4LO2A

Ha17-ha33-lac
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
286
structure length
286
Chain Sequence
NSLNDKIVTISCKADTNLFFYQVAGNVSLFQQTRNYLERWRLIYDSNKAAYKIKSMDIHNTNLVLTWNAPTHNISTQQDSNADNQYWLLLKDIGNNSFIIASYKNPNLVLYADTVARNLKLSTLNNSNYIKFIIEDYIISDLNNFTCKISPILDLNKVVQQVDVTNLNVNLYTWDYGRNQKWTIRYNEEKAAYQFFNTILSNGVLTWIFSNGNTVRVSSSNDQNNDAQYWLINPVSDTDETYTITNLRDTTKALDLYGGQTANGTAIQVFNYHGDDNQKWNIRNPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
molecule keywords HA-33
molecule tags Protein transport
source organism Clostridium botulinum
total genus 75
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo2A01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo2A02
3A23A 4OEFA 2DRZA 1Z4SA 2NVHA 5BXPA 3PG0A 4J2XA 4ZA3B 2RQ9A 1WBAA 3BX1C 3A07A 4QBVA 4DENA 2FDBM 2ZR1B 2F2FC 4I37A 4HA2A 3AKGA 4H9WA 1EPWA 4IZEA 3CA1A 3N7LA 2P23A 2AAIB 3BA5A 9ILBA 1FWVA 1XYFA 2DS0A 1T4QA 4WBCA 1AXMA 1RY7A 4USOA 4I8MA 4JPZA 3K1XA 3PUBA 2Y9XE 4L4HA 5FZYA 2IWTB 3V0AB 2X2SA 3VWCA 1N4KA 2MLLB 2FFVA 1RG8A 2Y9GA 1Q04A 4ISRA 2Q9XA 1G9BA 3A21A 3NBDA 2AXMA 1I1BA 3OBRA 3AKHA 2ZQNA 3ZXDA 1WD3A 2HW9A 4I3NA 1V6VA 4P6AA 3NBCA 3ZC9A 4X38A 3HALA 3Q7XA 1WD4A 1MD6A 5BXTA 4HR6C 1F31A 4IZXA 4D0TA 1AVWB 3Q7YA 4Q9GA 3NBNA 4G9NA 3OJVA 3FGMA 3EF2A 1FMZA 3UD7A 3UD9A 3AKFA 3LTQA 3BAQA 3CA3A 3T8SA 4LO7C 3IM5A 1R8OA 4D0ZA 1JLYA 4USPA 5BVPI 2K4AB 1G82A 4OW4A 3F62B 1IRAX 5G00A 5EHAA 1FV2A 3AJ6A 2D23A 3RSJA 1HCDA 4ZBVB 4KEKA 3BRDA 1DIWA 4P0LA 2D24A 5D63A 3TC2A 3FJEA 3HOMA 3FJJA 4X37A 4Q9PA 4QBCA 2D22A 2BEAA 1TWEA 3VUOA 2QYIB 5EC5A 3O4DA 1S0LA 3OJ2A 4G6JA 4F83A 3WMVA 3FJHA 4DEPA 3AZVA 1M2TB 3W9TA 1XG6A 2X2TA 4I4VA 1VCLA 2MC2A 2VUAA 5HPZA 2VU9A 1M16A 3POKA 1ISYA 3FJKA 3OGGA 1EVTA 1DZCA 1RZOB 1FGAA 3UDAA 1DFQA 3N7JA 2GZBA 1MC9A 3I2XA 5BXSA 4JP0A 4DCKC 3VT1A 4CJMA 1NZKA 2K43A 2KI6B 2R9KB 3FJ9A 4AN6A 1QXMA 1S0DA 5JLVA 2AQZA 4J23B 2VXRA 4I2SA 7I1BA 4ZFWB 3QYDA 3BAOA 3PMEA 1G9CA 1NUNA 3KMVA 1GGPB 3UD8A 4A7YA 5E24E 3AH4A 3ZX7A 8I1BA 2Q3NB 4OEEA 4LO3A 4I1EA 1JT5A 3A22A 1A8DA 5EG6C 1J0SA 3BAVA 3BA4A 5F8SA 2UUSA 5DZUA 1K5VA 4P0JA 3BAGA 1HWPB 3H6RB 3IM7A 4LO0C 2DREA 1SR4A 2VLCA 2AFGA 2FO1A 3PHZA 5JMCA 3FUQA 2ET2A 3IM6A 2Z49A 31BIA 4I4QA 3O49A 4D8HA 4GAFA 1V6WA 1W3GA 4PC4A 2LIQA 3RMXA 3BAHA 3BAUA 4ZOTA 2ERMA 5BXRA 2Y9FA 2KLLA 4Z8SB 1FN0A 1IHKA 3BADA 1DFCA 1S0FA 4J2YA 2BEBA 1BLAA 1YBIA 3WMUA 2KI4A 3O3QA 1FWUA 3VT2A 3WO4A 2D20A 1BFCA 5B2HA 4LO2A 3ZC8A 3CAHA 4QD2B 1TOOA 2ZQOA 1G9AA 3H6SE 4A7KA 1DJSB 5FZZA 1BFBA 4LO3C 5F90A 2Z48A 3IAGC 3OGFA 1PZZA 4I4SA 4IY9A 1BASA 1E0OA 1FV3A 3H6RA 4H04A 3QR5A 4I4OA 4OWLA 5I1BA 2YUGA 3BA7A 3CQAA 3RTIB 4ZFUB 3S8KA 6I1BA 5BQUC 1EV2A 1SR4C 3CRGA 1HWNB 1HCEA 1YYNA 5FNXA 1BLDA 4LO0A 1KNMA 3S8JA 1Q1UA 3CA0A 3CRIA 5FNWA 1SZ6B 2NTDA 1JTCA 2E4MA 2D43A 3AZWA 1CE7B 5DSSB 1ABRB 1Z0HA 3O5WB 4I96A 4Z9WB 3LLPA 3O4OA 5F8WA 1K5UA 4ISQA 3BB2A 1Z2VA 3N0KA 2HWMA 1XHBA 2D44A 1S0BA 4EKXB 3NJ5A 4QKSA 3CA6A 4QC4A 3UJ0A 1P63A 3SNVA 1DQGA 1DLLA 1HWOB 1S0CA 3VT0A 3IIRA 2D7IA 3CA5A 2NZ9A 4XKIA 1EYLA 4ENDA 3AJ5A 4I6IA 4KBBA 3MPPG 1AVXB 3WINA 4XFTA 3I2AA 1PUUB 3E8LC 1BFFA 3P6IA 4I4RA 4LO2C 4X3AA 1IJTA 5D61A 3C9ZA 4I1BA 3JRRA 3O4AA 3FJ8A 1S0EA 3AKIA 4JKXB 5F8YA 1FMMS 2D1ZA 3WO3A 2VSEA 3CU1B 1R8NA 2Y9WC 4IY8A 1JT4A 3HMYA 1IOBA 3Q7WA 3HN1A 5BP5A 2P39A 4GP3A 3VSZA 1PUMB 3P6JA 1JLXA 3B9UA 3N7MA 3R4SA 3NBEA 3O4CA 4JKQA 3CA4A 1AF9A 1TIEA 4I4PA 1ISZA 1AVUA 2L5XA 3AH2A 2GO2A 5BQUA 3ILAA 2F8XC 3H6QA 1AVAC 1HIBA 1ISWA 2E4MC 3HSMA 1ISXA 2NYYA 1WBCA 1QQKA 2RG9B 3FJDA 4IONA 4G1RA 2WBCA 4AN7B 3RTJB 1IRPA 4R6UB 4EB2B 3OJMA 1JT3A 1PC8B 4OEGA 1ONKB 1PWAA 4A7ZA 2J3PA 4G6MA 2RSTA 2M49A 3FUOA 3VSFA 3N7KA 1ISVA 1DQOA 2FGFA 2DRYA 2D7RA 4P0KA 3WINC 5BOWA 3JUTA 3WA1A 3FJIA 4I0YA 3RMYA 1ILR1 2MIBA 4QD2C 4KEJA 5DUYA 2I1BA 1Q03A 3V0BB 2NP0A 4L4IA 2KKIA 4FVVA 3BRFA 4QKRA 4TLPA 3BTAA 5D62A 4QO3A 3O4BA 1ITBA 4Q91A 4OWJA 2VXTI 1W3AA 3VEQA 2QN4A 4F34A 1AFCA 4GOYA 4OWKA 1TFMB 4KEIA 1YTOA 4EEEB 4YOLA 41BIA 5BP5C 4I7IA 1T9FA 1S0GA 4J2SA 4XFSA 3FFZA 4LO1A 1CVSA 2IHOA 1BFGA 1XZZA 1V6UA 1L2HA 1TTUA 1BA7A 1JQZA 1JT7A 3FJAA 4ZFYB 5FZUA 4GOVA 4I4XA 4KC3A 4OUJA 2FFUA 3FJBA 1HWMB 4LO7B 1RMLA 3UJ4A 1JY0A 4LO8B 2VSAA 4HJJA 4GAIA 2K8RA 2XOAA 2F2FA 3D7WB 4ZLBB 1IT0A 1DZDA 3BRGC 3WO2A 4G9MA 1II4A 4ZKTB 1W3FA 4X39A 2KH2A 2LIEA 1FQ9A 4I4UA 3V0AA 2HWAA 4IQPA 2NM1A 4EFQA 3FJFA 3HBWA 4JQ0A 3ZXGA 1I1EA 1YXWA 1D0HA 4J2KA 4EFRA 2HZ9A 2ESUA 5DVHA 4EFPA 3V0BA 2WRYA 3F1RA 1TP0A 1YF8B 1HKNA 1QQLA 4FGFA 1UPSA 4IYBA 4ZGRB 4GP0A 4I4YA 4JRAA 1G9DA 4JAWA 5GAQA 4IHZA 21BIA 4II0A 3V79C 4QALA 3AH1A 3P53A 3OBTA 3I29B 1OQLB 4XFUA 2BFHA 3MALA 1BARA 1V6XA 3CRHA 1TWMA 1IILA 3O44A 3R4UA 3FJCA 4LO1C
chains in the Genus database with same CATH superfamily
3A23A 4OEFA 2DRZA 1Z4SA 2NVHA 5BXPA 3PG0A 4J2XA 4ZA3B 2RQ9A 1WBAA 3BX1C 3A07A 4QBVA 4DENA 2FDBM 2ZR1B 2F2FC 4I37A 4HA2A 3AKGA 4H9WA 1EPWA 4IZEA 3CA1A 3N7LA 2P23A 2AAIB 3BA5A 9ILBA 1FWVA 1XYFA 2DS0A 1T4QA 4MZHA 4WBCA 1AXMA 1RY7A 4USOA 4I8MA 4JPZA 3K1XA 3PUBA 2Y9XE 4L4HA 5FZYA 2IWTB 3V0AB 2X2SA 3VWCA 1N4KA 2MLLB 2FFVA 1RG8A 2Y9GA 1Q04A 4ISRA 2Q9XA 1G9BA 3A21A 3NBDA 2AXMA 1I1BA 3OBRA 3AKHA 2ZQNA 3ZXDA 1WD3A 2HW9A 4I3NA 1V6VA 4P6AA 3NBCA 3ZC9A 4X38A 3HALA 3Q7XA 1WD4A 1MD6A 5BXTA 4HR6C 1F31A 4IZXA 4D0TA 1AVWB 3Q7YA 4Q9GA 3NBNA 4G9NA 3OJVA 3FGMA 3EF2A 1FMZA 3UD7A 3UD9A 3AKFA 3LTQA 3BAQA 3CA3A 3T8SA 4LO7C 3IM5A 1R8OA 4D0ZA 1JLYA 4USPA 5BVPI 2K4AB 1G82A 4OW4A 3F62B 1IRAX 5G00A 5EHAA 1FV2A 3AJ6A 2D23A 3RSJA 1HCDA 4ZBVB 4KEKA 3BRDA 1DIWA 4P0LA 2D24A 5D63A 3TC2A 3FJEA 3HOMA 3FJJA 4X37A 4Q9PA 4QBCA 2D22A 2BEAA 1TWEA 3VUOA 2QYIB 5EC5A 3O4DA 1S0LA 3OJ2A 4G6JA 4F83A 3WMVA 3FJHA 4DEPA 3AZVA 1M2TB 3W9TA 1XG6A 2X2TA 4I4VA 1VCLA 2MC2A 2VUAA 5HPZA 2VU9A 1M16A 3POKA 1ISYA 3FJKA 3OGGA 1EVTA 1DZCA 1RZOB 1FGAA 3UDAA 1DFQA 3N7JA 2GZBA 1MC9A 3I2XA 5BXSA 4JP0A 4DCKC 3VT1A 4CJMA 1NZKA 2K43A 2KI6B 2R9KB 3FJ9A 4AN6A 1QXMA 1S0DA 5JLVA 2AQZA 4J23B 2VXRA 4I2SA 7I1BA 4ZFWB 3QYDA 3BAOA 3PMEA 1G9CA 1NUNA 3KMVA 1GGPB 3UD8A 4A7YA 5E24E 3AH4A 3ZX7A 8I1BA 2Q3NB 4OEEA 4LO3A 4I1EA 1JT5A 3A22A 1A8DA 5EG6C 1J0SA 3BAVA 3BA4A 5F8SA 2UUSA 5DZUA 1K5VA 4P0JA 3BAGA 1HWPB 3H6RB 3IM7A 4LO0C 2DREA 1SR4A 2VLCA 2AFGA 2FO1A 3PHZA 5JMCA 3FUQA 2ET2A 3IM6A 2Z49A 31BIA 4I4QA 3O49A 4D8HA 4GAFA 1V6WA 1W3GA 4PC4A 2LIQA 3RMXA 3BAHA 3BAUA 4ZOTA 2ERMA 5BXRA 2Y9FA 2KLLA 4Z8SB 1FN0A 1IHKA 3BADA 1DFCA 1S0FA 4J2YA 2BEBA 1BLAA 1YBIA 3WMUA 2KI4A 3O3QA 1FWUA 3VT2A 3WO4A 2D20A 1BFCA 5B2HA 4LO2A 2NS2A 3ZC8A 3CAHA 4QD2B 1TOOA 2ZQOA 1G9AA 3H6SE 4A7KA 1DJSB 5FZZA 1BFBA 4LO3C 5F90A 2Z48A 3IAGC 3OGFA 1PZZA 4I4SA 4IY9A 1BASA 1E0OA 1FV3A 3H6RA 4H04A 3QR5A 4I4OA 4OWLA 4UY4A 5I1BA 2YUGA 3BA7A 3CQAA 3RTIB 4ZFUB 4MZFB 3S8KA 6I1BA 5BQUC 1EV2A 1SR4C 3CRGA 1HWNB 1HCEA 1YYNA 5FNXA 1BLDA 4LO0A 1KNMA 3S8JA 1Q1UA 3CA0A 3CRIA 5FNWA 1SZ6B 2NTDA 1JTCA 2E4MA 2D43A 3AZWA 1CE7B 5DSSB 1ABRB 1Z0HA 3O5WB 4I96A 4Z9WB 3LLPA 3O4OA 5F8WA 1K5UA 4ISQA 3BB2A 1Z2VA 3N0KA 2HWMA 1XHBA 2D44A 1S0BA 4EKXB 3NJ5A 4QKSA 3CA6A 4QC4A 3UJ0A 1P63A 3SNVA 1DQGA 1DLLA 1HWOB 1S0CA 3VT0A 3IIRA 2D7IA 3CA5A 2NZ9A 4XKIA 1EYLA 4ENDA 3AJ5A 4I6IA 4KBBA 3MPPG 1AVXB 3WINA 4XFTA 3I2AA 1PUUB 3E8LC 1BFFA 3P6IA 4I4RA 4LO2C 4X3AA 1IJTA 5D61A 3C9ZA 4I1BA 3JRRA 3O4AA 3FJ8A 1S0EA 3AKIA 4JKXB 5F8YA 1FMMS 2D1ZA 3WO3A 2VSEA 3CU1B 4H75A 1R8NA 2Y9WC 4IY8A 1JT4A 3HMYA 1IOBA 3Q7WA 3HN1A 5BP5A 2P39A 4GP3A 3VSZA 1PUMB 3P6JA 1JLXA 3B9UA 3N7MA 3R4SA 3NBEA 3O4CA 4JKQA 3CA4A 1AF9A 1TIEA 4I4PA 1ISZA 1AVUA 2L5XA 3AH2A 2GO2A 5BQUA 3ILAA 2F8XC 3H6QA 1AVAC 1HIBA 1ISWA 2E4MC 3HSMA 1ISXA 2NYYA 1WBCA 1QQKA 2RG9B 3FJDA 4IONA 4G1RA 2WBCA 4AN7B 3RTJB 1IRPA 4R6UB 4EB2B 3OJMA 1JT3A 1PC8B 4OEGA 1ONKB 1PWAA 4A7ZA 2J3PA 4G6MA 2RSTA 2M49A 3FUOA 3VSFA 3N7KA 1ISVA 1DQOA 2FGFA 2DRYA 2D7RA 4P0KA 3WINC 5BOWA 3JUTA 3WA1A 3FJIA 4I0YA 3RMYA 1ILR1 2MIBA 4QD2C 4KEJA 5DUYA 2I1BA 1Q03A 3V0BB 2NP0A 4L4IA 2KKIA 4FVVA 3BRFA 4QKRA 4TLPA 3BTAA 5D62A 4QO3A 3O4BA 1ITBA 4Q91A 4OWJA 2VXTI 1W3AA 3VEQA 2QN4A 4F34A 1AFCA 4GOYA 4OWKA 1TFMB 4KEIA 1YTOA 4EEEB 4YOLA 41BIA 5BP5C 4I7IA 1T9FA 1S0GA 4J2SA 4XFSA 3FFZA 4MZGB 4LO1A 1CVSA 2IHOA 1BFGA 1XZZA 1V6UA 1L2HA 1TTUA 1BA7A 1JQZA 1JT7A 3FJAA 4ZFYB 5FZUA 4GOVA 4I4XA 4KC3A 4OUJA 2FFUA 3FJBA 1HWMB 4LO7B 1RMLA 3UJ4A 1JY0A 4LO8B 2VSAA 4HJJA 4GAIA 2K8RA 2XOAA 2F2FA 3D7WB 4ZLBB 1IT0A 1DZDA 3BRGC 3WO2A 4G9MA 1II4A 4ZKTB 1W3FA 4X39A 2KH2A 2LIEA 1FQ9A 4I4UA 3V0AA 2HWAA 4IQPA 2NM1A 4EFQA 3FJFA 3HBWA 4JQ0A 3ZXGA 1I1EA 1YXWA 1D0HA 4J2KA 4EFRA 2HZ9A 2ESUA 5DVHA 4EFPA 3V0BA 2WRYA 3F1RA 1TP0A 1YF8B 1HKNA 1QQLA 4FGFA 1UPSA 4IYBA 4ZGRB 4GP0A 4I4YA 4JRAA 1G9DA 4JAWA 5GAQA 4IHZA 21BIA 4II0A 3V79C 4QALA 3AH1A 3P53A 3OBTA 3I29B 1OQLB 4XFUA 2BFHA 3MALA 1BARA 1V6XA 3CRHA 1TWMA 1IILA 3O44A 3R4UA 3FJCA 4LO1C
chains in the Genus database with same CATH topology
3A23A 4OEFA 2DRZA 1Z4SA 2NVHA 5BXPA 3PG0A 4J2XA 4ZA3B 2RQ9A 1WBAA 3BX1C 3A07A 4QBVA 4DENA 2FDBM 2ZR1B 2F2FC 4I37A 4HA2A 3AKGA 4H9WA 1EPWA 4IZEA 3CA1A 3N7LA 2P23A 2AAIB 3BA5A 9ILBA 1FWVA 1XYFA 2DS0A 1T4QA 4MZHA 4WBCA 1AXMA 1RY7A 4USOA 4I8MA 4JPZA 3K1XA 3PUBA 2Y9XE 4L4HA 5FZYA 2IWTB 3V0AB 2X2SA 3VWCA 1N4KA 2MLLB 2FFVA 1RG8A 2Y9GA 1Q04A 4ISRA 2Q9XA 1G9BA 3A21A 3NBDA 2AXMA 1I1BA 3OBRA 3AKHA 2ZQNA 3ZXDA 1WD3A 2HW9A 4I3NA 1V6VA 4P6AA 3NBCA 3ZC9A 4X38A 3HALA 3Q7XA 1WD4A 1MD6A 5BXTA 4HR6C 1F31A 4IZXA 4D0TA 1AVWB 3Q7YA 4Q9GA 3NBNA 4G9NA 3OJVA 3FGMA 3EF2A 1FMZA 3UD7A 3UD9A 3AKFA 3LTQA 3BAQA 3CA3A 3T8SA 4LO7C 3IM5A 1R8OA 4D0ZA 1JLYA 4USPA 5BVPI 2K4AB 1G82A 4OW4A 3F62B 1IRAX 5G00A 5EHAA 1FV2A 3AJ6A 2D23A 3RSJA 1HCDA 4ZBVB 4KEKA 3BRDA 1DIWA 4P0LA 2D24A 5D63A 3TC2A 3FJEA 3HOMA 3FJJA 4X37A 4Q9PA 4QBCA 2D22A 2BEAA 1TWEA 3VUOA 2QYIB 5EC5A 3O4DA 1S0LA 3OJ2A 4G6JA 4F83A 3WMVA 3FJHA 4DEPA 3AZVA 1M2TB 3W9TA 1XG6A 2X2TA 4I4VA 1VCLA 2MC2A 2VUAA 5HPZA 2VU9A 1M16A 3POKA 1ISYA 3FJKA 3OGGA 1EVTA 1DZCA 1RZOB 1FGAA 3UDAA 1DFQA 3N7JA 2GZBA 1MC9A 3I2XA 5BXSA 4JP0A 4DCKC 3VT1A 4CJMA 1NZKA 2K43A 2KI6B 2R9KB 3FJ9A 4AN6A 1QXMA 1S0DA 5JLVA 2AQZA 4J23B 2VXRA 4I2SA 7I1BA 4ZFWB 3QYDA 3BAOA 3PMEA 1G9CA 1NUNA 3KMVA 1GGPB 3UD8A 4A7YA 5E24E 3AH4A 3ZX7A 8I1BA 2Q3NB 4OEEA 4LO3A 4I1EA 1JT5A 3A22A 1A8DA 5EG6C 1J0SA 3BAVA 3BA4A 5F8SA 2UUSA 5DZUA 1K5VA 4P0JA 3BAGA 1HWPB 3H6RB 3IM7A 4LO0C 2DREA 1SR4A 2VLCA 2AFGA 2FO1A 3PHZA 5JMCA 3FUQA 2ET2A 3IM6A 2Z49A 31BIA 4I4QA 3O49A 4D8HA 4GAFA 1V6WA 1W3GA 4PC4A 2LIQA 3RMXA 3BAHA 3BAUA 4ZOTA 2ERMA 5BXRA 2Y9FA 2KLLA 4Z8SB 1FN0A 1IHKA 3BADA 1DFCA 1S0FA 4J2YA 2BEBA 1BLAA 1YBIA 3WMUA 2KI4A 3O3QA 1FWUA 3VT2A 3WO4A 2D20A 1BFCA 5B2HA 4LO2A 2NS2A 3ZC8A 3CAHA 4QD2B 1TOOA 2ZQOA 1G9AA 3H6SE 4A7KA 1DJSB 5FZZA 1BFBA 4LO3C 5F90A 2Z48A 3IAGC 3OGFA 1PZZA 4I4SA 4IY9A 1BASA 1E0OA 1FV3A 3H6RA 4H04A 3QR5A 4I4OA 4OWLA 4UY4A 5I1BA 2YUGA 3BA7A 3CQAA 3RTIB 4ZFUB 4MZFB 3S8KA 6I1BA 5BQUC 1EV2A 1SR4C 3CRGA 1HWNB 1HCEA 1YYNA 5FNXA 1BLDA 4LO0A 1KNMA 3S8JA 1Q1UA 3CA0A 3CRIA 5FNWA 1SZ6B 2NTDA 1JTCA 2E4MA 2D43A 3AZWA 1CE7B 5DSSB 1ABRB 1Z0HA 3O5WB 4I96A 4Z9WB 3LLPA 3O4OA 5F8WA 1K5UA 4ISQA 3BB2A 1Z2VA 3N0KA 2HWMA 1XHBA 2D44A 1S0BA 4EKXB 3NJ5A 4QKSA 3CA6A 4QC4A 3UJ0A 1P63A 3SNVA 1DQGA 1DLLA 1HWOB 1S0CA 3VT0A 3IIRA 2D7IA 3CA5A 2NZ9A 4XKIA 1EYLA 4ENDA 3AJ5A 4I6IA 4KBBA 3MPPG 1AVXB 3WINA 4XFTA 3I2AA 1PUUB 3E8LC 1BFFA 3P6IA 4I4RA 4LO2C 4X3AA 1IJTA 5D61A 3C9ZA 4I1BA 3JRRA 3O4AA 3FJ8A 1S0EA 3AKIA 4JKXB 5F8YA 1FMMS 2D1ZA 3WO3A 2VSEA 3CU1B 4H75A 1R8NA 2Y9WC 4IY8A 1JT4A 3HMYA 1IOBA 3Q7WA 3HN1A 5BP5A 2P39A 4GP3A 3VSZA 1PUMB 3P6JA 1JLXA 3B9UA 3N7MA 3R4SA 3NBEA 3O4CA 4JKQA 3CA4A 1AF9A 1TIEA 4I4PA 1ISZA 1AVUA 2L5XA 3AH2A 2GO2A 5BQUA 3ILAA 2F8XC 3H6QA 1AVAC 1HIBA 1ISWA 2E4MC 3HSMA 1ISXA 2NYYA 1WBCA 1QQKA 2RG9B 3FJDA 4IONA 4G1RA 2WBCA 4AN7B 3RTJB 1IRPA 4R6UB 4EB2B 3OJMA 1JT3A 1PC8B 4OEGA 1ONKB 1PWAA 4A7ZA 2J3PA 4G6MA 2RSTA 2M49A 3FUOA 3VSFA 3N7KA 1ISVA 1DQOA 2FGFA 2DRYA 2D7RA 4P0KA 3WINC 5BOWA 3JUTA 3WA1A 3FJIA 4I0YA 3RMYA 1ILR1 2MIBA 4QD2C 4KEJA 5DUYA 2I1BA 1Q03A 3V0BB 2NP0A 4L4IA 2KKIA 4FVVA 3BRFA 4QKRA 4TLPA 3BTAA 5D62A 4QO3A 3O4BA 1ITBA 4Q91A 4OWJA 2VXTI 1W3AA 3VEQA 2QN4A 4F34A 1AFCA 4GOYA 4OWKA 1TFMB 4KEIA 1YTOA 4EEEB 4YOLA 41BIA 5BP5C 4I7IA 1T9FA 1S0GA 4J2SA 4XFSA 3FFZA 4MZGB 4LO1A 1CVSA 2IHOA 1BFGA 1XZZA 1V6UA 1L2HA 1TTUA 1BA7A 1JQZA 1JT7A 3FJAA 4ZFYB 5FZUA 4GOVA 4I4XA 4KC3A 4OUJA 2FFUA 3FJBA 1HWMB 4LO7B 1RMLA 3UJ4A 1JY0A 4LO8B 2VSAA 4HJJA 4GAIA 2K8RA 2XOAA 2F2FA 3D7WB 4ZLBB 1IT0A 1DZDA 3BRGC 3WO2A 4G9MA 1II4A 4ZKTB 1W3FA 4X39A 2KH2A 2LIEA 1FQ9A 4I4UA 3V0AA 2HWAA 4IQPA 2NM1A 4EFQA 3FJFA 3HBWA 4JQ0A 3ZXGA 1I1EA 1YXWA 1D0HA 4J2KA 4EFRA 2HZ9A 2ESUA 5DVHA 4EFPA 3V0BA 2WRYA 3F1RA 1TP0A 1YF8B 1HKNA 1QQLA 4FGFA 1UPSA 4IYBA 4ZGRB 4GP0A 4I4YA 4JRAA 1G9DA 4JAWA 5GAQA 4IHZA 21BIA 4II0A 3V79C 4QALA 3AH1A 3P53A 3OBTA 3I29B 1OQLB 4XFUA 2BFHA 3MALA 1BARA 1V6XA 3CRHA 1TWMA 1IILA 3O44A 3R4UA 3FJCA 4LO1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A23 A;  4OEF A;  2DRZ A;  1Z4S A;  2NVH A;  5BXP A;  3PG0 A;  4J2X A;  4ZA3 B;  2RQ9 A;  1WBA A;  3BX1 C;  3A07 A;  4QBV A;  4DEN A;  2FDB M;  2ZR1 B;  2F2F C;  4I37 A;  4HA2 A;  3AKG A;  4H9W A;  1EPW A;  4IZE A;  3CA1 A;  3N7L A;  2P23 A;  2AAI B;  3BA5 A;  9ILB A;  1FWV A;  1XYF A;  2DS0 A;  1T4Q A;  4WBC A;  1AXM A;  1RY7 A;  4USO A;  4I8M A;  4JPZ A;  3K1X A;  3PUB A;  2Y9X E;  4L4H A;  5FZY A;  2IWT B;  3V0A B;  2X2S A;  3VWC A;  1N4K A;  2MLL B;  2FFV A;  1RG8 A;  2Y9G A;  1Q04 A;  4ISR A;  2Q9X A;  1G9B A;  3A21 A;  3NBD A;  2AXM A;  1I1B A;  3OBR A;  3AKH A;  2ZQN A;  3ZXD A;  1WD3 A;  2HW9 A;  4I3N A;  1V6V A;  4P6A A;  3NBC A;  3ZC9 A;  4X38 A;  3HAL A;  3Q7X A;  1WD4 A;  1MD6 A;  5BXT A;  4HR6 C;  1F31 A;  4IZX A;  4D0T A;  1AVW B;  3Q7Y A;  4Q9G A;  3NBN A;  4G9N A;  3OJV A;  3FGM A;  3EF2 A;  1FMZ A;  3UD7 A;  3UD9 A;  3AKF A;  3LTQ A;  3BAQ A;  3CA3 A;  3T8S A;  4LO7 C;  3IM5 A;  1R8O A;  4D0Z A;  1JLY A;  4USP A;  5BVP I;  2K4A B;  1G82 A;  4OW4 A;  3F62 B;  1IRA X;  5G00 A;  5EHA A;  1FV2 A;  3AJ6 A;  2D23 A;  3RSJ A;  1HCD A;  4ZBV B;  4KEK A;  3BRD A;  1DIW A;  4P0L A;  2D24 A;  5D63 A;  3TC2 A;  3FJE A;  3HOM A;  3FJJ A;  4X37 A;  4Q9P A;  4QBC A;  2D22 A;  2BEA A;  1TWE A;  3VUO A;  2QYI B;  5EC5 A;  3O4D A;  1S0L A;  3OJ2 A;  4G6J A;  4F83 A;  3WMV A;  3FJH A;  4DEP A;  3AZV A;  1M2T B;  3W9T A;  1XG6 A;  2X2T A;  4I4V A;  1VCL A;  2MC2 A;  2VUA A;  5HPZ A;  2VU9 A;  1M16 A;  3POK A;  1ISY A;  3FJK A;  3OGG A;  1EVT A;  1DZC A;  1RZO B;  1FGA A;  3UDA A;  1DFQ A;  3N7J A;  2GZB A;  1MC9 A;  3I2X A;  5BXS A;  4JP0 A;  4DCK C;  3VT1 A;  4CJM A;  1NZK A;  2K43 A;  2KI6 B;  2R9K B;  3FJ9 A;  4AN6 A;  1QXM A;  1S0D A;  5JLV A;  2AQZ A;  4J23 B;  2VXR A;  4I2S A;  7I1B A;  4ZFW B;  3QYD A;  3BAO A;  3PME A;  1G9C A;  1NUN A;  3KMV A;  1GGP B;  3UD8 A;  4A7Y A;  5E24 E;  3AH4 A;  3ZX7 A;  8I1B A;  2Q3N B;  4OEE A;  4LO3 A;  4I1E A;  1JT5 A;  3A22 A;  1A8D A;  5EG6 C;  1J0S A;  3BAV A;  3BA4 A;  5F8S A;  2UUS A;  5DZU A;  1K5V A;  4P0J A;  3BAG A;  1HWP B;  3H6R B;  3IM7 A;  4LO0 C;  2DRE A;  1SR4 A;  2VLC A;  2AFG A;  2FO1 A;  3PHZ A;  5JMC A;  3FUQ A;  2ET2 A;  3IM6 A;  2Z49 A;  31BI A;  4I4Q A;  3O49 A;  4D8H A;  4GAF A;  1V6W A;  1W3G A;  4PC4 A;  2LIQ A;  3RMX A;  3BAH A;  3BAU A;  4ZOT A;  2ERM A;  5BXR A;  2Y9F A;  2KLL A;  4Z8S B;  1FN0 A;  1IHK A;  3BAD A;  1DFC A;  1S0F A;  4J2Y A;  2BEB A;  1BLA A;  1YBI A;  3WMU A;  2KI4 A;  3O3Q A;  1FWU A;  3VT2 A;  3WO4 A;  2D20 A;  1BFC A;  5B2H A;  4LO2 A;  3ZC8 A;  3CAH A;  4QD2 B;  1TOO A;  2ZQO A;  1G9A A;  3H6S E;  4A7K A;  1DJS B;  5FZZ A;  1BFB A;  4LO3 C;  5F90 A;  2Z48 A;  3IAG C;  3OGF A;  1PZZ A;  4I4S A;  4IY9 A;  1BAS A;  1E0O A;  1FV3 A;  3H6R A;  4H04 A;  3QR5 A;  4I4O A;  4OWL A;  5I1B A;  2YUG A;  3BA7 A;  3CQA A;  3RTI B;  4ZFU B;  3S8K A;  6I1B A;  5BQU C;  1EV2 A;  1SR4 C;  3CRG A;  1HWN B;  1HCE A;  1YYN A;  5FNX A;  1BLD A;  4LO0 A;  1KNM A;  3S8J A;  1Q1U A;  3CA0 A;  3CRI A;  5FNW A;  1SZ6 B;  2NTD A;  1JTC A;  2E4M A;  2D43 A;  3AZW A;  1CE7 B;  5DSS B;  1ABR B;  1Z0H A;  3O5W B;  4I96 A;  4Z9W B;  3LLP A;  3O4O A;  5F8W A;  1K5U A;  4ISQ A;  3BB2 A;  1Z2V A;  3N0K A;  2HWM A;  1XHB A;  2D44 A;  1S0B A;  4EKX B;  3NJ5 A;  4QKS A;  3CA6 A;  4QC4 A;  3UJ0 A;  1P63 A;  3SNV A;  1DQG A;  1DLL A;  1HWO B;  1S0C A;  3VT0 A;  3IIR A;  2D7I A;  3CA5 A;  2NZ9 A;  4XKI A;  1EYL A;  4END A;  3AJ5 A;  4I6I A;  4KBB A;  3MPP G;  1AVX B;  3WIN A;  4XFT A;  3I2A A;  1PUU B;  3E8L C;  1BFF A;  3P6I A;  4I4R A;  4LO2 C;  4X3A A;  1IJT A;  5D61 A;  3C9Z A;  4I1B A;  3JRR A;  3O4A A;  3FJ8 A;  1S0E A;  3AKI A;  4JKX B;  5F8Y A;  1FMM S;  2D1Z A;  3WO3 A;  2VSE A;  3CU1 B;  1R8N A;  2Y9W C;  4IY8 A;  1JT4 A;  3HMY A;  1IOB A;  3Q7W A;  3HN1 A;  5BP5 A;  2P39 A;  4GP3 A;  3VSZ A;  1PUM B;  3P6J A;  1JLX A;  3B9U A;  3N7M A;  3R4S A;  3NBE A;  3O4C A;  4JKQ A;  3CA4 A;  1AF9 A;  1TIE A;  4I4P A;  1ISZ A;  1AVU A;  2L5X A;  3AH2 A;  2GO2 A;  5BQU A;  3ILA A;  2F8X C;  3H6Q A;  1AVA C;  1HIB A;  1ISW A;  2E4M C;  3HSM A;  1ISX A;  2NYY A;  1WBC A;  1QQK A;  2RG9 B;  3FJD A;  4ION A;  4G1R A;  2WBC A;  4AN7 B;  3RTJ B;  1IRP A;  4R6U B;  4EB2 B;  3OJM A;  1JT3 A;  1PC8 B;  4OEG A;  1ONK B;  1PWA A;  4A7Z A;  2J3P A;  4G6M A;  2RST A;  2M49 A;  3FUO A;  3VSF A;  3N7K A;  1ISV A;  1DQO A;  2FGF A;  2DRY A;  2D7R A;  4P0K A;  3WIN C;  5BOW A;  3JUT A;  3WA1 A;  3FJI A;  4I0Y A;  3RMY A;  1ILR 1;  2MIB A;  4QD2 C;  4KEJ A;  5DUY A;  2I1B A;  1Q03 A;  3V0B B;  2NP0 A;  4L4I A;  2KKI A;  4FVV A;  3BRF A;  4QKR A;  4TLP A;  3BTA A;  5D62 A;  4QO3 A;  3O4B A;  1ITB A;  4Q91 A;  4OWJ A;  2VXT I;  1W3A A;  3VEQ A;  2QN4 A;  4F34 A;  1AFC A;  4GOY A;  4OWK A;  1TFM B;  4KEI A;  1YTO A;  4EEE B;  4YOL A;  41BI A;  5BP5 C;  4I7I A;  1T9F A;  1S0G A;  4J2S A;  4XFS A;  3FFZ A;  4LO1 A;  1CVS A;  2IHO A;  1BFG A;  1XZZ A;  1V6U A;  1L2H A;  1TTU A;  1BA7 A;  1JQZ A;  1JT7 A;  3FJA A;  4ZFY B;  5FZU A;  4GOV A;  4I4X A;  4KC3 A;  4OUJ A;  2FFU A;  3FJB A;  1HWM B;  4LO7 B;  1RML A;  3UJ4 A;  1JY0 A;  4LO8 B;  2VSA A;  4HJJ A;  4GAI A;  2K8R A;  2XOA A;  2F2F A;  3D7W B;  4ZLB B;  1IT0 A;  1DZD A;  3BRG C;  3WO2 A;  4G9M A;  1II4 A;  4ZKT B;  1W3F A;  4X39 A;  2KH2 A;  2LIE A;  1FQ9 A;  4I4U A;  3V0A A;  2HWA A;  4IQP A;  2NM1 A;  4EFQ A;  3FJF A;  3HBW A;  4JQ0 A;  3ZXG A;  1I1E A;  1YXW A;  1D0H A;  4J2K A;  4EFR A;  2HZ9 A;  2ESU A;  5DVH A;  4EFP A;  3V0B A;  2WRY A;  3F1R A;  1TP0 A;  1YF8 B;  1HKN A;  1QQL A;  4FGF A;  1UPS A;  4IYB A;  4ZGR B;  4GP0 A;  4I4Y A;  4JRA A;  1G9D A;  4JAW A;  5GAQ A;  4IHZ A;  21BI A;  4II0 A;  3V79 C;  4QAL A;  3AH1 A;  3P53 A;  3OBT A;  3I29 B;  1OQL B;  4XFU A;  2BFH A;  3MAL A;  1BAR A;  1V6X A;  3CRH A;  1TWM A;  1IIL A;  3O44 A;  3R4U A;  3FJC A;  4LO1 C; 
#chains in the Genus database with same CATH topology
 3A23 A;  4OEF A;  2DRZ A;  1Z4S A;  2NVH A;  5BXP A;  3PG0 A;  4J2X A;  4ZA3 B;  2RQ9 A;  1WBA A;  3BX1 C;  3A07 A;  4QBV A;  4DEN A;  2FDB M;  2ZR1 B;  2F2F C;  4I37 A;  4HA2 A;  3AKG A;  4H9W A;  1EPW A;  4IZE A;  3CA1 A;  3N7L A;  2P23 A;  2AAI B;  3BA5 A;  9ILB A;  1FWV A;  1XYF A;  2DS0 A;  1T4Q A;  4MZH A;  4WBC A;  1AXM A;  1RY7 A;  4USO A;  4I8M A;  4JPZ A;  3K1X A;  3PUB A;  2Y9X E;  4L4H A;  5FZY A;  2IWT B;  3V0A B;  2X2S A;  3VWC A;  1N4K A;  2MLL B;  2FFV A;  1RG8 A;  2Y9G A;  1Q04 A;  4ISR A;  2Q9X A;  1G9B A;  3A21 A;  3NBD A;  2AXM A;  1I1B A;  3OBR A;  3AKH A;  2ZQN A;  3ZXD A;  1WD3 A;  2HW9 A;  4I3N A;  1V6V A;  4P6A A;  3NBC A;  3ZC9 A;  4X38 A;  3HAL A;  3Q7X A;  1WD4 A;  1MD6 A;  5BXT A;  4HR6 C;  1F31 A;  4IZX A;  4D0T A;  1AVW B;  3Q7Y A;  4Q9G A;  3NBN A;  4G9N A;  3OJV A;  3FGM A;  3EF2 A;  1FMZ A;  3UD7 A;  3UD9 A;  3AKF A;  3LTQ A;  3BAQ A;  3CA3 A;  3T8S A;  4LO7 C;  3IM5 A;  1R8O A;  4D0Z A;  1JLY A;  4USP A;  5BVP I;  2K4A B;  1G82 A;  4OW4 A;  3F62 B;  1IRA X;  5G00 A;  5EHA A;  1FV2 A;  3AJ6 A;  2D23 A;  3RSJ A;  1HCD A;  4ZBV B;  4KEK A;  3BRD A;  1DIW A;  4P0L A;  2D24 A;  5D63 A;  3TC2 A;  3FJE A;  3HOM A;  3FJJ A;  4X37 A;  4Q9P A;  4QBC A;  2D22 A;  2BEA A;  1TWE A;  3VUO A;  2QYI B;  5EC5 A;  3O4D A;  1S0L A;  3OJ2 A;  4G6J A;  4F83 A;  3WMV A;  3FJH A;  4DEP A;  3AZV A;  1M2T B;  3W9T A;  1XG6 A;  2X2T A;  4I4V A;  1VCL A;  2MC2 A;  2VUA A;  5HPZ A;  2VU9 A;  1M16 A;  3POK A;  1ISY A;  3FJK A;  3OGG A;  1EVT A;  1DZC A;  1RZO B;  1FGA A;  3UDA A;  1DFQ A;  3N7J A;  2GZB A;  1MC9 A;  3I2X A;  5BXS A;  4JP0 A;  4DCK C;  3VT1 A;  4CJM A;  1NZK A;  2K43 A;  2KI6 B;  2R9K B;  3FJ9 A;  4AN6 A;  1QXM A;  1S0D A;  5JLV A;  2AQZ A;  4J23 B;  2VXR A;  4I2S A;  7I1B A;  4ZFW B;  3QYD A;  3BAO A;  3PME A;  1G9C A;  1NUN A;  3KMV A;  1GGP B;  3UD8 A;  4A7Y A;  5E24 E;  3AH4 A;  3ZX7 A;  8I1B A;  2Q3N B;  4OEE A;  4LO3 A;  4I1E A;  1JT5 A;  3A22 A;  1A8D A;  5EG6 C;  1J0S A;  3BAV A;  3BA4 A;  5F8S A;  2UUS A;  5DZU A;  1K5V A;  4P0J A;  3BAG A;  1HWP B;  3H6R B;  3IM7 A;  4LO0 C;  2DRE A;  1SR4 A;  2VLC A;  2AFG A;  2FO1 A;  3PHZ A;  5JMC A;  3FUQ A;  2ET2 A;  3IM6 A;  2Z49 A;  31BI A;  4I4Q A;  3O49 A;  4D8H A;  4GAF A;  1V6W A;  1W3G A;  4PC4 A;  2LIQ A;  3RMX A;  3BAH A;  3BAU A;  4ZOT A;  2ERM A;  5BXR A;  2Y9F A;  2KLL A;  4Z8S B;  1FN0 A;  1IHK A;  3BAD A;  1DFC A;  1S0F A;  4J2Y A;  2BEB A;  1BLA A;  1YBI A;  3WMU A;  2KI4 A;  3O3Q A;  1FWU A;  3VT2 A;  3WO4 A;  2D20 A;  1BFC A;  5B2H A;  4LO2 A;  2NS2 A;  3ZC8 A;  3CAH A;  4QD2 B;  1TOO A;  2ZQO A;  1G9A A;  3H6S E;  4A7K A;  1DJS B;  5FZZ A;  1BFB A;  4LO3 C;  5F90 A;  2Z48 A;  3IAG C;  3OGF A;  1PZZ A;  4I4S A;  4IY9 A;  1BAS A;  1E0O A;  1FV3 A;  3H6R A;  4H04 A;  3QR5 A;  4I4O A;  4OWL A;  4UY4 A;  5I1B A;  2YUG A;  3BA7 A;  3CQA A;  3RTI B;  4ZFU B;  4MZF B;  3S8K A;  6I1B A;  5BQU C;  1EV2 A;  1SR4 C;  3CRG A;  1HWN B;  1HCE A;  1YYN A;  5FNX A;  1BLD A;  4LO0 A;  1KNM A;  3S8J A;  1Q1U A;  3CA0 A;  3CRI A;  5FNW A;  1SZ6 B;  2NTD A;  1JTC A;  2E4M A;  2D43 A;  3AZW A;  1CE7 B;  5DSS B;  1ABR B;  1Z0H A;  3O5W B;  4I96 A;  4Z9W B;  3LLP A;  3O4O A;  5F8W A;  1K5U A;  4ISQ A;  3BB2 A;  1Z2V A;  3N0K A;  2HWM A;  1XHB A;  2D44 A;  1S0B A;  4EKX B;  3NJ5 A;  4QKS A;  3CA6 A;  4QC4 A;  3UJ0 A;  1P63 A;  3SNV A;  1DQG A;  1DLL A;  1HWO B;  1S0C A;  3VT0 A;  3IIR A;  2D7I A;  3CA5 A;  2NZ9 A;  4XKI A;  1EYL A;  4END A;  3AJ5 A;  4I6I A;  4KBB A;  3MPP G;  1AVX B;  3WIN A;  4XFT A;  3I2A A;  1PUU B;  3E8L C;  1BFF A;  3P6I A;  4I4R A;  4LO2 C;  4X3A A;  1IJT A;  5D61 A;  3C9Z A;  4I1B A;  3JRR A;  3O4A A;  3FJ8 A;  1S0E A;  3AKI A;  4JKX B;  5F8Y A;  1FMM S;  2D1Z A;  3WO3 A;  2VSE A;  3CU1 B;  4H75 A;  1R8N A;  2Y9W C;  4IY8 A;  1JT4 A;  3HMY A;  1IOB A;  3Q7W A;  3HN1 A;  5BP5 A;  2P39 A;  4GP3 A;  3VSZ A;  1PUM B;  3P6J A;  1JLX A;  3B9U A;  3N7M A;  3R4S A;  3NBE A;  3O4C A;  4JKQ A;  3CA4 A;  1AF9 A;  1TIE A;  4I4P A;  1ISZ A;  1AVU A;  2L5X A;  3AH2 A;  2GO2 A;  5BQU A;  3ILA A;  2F8X C;  3H6Q A;  1AVA C;  1HIB A;  1ISW A;  2E4M C;  3HSM A;  1ISX A;  2NYY A;  1WBC A;  1QQK A;  2RG9 B;  3FJD A;  4ION A;  4G1R A;  2WBC A;  4AN7 B;  3RTJ B;  1IRP A;  4R6U B;  4EB2 B;  3OJM A;  1JT3 A;  1PC8 B;  4OEG A;  1ONK B;  1PWA A;  4A7Z A;  2J3P A;  4G6M A;  2RST A;  2M49 A;  3FUO A;  3VSF A;  3N7K A;  1ISV A;  1DQO A;  2FGF A;  2DRY A;  2D7R A;  4P0K A;  3WIN C;  5BOW A;  3JUT A;  3WA1 A;  3FJI A;  4I0Y A;  3RMY A;  1ILR 1;  2MIB A;  4QD2 C;  4KEJ A;  5DUY A;  2I1B A;  1Q03 A;  3V0B B;  2NP0 A;  4L4I A;  2KKI A;  4FVV A;  3BRF A;  4QKR A;  4TLP A;  3BTA A;  5D62 A;  4QO3 A;  3O4B A;  1ITB A;  4Q91 A;  4OWJ A;  2VXT I;  1W3A A;  3VEQ A;  2QN4 A;  4F34 A;  1AFC A;  4GOY A;  4OWK A;  1TFM B;  4KEI A;  1YTO A;  4EEE B;  4YOL A;  41BI A;  5BP5 C;  4I7I A;  1T9F A;  1S0G A;  4J2S A;  4XFS A;  3FFZ A;  4MZG B;  4LO1 A;  1CVS A;  2IHO A;  1BFG A;  1XZZ A;  1V6U A;  1L2H A;  1TTU A;  1BA7 A;  1JQZ A;  1JT7 A;  3FJA A;  4ZFY B;  5FZU A;  4GOV A;  4I4X A;  4KC3 A;  4OUJ A;  2FFU A;  3FJB A;  1HWM B;  4LO7 B;  1RML A;  3UJ4 A;  1JY0 A;  4LO8 B;  2VSA A;  4HJJ A;  4GAI A;  2K8R A;  2XOA A;  2F2F A;  3D7W B;  4ZLB B;  1IT0 A;  1DZD A;  3BRG C;  3WO2 A;  4G9M A;  1II4 A;  4ZKT B;  1W3F A;  4X39 A;  2KH2 A;  2LIE A;  1FQ9 A;  4I4U A;  3V0A A;  2HWA A;  4IQP A;  2NM1 A;  4EFQ A;  3FJF A;  3HBW A;  4JQ0 A;  3ZXG A;  1I1E A;  1YXW A;  1D0H A;  4J2K A;  4EFR A;  2HZ9 A;  2ESU A;  5DVH A;  4EFP A;  3V0B A;  2WRY A;  3F1R A;  1TP0 A;  1YF8 B;  1HKN A;  1QQL A;  4FGF A;  1UPS A;  4IYB A;  4ZGR B;  4GP0 A;  4I4Y A;  4JRA A;  1G9D A;  4JAW A;  5GAQ A;  4IHZ A;  21BI A;  4II0 A;  3V79 C;  4QAL A;  3AH1 A;  3P53 A;  3OBT A;  3I29 B;  1OQL B;  4XFU A;  2BFH A;  3MAL A;  1BAR A;  1V6X A;  3CRH A;  1TWM A;  1IIL A;  3O44 A;  3R4U A;  3FJC A;  4LO1 C; 
#chains in the Genus database with same CATH homology
 3A23 A;  4OEF A;  2DRZ A;  1Z4S A;  2NVH A;  5BXP A;  3PG0 A;  4J2X A;  4ZA3 B;  2RQ9 A;  1WBA A;  3BX1 C;  3A07 A;  4QBV A;  4DEN A;  2FDB M;  2ZR1 B;  2F2F C;  4I37 A;  4HA2 A;  3AKG A;  4H9W A;  1EPW A;  4IZE A;  3CA1 A;  3N7L A;  2P23 A;  2AAI B;  3BA5 A;  9ILB A;  1FWV A;  1XYF A;  2DS0 A;  1T4Q A;  4MZH A;  4WBC A;  1AXM A;  1RY7 A;  4USO A;  4I8M A;  4JPZ A;  3K1X A;  3PUB A;  2Y9X E;  4L4H A;  5FZY A;  2IWT B;  3V0A B;  2X2S A;  3VWC A;  1N4K A;  2MLL B;  2FFV A;  1RG8 A;  2Y9G A;  1Q04 A;  4ISR A;  2Q9X A;  1G9B A;  3A21 A;  3NBD A;  2AXM A;  1I1B A;  3OBR A;  3AKH A;  2ZQN A;  3ZXD A;  1WD3 A;  2HW9 A;  4I3N A;  1V6V A;  4P6A A;  3NBC A;  3ZC9 A;  4X38 A;  3HAL A;  3Q7X A;  1WD4 A;  1MD6 A;  5BXT A;  4HR6 C;  1F31 A;  4IZX A;  4D0T A;  1AVW B;  3Q7Y A;  4Q9G A;  3NBN A;  4G9N A;  3OJV A;  3FGM A;  3EF2 A;  1FMZ A;  3UD7 A;  3UD9 A;  3AKF A;  3LTQ A;  3BAQ A;  3CA3 A;  3T8S A;  4LO7 C;  3IM5 A;  1R8O A;  4D0Z A;  1JLY A;  4USP A;  5BVP I;  2K4A B;  1G82 A;  4OW4 A;  3F62 B;  1IRA X;  5G00 A;  5EHA A;  1FV2 A;  3AJ6 A;  2D23 A;  3RSJ A;  1HCD A;  4ZBV B;  4KEK A;  3BRD A;  1DIW A;  4P0L A;  2D24 A;  5D63 A;  3TC2 A;  3FJE A;  3HOM A;  3FJJ A;  4X37 A;  4Q9P A;  4QBC A;  2D22 A;  2BEA A;  1TWE A;  3VUO A;  2QYI B;  5EC5 A;  3O4D A;  1S0L A;  3OJ2 A;  4G6J A;  4F83 A;  3WMV A;  3FJH A;  4DEP A;  3AZV A;  1M2T B;  3W9T A;  1XG6 A;  2X2T A;  4I4V A;  1VCL A;  2MC2 A;  2VUA A;  5HPZ A;  2VU9 A;  1M16 A;  3POK A;  1ISY A;  3FJK A;  3OGG A;  1EVT A;  1DZC A;  1RZO B;  1FGA A;  3UDA A;  1DFQ A;  3N7J A;  2GZB A;  1MC9 A;  3I2X A;  5BXS A;  4JP0 A;  4DCK C;  3VT1 A;  4CJM A;  1NZK A;  2K43 A;  2KI6 B;  2R9K B;  3FJ9 A;  4AN6 A;  1QXM A;  1S0D A;  5JLV A;  2AQZ A;  4J23 B;  2VXR A;  4I2S A;  7I1B A;  4ZFW B;  3QYD A;  3BAO A;  3PME A;  1G9C A;  1NUN A;  3KMV A;  1GGP B;  3UD8 A;  4A7Y A;  5E24 E;  3AH4 A;  3ZX7 A;  8I1B A;  2Q3N B;  4OEE A;  4LO3 A;  4I1E A;  1JT5 A;  3A22 A;  1A8D A;  5EG6 C;  1J0S A;  3BAV A;  3BA4 A;  5F8S A;  2UUS A;  5DZU A;  1K5V A;  4P0J A;  3BAG A;  1HWP B;  3H6R B;  3IM7 A;  4LO0 C;  2DRE A;  1SR4 A;  2VLC A;  2AFG A;  2FO1 A;  3PHZ A;  5JMC A;  3FUQ A;  2ET2 A;  3IM6 A;  2Z49 A;  31BI A;  4I4Q A;  3O49 A;  4D8H A;  4GAF A;  1V6W A;  1W3G A;  4PC4 A;  2LIQ A;  3RMX A;  3BAH A;  3BAU A;  4ZOT A;  2ERM A;  5BXR A;  2Y9F A;  2KLL A;  4Z8S B;  1FN0 A;  1IHK A;  3BAD A;  1DFC A;  1S0F A;  4J2Y A;  2BEB A;  1BLA A;  1YBI A;  3WMU A;  2KI4 A;  3O3Q A;  1FWU A;  3VT2 A;  3WO4 A;  2D20 A;  1BFC A;  5B2H A;  4LO2 A;  2NS2 A;  3ZC8 A;  3CAH A;  4QD2 B;  1TOO A;  2ZQO A;  1G9A A;  3H6S E;  4A7K A;  1DJS B;  5FZZ A;  1BFB A;  4LO3 C;  5F90 A;  2Z48 A;  3IAG C;  3OGF A;  1PZZ A;  4I4S A;  4IY9 A;  1BAS A;  1E0O A;  1FV3 A;  3H6R A;  4H04 A;  3QR5 A;  4I4O A;  4OWL A;  4UY4 A;  5I1B A;  2YUG A;  3BA7 A;  3CQA A;  3RTI B;  4ZFU B;  4MZF B;  3S8K A;  6I1B A;  5BQU C;  1EV2 A;  1SR4 C;  3CRG A;  1HWN B;  1HCE A;  1YYN A;  5FNX A;  1BLD A;  4LO0 A;  1KNM A;  3S8J A;  1Q1U A;  3CA0 A;  3CRI A;  5FNW A;  1SZ6 B;  2NTD A;  1JTC A;  2E4M A;  2D43 A;  3AZW A;  1CE7 B;  5DSS B;  1ABR B;  1Z0H A;  3O5W B;  4I96 A;  4Z9W B;  3LLP A;  3O4O A;  5F8W A;  1K5U A;  4ISQ A;  3BB2 A;  1Z2V A;  3N0K A;  2HWM A;  1XHB A;  2D44 A;  1S0B A;  4EKX B;  3NJ5 A;  4QKS A;  3CA6 A;  4QC4 A;  3UJ0 A;  1P63 A;  3SNV A;  1DQG A;  1DLL A;  1HWO B;  1S0C A;  3VT0 A;  3IIR A;  2D7I A;  3CA5 A;  2NZ9 A;  4XKI A;  1EYL A;  4END A;  3AJ5 A;  4I6I A;  4KBB A;  3MPP G;  1AVX B;  3WIN A;  4XFT A;  3I2A A;  1PUU B;  3E8L C;  1BFF A;  3P6I A;  4I4R A;  4LO2 C;  4X3A A;  1IJT A;  5D61 A;  3C9Z A;  4I1B A;  3JRR A;  3O4A A;  3FJ8 A;  1S0E A;  3AKI A;  4JKX B;  5F8Y A;  1FMM S;  2D1Z A;  3WO3 A;  2VSE A;  3CU1 B;  4H75 A;  1R8N A;  2Y9W C;  4IY8 A;  1JT4 A;  3HMY A;  1IOB A;  3Q7W A;  3HN1 A;  5BP5 A;  2P39 A;  4GP3 A;  3VSZ A;  1PUM B;  3P6J A;  1JLX A;  3B9U A;  3N7M A;  3R4S A;  3NBE A;  3O4C A;  4JKQ A;  3CA4 A;  1AF9 A;  1TIE A;  4I4P A;  1ISZ A;  1AVU A;  2L5X A;  3AH2 A;  2GO2 A;  5BQU A;  3ILA A;  2F8X C;  3H6Q A;  1AVA C;  1HIB A;  1ISW A;  2E4M C;  3HSM A;  1ISX A;  2NYY A;  1WBC A;  1QQK A;  2RG9 B;  3FJD A;  4ION A;  4G1R A;  2WBC A;  4AN7 B;  3RTJ B;  1IRP A;  4R6U B;  4EB2 B;  3OJM A;  1JT3 A;  1PC8 B;  4OEG A;  1ONK B;  1PWA A;  4A7Z A;  2J3P A;  4G6M A;  2RST A;  2M49 A;  3FUO A;  3VSF A;  3N7K A;  1ISV A;  1DQO A;  2FGF A;  2DRY A;  2D7R A;  4P0K A;  3WIN C;  5BOW A;  3JUT A;  3WA1 A;  3FJI A;  4I0Y A;  3RMY A;  1ILR 1;  2MIB A;  4QD2 C;  4KEJ A;  5DUY A;  2I1B A;  1Q03 A;  3V0B B;  2NP0 A;  4L4I A;  2KKI A;  4FVV A;  3BRF A;  4QKR A;  4TLP A;  3BTA A;  5D62 A;  4QO3 A;  3O4B A;  1ITB A;  4Q91 A;  4OWJ A;  2VXT I;  1W3A A;  3VEQ A;  2QN4 A;  4F34 A;  1AFC A;  4GOY A;  4OWK A;  1TFM B;  4KEI A;  1YTO A;  4EEE B;  4YOL A;  41BI A;  5BP5 C;  4I7I A;  1T9F A;  1S0G A;  4J2S A;  4XFS A;  3FFZ A;  4MZG B;  4LO1 A;  1CVS A;  2IHO A;  1BFG A;  1XZZ A;  1V6U A;  1L2H A;  1TTU A;  1BA7 A;  1JQZ A;  1JT7 A;  3FJA A;  4ZFY B;  5FZU A;  4GOV A;  4I4X A;  4KC3 A;  4OUJ A;  2FFU A;  3FJB A;  1HWM B;  4LO7 B;  1RML A;  3UJ4 A;  1JY0 A;  4LO8 B;  2VSA A;  4HJJ A;  4GAI A;  2K8R A;  2XOA A;  2F2F A;  3D7W B;  4ZLB B;  1IT0 A;  1DZD A;  3BRG C;  3WO2 A;  4G9M A;  1II4 A;  4ZKT B;  1W3F A;  4X39 A;  2KH2 A;  2LIE A;  1FQ9 A;  4I4U A;  3V0A A;  2HWA A;  4IQP A;  2NM1 A;  4EFQ A;  3FJF A;  3HBW A;  4JQ0 A;  3ZXG A;  1I1E A;  1YXW A;  1D0H A;  4J2K A;  4EFR A;  2HZ9 A;  2ESU A;  5DVH A;  4EFP A;  3V0B A;  2WRY A;  3F1R A;  1TP0 A;  1YF8 B;  1HKN A;  1QQL A;  4FGF A;  1UPS A;  4IYB A;  4ZGR B;  4GP0 A;  4I4Y A;  4JRA A;  1G9D A;  4JAW A;  5GAQ A;  4IHZ A;  21BI A;  4II0 A;  3V79 C;  4QAL A;  3AH1 A;  3P53 A;  3OBT A;  3I29 B;  1OQL B;  4XFU A;  2BFH A;  3MAL A;  1BAR A;  1V6X A;  3CRH A;  1TWM A;  1IIL A;  3O44 A;  3R4U A;  3FJC A;  4LO1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...