNA 3H6SE 2BEAA 2NM1A 4KBBA 2BEBA 1AVUA 1MD6A 4MZFB 4Z9WB 1QQLA 1GGPB 1P63A 4IZEA 1A8DA 2P39A 2K8RA 3UJ4A 2AXMA 3RMXA 4FVVA 4ZKTB 4P0JA 3FJAA 1AVWB 4I4XA 3FJKA 3O3QA 2NP0A 3FJFA 5F8WA 4J2SA 3FJDA 1J0SA 4QC4A 2E4MC 1R8NA 4JRAA 1ISYA 2VSAA 1ISVA 3R4UA 7I1BA 3H6QA 1BLAA 1EV2A 1L2HA 4EB2B 3B9UA 2Y9XE 3CA5A 4P0LA 4EFPA 1Z0HA 4X39A 2WBCA 1TOOA 1JT7A 4KEIA 2UUSA 1DQGA 1S0EA 3VWCA 4F34A 2KI4A 1ISXA 1G9DA 3N7KA 5HPZA 3P6IA 4IY9A 3CAHA 2ZR1B 3K1XA 3C9ZA 3MPPG 1M16A 3OBTA 3OJ2A 4EFQA 2ERMA 2RG9B 3AKIA 4LO0A 5F8SA 3HALA 5GAQA 1JT3A 2Z49A 4KC3A 2DREA 3AJ6A 1CVSA 1IILA 4QBCA 3F62B 1VCLA 2MIBA 1BASA 2IHOA 1IJTA 2YUGA 3IIRA 1UPSA 2ET2A 1ISWA 4II0A 3P6JA 4I7IA 4KEJA 1G82A 2P23A 4TLPA 1MC9A 4JPZA 4YOLA 5I1BA 4OWJA 5DVHA 4X3AA 1PUUB 2HWMA 2HZ9A 3IAGC 2KLLA 3IM7A 4LO7B 3RSJA 2D22A 4KEKA 2D7IA 1S0DA 1T9FA 4IQPA 1V6XA 5JLVA 1FMMS 1M2TB 1RZOB 1JLXA 3BA7A 3FGMA 1BFFA 1XYFA 1DLLA 5BXPA 1ISZA 1RG8A 3OGGA 3ZC9A 3OGFA 4Q91A 4GAIA 1PUMB 2F2FA 4IONA 4IY8A 1DQOA 3QR5A 1II4A 3WO2A 3V0AB 1AF9A 1NUNA 3A22A 1TTUA 2Y9GA 3BAGA 4OW4A 3I29B 1FQ9A 3ZC8A 2K43A 3I2AA 4IZXA 3SNVA 3N7LA 1DJSB 4IYBA 2Q9XA 4X37A 3ZXDA 2F2FC 2J3PA 2VU9A 3OJMA 4Q9GA 1OQLB 4GP3A 4JKQA 4Q9PA 2VUAA 3V0BA 2ZQNA 1G9CA 3CA3A 1HWNB 3WINC 4DENA 4A7KA 3AZWA 1DFQA 1W3GA 1DZCA 4I4SA 3BTAA 5G00A 1I1BA 4XFTA 3HN1A 3AH2A 3VT0A 2NVHA 4I1BA 1BFCA 4EKXB 2HWAA 3BAHA 3CA6A
chains in the Genus database with same CATH topology
3CRGA 5D61A 2X2TA 1IRAX 3P53A 4G1RA 4Z8SB 2E4MA 4LO1C 2FFVA 2D43A 21BIA 4ENDA 1HCDA 1AFCA 1WD3A 2D23A 3VT2A 3N0KA 4D0TA 1SZ6B 2LIQA 3V79C 3BB2A 1ITBA 4X38A 3E8LC 4ISRA 1HIBA 4PC4A 1BFGA 1PZZA 2VLCA 4USOA 4ZBVB 3R4SA 4H9WA 4QD2C 5BVPI 4XKIA 2F8XC 2XOAA 1JLYA 1CE7B 3AZVA 4JQ0A 3BAVA 3NBDA 2WRYA 1YYNA 3IM5A 5DZUA 5D63A 3O4CA 2DRZA 2AAIB 2D7RA 2FDBM 5EC5A 4I6IA 3CRIA 3NJ5A 4OUJA 2K4AB 3VSZA 5BP5A 3H6RB 2NYYA 1Q03A 3Q7YA 1AVAC 3FJ9A 3NBEA 4GAFA 5F90A 4I8MA 5BQUC 2ZQOA 4I4PA 3A07A 2QYIB 2RSTA 3FJEA 1YXWA 1TIEA 1E0OA 5BP5C 3WMVA 2D44A 1XHBA 3EF2A 3AKFA 3BAQA 3S8KA 4HR6C 3HMYA 5EG6C 3FJ8A 4I4OA 1R8OA 4I1EA 2DS0A 5BOWA 3CRHA 5B2HA 1Q1UA 5BXTA 2NTDA 2X2SA 3O4DA 4CJMA 1XZZA 3POKA 5FZZA 1AXMA 1PC8B 2FGFA 2AQZA 1QXMA 1JT5A 1FV2A 2I1BA 2VXTI 3HSMA 1PWAA 1WBCA 2LIEA 4ZOTA 4IHZA 1TWMA 4J2YA 1TP0A 4I4YA 1TWEA 3WO3A 4A7YA 4G9NA 2KH2A 4LO8B 1S0BA 1SR4C 2DRYA 2KKIA 3UD8A 1YF8B 4L4IA 1FMZA 3UJ0A 3CQAA 2D20A 1WD4A 4P6AA 3RMYA 4J2XA 1DFCA 4LO2C 5FNXA 2HW9A 2Y9WC 3W9TA 3ZX7A 4AN6A 3WINA 9ILBA 4LO7C 1JTCA 4J23B 1G9BA 3PHZA 4EEEB 4EFRA 3BADA 1V6UA 3BAOA 4LO3C 1IHKA 1FGAA 1RMLA 3A23A 1IRPA 3PG0A 4FGFA 4I96A 1D0HA 4G9MA 1FWUA 3WA1A 3FJJA 5D62A 4F83A 1JT4A 5EHAA 4ZGRB 4LO1A 1FV3A 3BA4A 3HOMA 3A21A 3D7WB 1TFMB 3S8JA 3VT1A 4J2KA 3AKGA 1RY7A 3I2XA 3HBWA 1BLDA 2KI6B 3WO4A 1FN0A 2ESUA 3O4BA 1BA7A 1ILR1 3FJCA 8I1BA 2RQ9A 3O4OA 1S0LA 2L5XA 41BIA 5FZYA 1N4KA 3AKHA 1XG6A 1IOBA 5BQUA 4GOYA 3O4AA 3RTIB 2FFUA 4H75A 4DCKC 3JRRA 6I1BA 1KNMA 2GO2A 1DZDA 3BA5A 1YTOA 4I4UA 2FO1A 1AVXB 4I2SA 3NBCA 3MALA 2M49A 3AH1A 4ZFWB 3BRDA 1ONKB 1DIWA 3LTQA 5JMCA 3PUBA 3H6RA 2Y9FA 3O44A 5F8YA 1FWVA 3RTJB 4QKSA 3VSFA 3QYDA 1IT0A 3O49A 4JAWA 5FNWA 3BAUA 3O5WB 5DUYA 3UD9A 1F31A 2VSEA 3FJBA 1Z2VA 4ZFYB 4XFUA 2D24A 4USPA 2BFHA 31BIA 1WBAA 4L4HA 3FJIA 1BARA 4ISQA 3BRGC 3VEQA 1S0FA 1V6WA 1V6VA 4OEFA 2MC2A 4I37A 3OJVA 3LLPA 3FUQA 2D1ZA 1EPWA 4D8HA 4G6JA 1SR4A 1T4QA 1K5UA 1W3AA 1ABRB 4I4VA 3KMVA 3JUTA 4LO0C 4LO2A 5BXSA 3NBNA 2VXRA 1EVTA 4WBCA 3AH4A 4DEPA 4JKXB 3AJ5A 3OBRA 4QBVA 4P0KA 4I4QA 3ZXGA 3IM6A 2QN4A 3VUOA 2GZBA 1NZKA 4LO3A 3CA1A 2MLLB 4ZFUB 3BX1C 4HJJA 2AFGA 4GOVA 1HWPB 3FFZA 3V0AA 4XFSA 1S0CA 1EYLA 1HWOB 1QQKA 1I1EA 4ZLBB 1HCEA 1YBIA 4QO3A 5FZUA 4OWLA 3Q7XA 4HA2A 4OEEA 4R6UB 3CA0A 3N7JA 4I4RA 4I0YA 4UY4A 4D0ZA 5E24E 4GP0A 4QKRA 1W3FA 2R9KB 3V0BB 1Z4SA 1K5VA 3N7MA 2Z48A 4QALA 4MZGB 1JY0A 4H04A 3FJHA 5DSSB 3BRFA 4MZHA 2NS2A 3CA4A 3ILAA 5BXRA 3T8SA 1Q04A 4AN7B 4I3NA 1BFBA 3F1RA 1S0GA 3WMUA 2IWTB 3UD7A 3CU1B 3TC2A 4A7ZA 4OWKA 4JP0A 3PMEA 2NZ9A 3FUOA 1HWMB 1G9AA 4OEGA 3UDAA 3Q7WA 4QD2B 4ZA3B 1JQZA 2Q3NB 4G6MA 1HKNA 3H6SE 2BEAA 2NM1A 4KBBA 2BEBA 1AVUA 1MD6A 4MZFB 4Z9WB 1QQLA 1GGPB 1P63A 4IZEA 1A8DA 2P39A 2K8RA 3UJ4A 2AXMA 3RMXA 4FVVA 4ZKTB 4P0JA 3FJAA 1AVWB 4I4XA 3FJKA 3O3QA 2NP0A 3FJFA 5F8WA 4J2SA 3FJDA 1J0SA 4QC4A 2E4MC 1R8NA 4JRAA 1ISYA 2VSAA 1ISVA 3R4UA 7I1BA 3H6QA 1BLAA 1EV2A 1L2HA 4EB2B 3B9UA 2Y9XE 3CA5A 4P0LA 4EFPA 1Z0HA 4X39A 2WBCA 1TOOA 1JT7A 4KEIA 2UUSA 1DQGA 1S0EA 3VWCA 4F34A 2KI4A 1ISXA 1G9DA 3N7KA 5HPZA 3P6IA 4IY9A 3CAHA 2ZR1B 3K1XA 3C9ZA 3MPPG 1M16A 3OBTA 3OJ2A 4EFQA 2ERMA 2RG9B 3AKIA 4LO0A 5F8SA 3HALA 5GAQA 1JT3A 2Z49A 4KC3A 2DREA 3AJ6A 1CVSA 1IILA 4QBCA 3F62B 1VCLA 2MIBA 1BASA 2IHOA 1IJTA 2YUGA 3IIRA 1UPSA 2ET2A 1ISWA 4II0A 3P6JA 4I7IA 4KEJA 1G82A 2P23A 4TLPA 1MC9A 4JPZA 4YOLA 5I1BA 4OWJA 5DVHA 4X3AA 1PUUB 2HWMA 2HZ9A 3IAGC 2KLLA 3IM7A 4LO7B 3RSJA 2D22A 4KEKA 2D7IA 1S0DA 1T9FA 4IQPA 1V6XA 5JLVA 1FMMS 1M2TB 1RZOB 1JLXA 3BA7A 3FGMA 1BFFA 1XYFA 1DLLA 5BXPA 1ISZA 1RG8A 3OGGA 3ZC9A 3OGFA 4Q91A 4GAIA 1PUMB 2F2FA 4IONA 4IY8A 1DQOA 3QR5A 1II4A 3WO2A 3V0AB 1AF9A 1NUNA 3A22A 1TTUA 2Y9GA 3BAGA 4OW4A 3I29B 1FQ9A 3ZC8A 2K43A 3I2AA 4IZXA 3SNVA 3N7LA 1DJSB 4IYBA 2Q9XA 4X37A 3ZXDA 2F2FC 2J3PA 2VU9A 3OJMA 4Q9GA 1OQLB 4GP3A 4JKQA 4Q9PA 2VUAA 3V0BA 2ZQNA 1G9CA 3CA3A 1HWNB 3WINC 4DENA 4A7KA 3AZWA 1DFQA 1W3GA 1DZCA 4I4SA 3BTAA 5G00A 1I1BA 4XFTA 3HN1A 3AH2A 3VT0A 2NVHA 4I1BA 1BFCA 4EKXB 2HWAA 3BAHA 3CA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRG A;  5D61 A;  2X2T A;  1IRA X;  3P53 A;  4G1R A;  4Z8S B;  2E4M A;  4LO1 C;  2FFV A;  2D43 A;  21BI A;  4END A;  1HCD A;  1AFC A;  1WD3 A;  2D23 A;  3VT2 A;  3N0K A;  4D0T A;  1SZ6 B;  2LIQ A;  3V79 C;  3BB2 A;  1ITB A;  4X38 A;  3E8L C;  4ISR A;  1HIB A;  4PC4 A;  1BFG A;  1PZZ A;  2VLC A;  4USO A;  4ZBV B;  3R4S A;  4H9W A;  4QD2 C;  5BVP I;  4XKI A;  2F8X C;  2XOA A;  1JLY A;  1CE7 B;  3AZV A;  4JQ0 A;  3BAV A;  3NBD A;  2WRY A;  1YYN A;  3IM5 A;  5DZU A;  5D63 A;  3O4C A;  2DRZ A;  2AAI B;  2D7R A;  2FDB M;  5EC5 A;  4I6I A;  3CRI A;  3NJ5 A;  4OUJ A;  2K4A B;  3VSZ A;  5BP5 A;  3H6R B;  2NYY A;  1Q03 A;  3Q7Y A;  1AVA C;  3FJ9 A;  3NBE A;  4GAF A;  5F90 A;  4I8M A;  5BQU C;  2ZQO A;  4I4P A;  3A07 A;  2QYI B;  2RST A;  3FJE A;  1YXW A;  1TIE A;  1E0O A;  5BP5 C;  3WMV A;  2D44 A;  1XHB A;  3EF2 A;  3AKF A;  3BAQ A;  3S8K A;  4HR6 C;  3HMY A;  5EG6 C;  3FJ8 A;  4I4O A;  1R8O A;  4I1E A;  2DS0 A;  5BOW A;  3CRH A;  5B2H A;  1Q1U A;  5BXT A;  2NTD A;  2X2S A;  3O4D A;  4CJM A;  1XZZ A;  3POK A;  5FZZ A;  1AXM A;  1PC8 B;  2FGF A;  2AQZ A;  1QXM A;  1JT5 A;  1FV2 A;  2I1B A;  2VXT I;  3HSM A;  1PWA A;  1WBC A;  2LIE A;  4ZOT A;  4IHZ A;  1TWM A;  4J2Y A;  1TP0 A;  4I4Y A;  1TWE A;  3WO3 A;  4A7Y A;  4G9N A;  2KH2 A;  4LO8 B;  1S0B A;  1SR4 C;  2DRY A;  2KKI A;  3UD8 A;  1YF8 B;  4L4I A;  1FMZ A;  3UJ0 A;  3CQA A;  2D20 A;  1WD4 A;  4P6A A;  3RMY A;  4J2X A;  1DFC A;  4LO2 C;  5FNX A;  2HW9 A;  2Y9W C;  3W9T A;  3ZX7 A;  4AN6 A;  3WIN A;  9ILB A;  4LO7 C;  1JTC A;  4J23 B;  1G9B A;  3PHZ A;  4EEE B;  4EFR A;  3BAD A;  1V6U A;  3BAO A;  4LO3 C;  1IHK A;  1FGA A;  1RML A;  3A23 A;  1IRP A;  3PG0 A;  4FGF A;  4I96 A;  1D0H A;  4G9M A;  1FWU A;  3WA1 A;  3FJJ A;  5D62 A;  4F83 A;  1JT4 A;  5EHA A;  4ZGR B;  4LO1 A;  1FV3 A;  3BA4 A;  3HOM A;  3A21 A;  3D7W B;  1TFM B;  3S8J A;  3VT1 A;  4J2K A;  3AKG A;  1RY7 A;  3I2X A;  3HBW A;  1BLD A;  2KI6 B;  3WO4 A;  1FN0 A;  2ESU A;  3O4B A;  1BA7 A;  1ILR 1;  3FJC A;  8I1B A;  2RQ9 A;  3O4O A;  1S0L A;  2L5X A;  41BI A;  5FZY A;  1N4K A;  3AKH A;  1XG6 A;  1IOB A;  5BQU A;  4GOY A;  3O4A A;  3RTI B;  2FFU A;  4DCK C;  3JRR A;  6I1B A;  1KNM A;  2GO2 A;  1DZD A;  3BA5 A;  1YTO A;  4I4U A;  2FO1 A;  1AVX B;  4I2S A;  3NBC A;  3MAL A;  2M49 A;  3AH1 A;  4ZFW B;  3BRD A;  1ONK B;  1DIW A;  3LTQ A;  5JMC A;  3PUB A;  3H6R A;  2Y9F A;  3O44 A;  5F8Y A;  1FWV A;  3RTJ B;  4QKS A;  3VSF A;  3QYD A;  1IT0 A;  3O49 A;  4JAW A;  5FNW A;  3BAU A;  3O5W B;  5DUY A;  3UD9 A;  1F31 A;  2VSE A;  3FJB A;  1Z2V A;  4ZFY B;  4XFU A;  2D24 A;  4USP A;  2BFH A;  31BI A;  1WBA A;  4L4H A;  3FJI A;  1BAR A;  4ISQ A;  3BRG C;  3VEQ A;  1S0F A;  1V6W A;  1V6V A;  4OEF A;  2MC2 A;  4I37 A;  3OJV A;  3LLP A;  3FUQ A;  2D1Z A;  1EPW A;  4D8H A;  4G6J A;  1SR4 A;  1T4Q A;  1K5U A;  1W3A A;  1ABR B;  4I4V A;  3KMV A;  3JUT A;  4LO0 C;  4LO2 A;  5BXS A;  3NBN A;  2VXR A;  1EVT A;  4WBC A;  3AH4 A;  4DEP A;  4JKX B;  3AJ5 A;  3OBR A;  4QBV A;  4P0K A;  4I4Q A;  3ZXG A;  3IM6 A;  2QN4 A;  3VUO A;  2GZB A;  1NZK A;  4LO3 A;  3CA1 A;  2MLL B;  4ZFU B;  3BX1 C;  4HJJ A;  2AFG A;  4GOV A;  1HWP B;  3FFZ A;  3V0A A;  4XFS A;  1S0C A;  1EYL A;  1HWO B;  1QQK A;  1I1E A;  4ZLB B;  1HCE A;  1YBI A;  4QO3 A;  5FZU A;  4OWL A;  3Q7X A;  4HA2 A;  4OEE A;  4R6U B;  3CA0 A;  3N7J A;  4I4R A;  4I0Y A;  5E24 E;  4D0Z A;  4GP0 A;  4QKR A;  1W3F A;  2R9K B;  3V0B B;  1Z4S A;  1K5V A;  3N7M A;  2Z48 A;  4QAL A;  1JY0 A;  4H04 A;  3FJH A;  5DSS B;  3BRF A;  3CA4 A;  3ILA A;  5BXR A;  3T8S A;  1Q04 A;  4AN7 B;  4I3N A;  1BFB A;  3F1R A;  1S0G A;  3WMU A;  2IWT B;  3UD7 A;  3CU1 B;  3TC2 A;  4A7Z A;  4OWK A;  4JP0 A;  3PME A;  2NZ9 A;  3FUO A;  1HWM B;  1G9A A;  4OEG A;  3UDA A;  3Q7W A;  4QD2 B;  4ZA3 B;  1JQZ A;  2Q3N B;  4G6M A;  1HKN A;  3H6S E;  2BEA A;  2NM1 A;  4KBB A;  2BEB A;  1AVU A;  1MD6 A;  4Z9W B;  1QQL A;  1GGP B;  1P63 A;  4IZE A;  1A8D A;  2P39 A;  2K8R A;  3UJ4 A;  2AXM A;  3RMX A;  4FVV A;  4ZKT B;  4P0J A;  3FJA A;  1AVW B;  4I4X A;  3FJK A;  3O3Q A;  2NP0 A;  3FJF A;  5F8W A;  4J2S A;  3FJD A;  1J0S A;  4QC4 A;  2E4M C;  1R8N A;  4JRA A;  1ISY A;  2VSA A;  1ISV A;  3R4U A;  7I1B A;  3H6Q A;  1BLA A;  1EV2 A;  1L2H A;  4EB2 B;  3B9U A;  2Y9X E;  3CA5 A;  4P0L A;  4EFP A;  1Z0H A;  4X39 A;  2WBC A;  1TOO A;  1JT7 A;  4KEI A;  2UUS A;  1DQG A;  1S0E A;  3VWC A;  4F34 A;  2KI4 A;  1ISX A;  1G9D A;  3N7K A;  5HPZ A;  3P6I A;  4IY9 A;  3CAH A;  2ZR1 B;  3K1X A;  3C9Z A;  3MPP G;  1M16 A;  3OBT A;  3OJ2 A;  4EFQ A;  2ERM A;  2RG9 B;  3AKI A;  4LO0 A;  5F8S A;  3HAL A;  5GAQ A;  1JT3 A;  2Z49 A;  4KC3 A;  2DRE A;  3AJ6 A;  1CVS A;  1IIL A;  4QBC A;  3F62 B;  1VCL A;  2MIB A;  1BAS A;  2IHO A;  1IJT A;  2YUG A;  3IIR A;  1UPS A;  2ET2 A;  1ISW A;  4II0 A;  3P6J A;  4I7I A;  4KEJ A;  1G82 A;  2P23 A;  4TLP A;  1MC9 A;  4JPZ A;  4YOL A;  5I1B A;  4OWJ A;  5DVH A;  4X3A A;  1PUU B;  2HWM A;  2HZ9 A;  3IAG C;  2KLL A;  3IM7 A;  4LO7 B;  3RSJ A;  2D22 A;  4KEK A;  2D7I A;  1S0D A;  1T9F A;  4IQP A;  1V6X A;  5JLV A;  1FMM S;  1M2T B;  1RZO B;  1JLX A;  3BA7 A;  3FGM A;  1BFF A;  1XYF A;  1DLL A;  5BXP A;  1ISZ A;  1RG8 A;  3OGG A;  3ZC9 A;  3OGF A;  4Q91 A;  4GAI A;  1PUM B;  2F2F A;  4ION A;  4IY8 A;  1DQO A;  3QR5 A;  1II4 A;  3WO2 A;  3V0A B;  1AF9 A;  1NUN A;  3A22 A;  1TTU A;  2Y9G A;  3BAG A;  4OW4 A;  3I29 B;  1FQ9 A;  3ZC8 A;  2K43 A;  3I2A A;  4IZX A;  3SNV A;  3N7L A;  1DJS B;  4IYB A;  2Q9X A;  4X37 A;  3ZXD A;  2F2F C;  2J3P A;  2VU9 A;  3OJM A;  4Q9G A;  1OQL B;  4GP3 A;  4JKQ A;  4Q9P A;  2VUA A;  3V0B A;  2ZQN A;  1G9C A;  3CA3 A;  1HWN B;  3WIN C;  4DEN A;  4A7K A;  3AZW A;  1DFQ A;  1W3G A;  1DZC A;  4I4S A;  3BTA A;  5G00 A;  1I1B A;  4XFT A;  3HN1 A;  3AH2 A;  3VT0 A;  2NVH A;  4I1B A;  1BFC A;  4EKX B;  2HWA A;  3BAH A;  3CA6 A; 
#chains in the Genus database with same CATH topology
 3CRG A;  5D61 A;  2X2T A;  1IRA X;  3P53 A;  4G1R A;  4Z8S B;  2E4M A;  4LO1 C;  2FFV A;  2D43 A;  21BI A;  4END A;  1HCD A;  1AFC A;  1WD3 A;  2D23 A;  3VT2 A;  3N0K A;  4D0T A;  1SZ6 B;  2LIQ A;  3V79 C;  3BB2 A;  1ITB A;  4X38 A;  3E8L C;  4ISR A;  1HIB A;  4PC4 A;  1BFG A;  1PZZ A;  2VLC A;  4USO A;  4ZBV B;  3R4S A;  4H9W A;  4QD2 C;  5BVP I;  4XKI A;  2F8X C;  2XOA A;  1JLY A;  1CE7 B;  3AZV A;  4JQ0 A;  3BAV A;  3NBD A;  2WRY A;  1YYN A;  3IM5 A;  5DZU A;  5D63 A;  3O4C A;  2DRZ A;  2AAI B;  2D7R A;  2FDB M;  5EC5 A;  4I6I A;  3CRI A;  3NJ5 A;  4OUJ A;  2K4A B;  3VSZ A;  5BP5 A;  3H6R B;  2NYY A;  1Q03 A;  3Q7Y A;  1AVA C;  3FJ9 A;  3NBE A;  4GAF A;  5F90 A;  4I8M A;  5BQU C;  2ZQO A;  4I4P A;  3A07 A;  2QYI B;  2RST A;  3FJE A;  1YXW A;  1TIE A;  1E0O A;  5BP5 C;  3WMV A;  2D44 A;  1XHB A;  3EF2 A;  3AKF A;  3BAQ A;  3S8K A;  4HR6 C;  3HMY A;  5EG6 C;  3FJ8 A;  4I4O A;  1R8O A;  4I1E A;  2DS0 A;  5BOW A;  3CRH A;  5B2H A;  1Q1U A;  5BXT A;  2NTD A;  2X2S A;  3O4D A;  4CJM A;  1XZZ A;  3POK A;  5FZZ A;  1AXM A;  1PC8 B;  2FGF A;  2AQZ A;  1QXM A;  1JT5 A;  1FV2 A;  2I1B A;  2VXT I;  3HSM A;  1PWA A;  1WBC A;  2LIE A;  4ZOT A;  4IHZ A;  1TWM A;  4J2Y A;  1TP0 A;  4I4Y A;  1TWE A;  3WO3 A;  4A7Y A;  4G9N A;  2KH2 A;  4LO8 B;  1S0B A;  1SR4 C;  2DRY A;  2KKI A;  3UD8 A;  1YF8 B;  4L4I A;  1FMZ A;  3UJ0 A;  3CQA A;  2D20 A;  1WD4 A;  4P6A A;  3RMY A;  4J2X A;  1DFC A;  4LO2 C;  5FNX A;  2HW9 A;  2Y9W C;  3W9T A;  3ZX7 A;  4AN6 A;  3WIN A;  9ILB A;  4LO7 C;  1JTC A;  4J23 B;  1G9B A;  3PHZ A;  4EEE B;  4EFR A;  3BAD A;  1V6U A;  3BAO A;  4LO3 C;  1IHK A;  1FGA A;  1RML A;  3A23 A;  1IRP A;  3PG0 A;  4FGF A;  4I96 A;  1D0H A;  4G9M A;  1FWU A;  3WA1 A;  3FJJ A;  5D62 A;  4F83 A;  1JT4 A;  5EHA A;  4ZGR B;  4LO1 A;  1FV3 A;  3BA4 A;  3HOM A;  3A21 A;  3D7W B;  1TFM B;  3S8J A;  3VT1 A;  4J2K A;  3AKG A;  1RY7 A;  3I2X A;  3HBW A;  1BLD A;  2KI6 B;  3WO4 A;  1FN0 A;  2ESU A;  3O4B A;  1BA7 A;  1ILR 1;  3FJC A;  8I1B A;  2RQ9 A;  3O4O A;  1S0L A;  2L5X A;  41BI A;  5FZY A;  1N4K A;  3AKH A;  1XG6 A;  1IOB A;  5BQU A;  4GOY A;  3O4A A;  3RTI B;  2FFU A;  4H75 A;  4DCK C;  3JRR A;  6I1B A;  1KNM A;  2GO2 A;  1DZD A;  3BA5 A;  1YTO A;  4I4U A;  2FO1 A;  1AVX B;  4I2S A;  3NBC A;  3MAL A;  2M49 A;  3AH1 A;  4ZFW B;  3BRD A;  1ONK B;  1DIW A;  3LTQ A;  5JMC A;  3PUB A;  3H6R A;  2Y9F A;  3O44 A;  5F8Y A;  1FWV A;  3RTJ B;  4QKS A;  3VSF A;  3QYD A;  1IT0 A;  3O49 A;  4JAW A;  5FNW A;  3BAU A;  3O5W B;  5DUY A;  3UD9 A;  1F31 A;  2VSE A;  3FJB A;  1Z2V A;  4ZFY B;  4XFU A;  2D24 A;  4USP A;  2BFH A;  31BI A;  1WBA A;  4L4H A;  3FJI A;  1BAR A;  4ISQ A;  3BRG C;  3VEQ A;  1S0F A;  1V6W A;  1V6V A;  4OEF A;  2MC2 A;  4I37 A;  3OJV A;  3LLP A;  3FUQ A;  2D1Z A;  1EPW A;  4D8H A;  4G6J A;  1SR4 A;  1T4Q A;  1K5U A;  1W3A A;  1ABR B;  4I4V A;  3KMV A;  3JUT A;  4LO0 C;  4LO2 A;  5BXS A;  3NBN A;  2VXR A;  1EVT A;  4WBC A;  3AH4 A;  4DEP A;  4JKX B;  3AJ5 A;  3OBR A;  4QBV A;  4P0K A;  4I4Q A;  3ZXG A;  3IM6 A;  2QN4 A;  3VUO A;  2GZB A;  1NZK A;  4LO3 A;  3CA1 A;  2MLL B;  4ZFU B;  3BX1 C;  4HJJ A;  2AFG A;  4GOV A;  1HWP B;  3FFZ A;  3V0A A;  4XFS A;  1S0C A;  1EYL A;  1HWO B;  1QQK A;  1I1E A;  4ZLB B;  1HCE A;  1YBI A;  4QO3 A;  5FZU A;  4OWL A;  3Q7X A;  4HA2 A;  4OEE A;  4R6U B;  3CA0 A;  3N7J A;  4I4R A;  4I0Y A;  4UY4 A;  4D0Z A;  5E24 E;  4GP0 A;  4QKR A;  1W3F A;  2R9K B;  3V0B B;  1Z4S A;  1K5V A;  3N7M A;  2Z48 A;  4QAL A;  4MZG B;  1JY0 A;  4H04 A;  3FJH A;  5DSS B;  3BRF A;  4MZH A;  2NS2 A;  3CA4 A;  3ILA A;  5BXR A;  3T8S A;  1Q04 A;  4AN7 B;  4I3N A;  1BFB A;  3F1R A;  1S0G A;  3WMU A;  2IWT B;  3UD7 A;  3CU1 B;  3TC2 A;  4A7Z A;  4OWK A;  4JP0 A;  3PME A;  2NZ9 A;  3FUO A;  1HWM B;  1G9A A;  4OEG A;  3UDA A;  3Q7W A;  4QD2 B;  4ZA3 B;  1JQZ A;  2Q3N B;  4G6M A;  1HKN A;  3H6S E;  2BEA A;  2NM1 A;  4KBB A;  2BEB A;  1AVU A;  1MD6 A;  4MZF B;  4Z9W B;  1QQL A;  1GGP B;  1P63 A;  4IZE A;  1A8D A;  2P39 A;  2K8R A;  3UJ4 A;  2AXM A;  3RMX A;  4FVV A;  4ZKT B;  4P0J A;  3FJA A;  1AVW B;  4I4X A;  3FJK A;  3O3Q A;  2NP0 A;  3FJF A;  5F8W A;  4J2S A;  3FJD A;  1J0S A;  4QC4 A;  2E4M C;  1R8N A;  4JRA A;  1ISY A;  2VSA A;  1ISV A;  3R4U A;  7I1B A;  3H6Q A;  1BLA A;  1EV2 A;  1L2H A;  4EB2 B;  3B9U A;  2Y9X E;  3CA5 A;  4P0L A;  4EFP A;  1Z0H A;  4X39 A;  2WBC A;  1TOO A;  1JT7 A;  4KEI A;  2UUS A;  1DQG A;  1S0E A;  3VWC A;  4F34 A;  2KI4 A;  1ISX A;  1G9D A;  3N7K A;  5HPZ A;  3P6I A;  4IY9 A;  3CAH A;  2ZR1 B;  3K1X A;  3C9Z A;  3MPP G;  1M16 A;  3OBT A;  3OJ2 A;  4EFQ A;  2ERM A;  2RG9 B;  3AKI A;  4LO0 A;  5F8S A;  3HAL A;  5GAQ A;  1JT3 A;  2Z49 A;  4KC3 A;  2DRE A;  3AJ6 A;  1CVS A;  1IIL A;  4QBC A;  3F62 B;  1VCL A;  2MIB A;  1BAS A;  2IHO A;  1IJT A;  2YUG A;  3IIR A;  1UPS A;  2ET2 A;  1ISW A;  4II0 A;  3P6J A;  4I7I A;  4KEJ A;  1G82 A;  2P23 A;  4TLP A;  1MC9 A;  4JPZ A;  4YOL A;  5I1B A;  4OWJ A;  5DVH A;  4X3A A;  1PUU B;  2HWM A;  2HZ9 A;  3IAG C;  2KLL A;  3IM7 A;  4LO7 B;  3RSJ A;  2D22 A;  4KEK A;  2D7I A;  1S0D A;  1T9F A;  4IQP A;  1V6X A;  5JLV A;  1FMM S;  1M2T B;  1RZO B;  1JLX A;  3BA7 A;  3FGM A;  1BFF A;  1XYF A;  1DLL A;  5BXP A;  1ISZ A;  1RG8 A;  3OGG A;  3ZC9 A;  3OGF A;  4Q91 A;  4GAI A;  1PUM B;  2F2F A;  4ION A;  4IY8 A;  1DQO A;  3QR5 A;  1II4 A;  3WO2 A;  3V0A B;  1AF9 A;  1NUN A;  3A22 A;  1TTU A;  2Y9G A;  3BAG A;  4OW4 A;  3I29 B;  1FQ9 A;  3ZC8 A;  2K43 A;  3I2A A;  4IZX A;  3SNV A;  3N7L A;  1DJS B;  4IYB A;  2Q9X A;  4X37 A;  3ZXD A;  2F2F C;  2J3P A;  2VU9 A;  3OJM A;  4Q9G A;  1OQL B;  4GP3 A;  4JKQ A;  4Q9P A;  2VUA A;  3V0B A;  2ZQN A;  1G9C A;  3CA3 A;  1HWN B;  3WIN C;  4DEN A;  4A7K A;  3AZW A;  1DFQ A;  1W3G A;  1DZC A;  4I4S A;  3BTA A;  5G00 A;  1I1B A;  4XFT A;  3HN1 A;  3AH2 A;  3VT0 A;  2NVH A;  4I1B A;  1BFC A;  4EKX B;  2HWA A;  3BAH A;  3CA6 A; 
#chains in the Genus database with same CATH homology
 3CRG A;  5D61 A;  2X2T A;  1IRA X;  3P53 A;  4G1R A;  4Z8S B;  2E4M A;  4LO1 C;  2FFV A;  2D43 A;  21BI A;  4END A;  1HCD A;  1AFC A;  1WD3 A;  2D23 A;  3VT2 A;  3N0K A;  4D0T A;  1SZ6 B;  2LIQ A;  3V79 C;  3BB2 A;  1ITB A;  4X38 A;  3E8L C;  4ISR A;  1HIB A;  4PC4 A;  1BFG A;  1PZZ A;  2VLC A;  4USO A;  4ZBV B;  3R4S A;  4H9W A;  4QD2 C;  5BVP I;  4XKI A;  2F8X C;  2XOA A;  1JLY A;  1CE7 B;  3AZV A;  4JQ0 A;  3BAV A;  3NBD A;  2WRY A;  1YYN A;  3IM5 A;  5DZU A;  5D63 A;  3O4C A;  2DRZ A;  2AAI B;  2D7R A;  2FDB M;  5EC5 A;  4I6I A;  3CRI A;  3NJ5 A;  4OUJ A;  2K4A B;  3VSZ A;  5BP5 A;  3H6R B;  2NYY A;  1Q03 A;  3Q7Y A;  1AVA C;  3FJ9 A;  3NBE A;  4GAF A;  5F90 A;  4I8M A;  5BQU C;  2ZQO A;  4I4P A;  3A07 A;  2QYI B;  2RST A;  3FJE A;  1YXW A;  1TIE A;  1E0O A;  5BP5 C;  3WMV A;  2D44 A;  1XHB A;  3EF2 A;  3AKF A;  3BAQ A;  3S8K A;  4HR6 C;  3HMY A;  5EG6 C;  3FJ8 A;  4I4O A;  1R8O A;  4I1E A;  2DS0 A;  5BOW A;  3CRH A;  5B2H A;  1Q1U A;  5BXT A;  2NTD A;  2X2S A;  3O4D A;  4CJM A;  1XZZ A;  3POK A;  5FZZ A;  1AXM A;  1PC8 B;  2FGF A;  2AQZ A;  1QXM A;  1JT5 A;  1FV2 A;  2I1B A;  2VXT I;  3HSM A;  1PWA A;  1WBC A;  2LIE A;  4ZOT A;  4IHZ A;  1TWM A;  4J2Y A;  1TP0 A;  4I4Y A;  1TWE A;  3WO3 A;  4A7Y A;  4G9N A;  2KH2 A;  4LO8 B;  1S0B A;  1SR4 C;  2DRY A;  2KKI A;  3UD8 A;  1YF8 B;  4L4I A;  1FMZ A;  3UJ0 A;  3CQA A;  2D20 A;  1WD4 A;  4P6A A;  3RMY A;  4J2X A;  1DFC A;  4LO2 C;  5FNX A;  2HW9 A;  2Y9W C;  3W9T A;  3ZX7 A;  4AN6 A;  3WIN A;  9ILB A;  4LO7 C;  1JTC A;  4J23 B;  1G9B A;  3PHZ A;  4EEE B;  4EFR A;  3BAD A;  1V6U A;  3BAO A;  4LO3 C;  1IHK A;  1FGA A;  1RML A;  3A23 A;  1IRP A;  3PG0 A;  4FGF A;  4I96 A;  1D0H A;  4G9M A;  1FWU A;  3WA1 A;  3FJJ A;  5D62 A;  4F83 A;  1JT4 A;  5EHA A;  4ZGR B;  4LO1 A;  1FV3 A;  3BA4 A;  3HOM A;  3A21 A;  3D7W B;  1TFM B;  3S8J A;  3VT1 A;  4J2K A;  3AKG A;  1RY7 A;  3I2X A;  3HBW A;  1BLD A;  2KI6 B;  3WO4 A;  1FN0 A;  2ESU A;  3O4B A;  1BA7 A;  1ILR 1;  3FJC A;  8I1B A;  2RQ9 A;  3O4O A;  1S0L A;  2L5X A;  41BI A;  5FZY A;  1N4K A;  3AKH A;  1XG6 A;  1IOB A;  5BQU A;  4GOY A;  3O4A A;  3RTI B;  2FFU A;  4H75 A;  4DCK C;  3JRR A;  6I1B A;  1KNM A;  2GO2 A;  1DZD A;  3BA5 A;  1YTO A;  4I4U A;  2FO1 A;  1AVX B;  4I2S A;  3NBC A;  3MAL A;  2M49 A;  3AH1 A;  4ZFW B;  3BRD A;  1ONK B;  1DIW A;  3LTQ A;  5JMC A;  3PUB A;  3H6R A;  2Y9F A;  3O44 A;  5F8Y A;  1FWV A;  3RTJ B;  4QKS A;  3VSF A;  3QYD A;  1IT0 A;  3O49 A;  4JAW A;  5FNW A;  3BAU A;  3O5W B;  5DUY A;  3UD9 A;  1F31 A;  2VSE A;  3FJB A;  1Z2V A;  4ZFY B;  4XFU A;  2D24 A;  4USP A;  2BFH A;  31BI A;  1WBA A;  4L4H A;  3FJI A;  1BAR A;  4ISQ A;  3BRG C;  3VEQ A;  1S0F A;  1V6W A;  1V6V A;  4OEF A;  2MC2 A;  4I37 A;  3OJV A;  3LLP A;  3FUQ A;  2D1Z A;  1EPW A;  4D8H A;  4G6J A;  1SR4 A;  1T4Q A;  1K5U A;  1W3A A;  1ABR B;  4I4V A;  3KMV A;  3JUT A;  4LO0 C;  4LO2 A;  5BXS A;  3NBN A;  2VXR A;  1EVT A;  4WBC A;  3AH4 A;  4DEP A;  4JKX B;  3AJ5 A;  3OBR A;  4QBV A;  4P0K A;  4I4Q A;  3ZXG A;  3IM6 A;  2QN4 A;  3VUO A;  2GZB A;  1NZK A;  4LO3 A;  3CA1 A;  2MLL B;  4ZFU B;  3BX1 C;  4HJJ A;  2AFG A;  4GOV A;  1HWP B;  3FFZ A;  3V0A A;  4XFS A;  1S0C A;  1EYL A;  1HWO B;  1QQK A;  1I1E A;  4ZLB B;  1HCE A;  1YBI A;  4QO3 A;  5FZU A;  4OWL A;  3Q7X A;  4HA2 A;  4OEE A;  4R6U B;  3CA0 A;  3N7J A;  4I4R A;  4I0Y A;  4UY4 A;  4D0Z A;  5E24 E;  4GP0 A;  4QKR A;  1W3F A;  2R9K B;  3V0B B;  1Z4S A;  1K5V A;  3N7M A;  2Z48 A;  4QAL A;  4MZG B;  1JY0 A;  4H04 A;  3FJH A;  5DSS B;  3BRF A;  4MZH A;  2NS2 A;  3CA4 A;  3ILA A;  5BXR A;  3T8S A;  1Q04 A;  4AN7 B;  4I3N A;  1BFB A;  3F1R A;  1S0G A;  3WMU A;  2IWT B;  3UD7 A;  3CU1 B;  3TC2 A;  4A7Z A;  4OWK A;  4JP0 A;  3PME A;  2NZ9 A;  3FUO A;  1HWM B;  1G9A A;  4OEG A;  3UDA A;  3Q7W A;  4QD2 B;  4ZA3 B;  1JQZ A;  2Q3N B;  4G6M A;  1HKN A;  3H6S E;  2BEA A;  2NM1 A;  4KBB A;  2BEB A;  1AVU A;  1MD6 A;  4MZF B;  4Z9W B;  1QQL A;  1GGP B;  1P63 A;  4IZE A;  1A8D A;  2P39 A;  2K8R A;  3UJ4 A;  2AXM A;  3RMX A;  4FVV A;  4ZKT B;  4P0J A;  3FJA A;  1AVW B;  4I4X A;  3FJK A;  3O3Q A;  2NP0 A;  3FJF A;  5F8W A;  4J2S A;  3FJD A;  1J0S A;  4QC4 A;  2E4M C;  1R8N A;  4JRA A;  1ISY A;  2VSA A;  1ISV A;  3R4U A;  7I1B A;  3H6Q A;  1BLA A;  1EV2 A;  1L2H A;  4EB2 B;  3B9U A;  2Y9X E;  3CA5 A;  4P0L A;  4EFP A;  1Z0H A;  4X39 A;  2WBC A;  1TOO A;  1JT7 A;  4KEI A;  2UUS A;  1DQG A;  1S0E A;  3VWC A;  4F34 A;  2KI4 A;  1ISX A;  1G9D A;  3N7K A;  5HPZ A;  3P6I A;  4IY9 A;  3CAH A;  2ZR1 B;  3K1X A;  3C9Z A;  3MPP G;  1M16 A;  3OBT A;  3OJ2 A;  4EFQ A;  2ERM A;  2RG9 B;  3AKI A;  4LO0 A;  5F8S A;  3HAL A;  5GAQ A;  1JT3 A;  2Z49 A;  4KC3 A;  2DRE A;  3AJ6 A;  1CVS A;  1IIL A;  4QBC A;  3F62 B;  1VCL A;  2MIB A;  1BAS A;  2IHO A;  1IJT A;  2YUG A;  3IIR A;  1UPS A;  2ET2 A;  1ISW A;  4II0 A;  3P6J A;  4I7I A;  4KEJ A;  1G82 A;  2P23 A;  4TLP A;  1MC9 A;  4JPZ A;  4YOL A;  5I1B A;  4OWJ A;  5DVH A;  4X3A A;  1PUU B;  2HWM A;  2HZ9 A;  3IAG C;  2KLL A;  3IM7 A;  4LO7 B;  3RSJ A;  2D22 A;  4KEK A;  2D7I A;  1S0D A;  1T9F A;  4IQP A;  1V6X A;  5JLV A;  1FMM S;  1M2T B;  1RZO B;  1JLX A;  3BA7 A;  3FGM A;  1BFF A;  1XYF A;  1DLL A;  5BXP A;  1ISZ A;  1RG8 A;  3OGG A;  3ZC9 A;  3OGF A;  4Q91 A;  4GAI A;  1PUM B;  2F2F A;  4ION A;  4IY8 A;  1DQO A;  3QR5 A;  1II4 A;  3WO2 A;  3V0A B;  1AF9 A;  1NUN A;  3A22 A;  1TTU A;  2Y9G A;  3BAG A;  4OW4 A;  3I29 B;  1FQ9 A;  3ZC8 A;  2K43 A;  3I2A A;  4IZX A;  3SNV A;  3N7L A;  1DJS B;  4IYB A;  2Q9X A;  4X37 A;  3ZXD A;  2F2F C;  2J3P A;  2VU9 A;  3OJM A;  4Q9G A;  1OQL B;  4GP3 A;  4JKQ A;  4Q9P A;  2VUA A;  3V0B A;  2ZQN A;  1G9C A;  3CA3 A;  1HWN B;  3WIN C;  4DEN A;  4A7K A;  3AZW A;  1DFQ A;  1W3G A;  1DZC A;  4I4S A;  3BTA A;  5G00 A;  1I1B A;  4XFT A;  3HN1 A;  3AH2 A;  3VT0 A;  2NVH A;  4I1B A;  1BFC A;  4EKX B;  2HWA A;  3BAH A;  3CA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...