1UPSA

Glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
404
structure length
402
Chain Sequence
AKDFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKESLNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyl hydrolase
molecule keywords GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA-GALACTOSIDASE
publication title Three-dimensional structure of GlcNAcalpha1-4Gal releasing endo-beta-galactosidase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 111
structure length 402
sequence length 404
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1upsA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1upsA02
1BLAA 3W58A 2FFVA 3MPPG 5JOWA 1QF3A 4OWJA 5B2HA 3AZZA 2EIGA 1BQPA 3AKHA 4Z8BA 2JD4A 4M3CA 4FGFA 2Y9FA 1JTCA 1MS1A 3INAA 2GN7A 2E4MC 2CYFA 3E8LC 1LOGA 1V6OA 1APNA 4JQ0A 4K21A 2ENRA 4JAWA 5GLUA 3BAGA 3UD7A 2VSEA 4LO3C 31BIA 1EVTA 3GALA 2ET2A 1CN1A 4P9WA 3D5OA 1UZZA 5F8YA 2LTNA 1RMLA 2ZGOA 1YF8B 4AWDA 4JKQA 1JT5A 3QCWA 3LSDA 2A71A 1SLTA 1RITA 3O49A 5BP5C 1YI7A 4Y1UA 2UUSA 3BX1C 4XXPA 4AGRA 4Y26A 2RQ9A 1WW5A 3WINC 3WMUA 3FGMA 1IILA 2YXSA 4UW3A 4KC3A 3FJCA 4JP0A 3A07A 3POWA 1FNZA 4OUJA 1KITA 1MVQA 1JOJA 2Y9XE 1S1AA 3WUDA 2JKBA 3WDVA 1DQ6A 3S8JA 2ZMKA 3ILNA 2D44A 3ZVXA 5F5QA 2D7RA 1DZDA 4DEPA 3CRHA 5KXDA 3WCSA 1Q8SA 4OW4A 1KJRA 4GKYA 4WVWA 3R4UA 4X37A 4XIOA 5KXBA 4DENA 2KM2A 4XZPA 2FHRA 3HN1A 1RY7A 4ISQA 2AUYA 1LHNA 4Y1VA 2JE7A 1QOSA 2D3SA 4FVVA 3WG2A 1GKBA 2FDBM 4F83A 2ZGKA 4I4SA 4P0KA 3WOGA 1I1BA 2NMOA 2ZGNA 2DTWA 3FUQA 4ITCA 1FAYA 1ZA4A 2MLLB 5T52A 3CRIA 1LCLA 4XFSA 2VW2A 4EFQA 3IM5A 2CWSA 1R8OA 4WVVA 4G9MA 4GAIA 1IS6A 3AJZA 2F2FC 1LOAA 2DUPA 3RMXA 1W0PA 4P9YA 4KEKA 3BODA 4Q8LA 2GNDA 4D69A 1N47A 1FGAA 5GLTA 4G1RA 2D3PA 3ZC9A 1IRAX 3ZXKA 1SCRA 1Q04A 2V5YA 3RQ0A 3AZWA 3TC2A 3CNAA 3V0AB 3P6JA 1AF9A 1AVUA 2E7QA 3PMEA 4YFWA 1LOCA 4J2SA 4FOYA 3FLTA 1QOOA 3LLPA 4XDQA 4LBJA 1V6WA 2HWAA 4ZFYB 3AP4A 3FJFA 2YY1A 2DURA 4BLJA 4Q1PA 4G9NA 4CRQA 2ZHNA 2YROA 1UN1A 4WV8A 3KM5A 4LBOA 3HALA 2ZHMA 1IS4A 3ZXJA 3BAQA 1IOAA 1FWUA 1J0SA 1HCDA 2XG3A 4IY9A 1FX5A 3WG1A 2DWRA 1W3GA 2PHFA 1NXD1 1ISVA 4QKRA 3RTIB 4YGEA 3CA3A 3QR5A 4BQ1A 1BASA 1BYHA 1ENSA 2VLCA 4ZKTB 1LESA 1Z2VA 4X3AA 4KEJA 3VT1A 1DQGA 4H9WA 2YZ4A 1ULEA 1SLIA 2NZ9A 2Y9WC 2OW4A 3HBWA 3ZSKA 4EEEB 4XE9A 4YZ3A 2OVUA 3H6RA 4LO1C 4I37A 1XYFA 3V0BB 4YZ1A 1N4KA 1AX2A 1JT3A 1XG6A 3C2UA 4C1WA 4GAFA 2ESUA 1KRIA 4I1EA 1Q56A 1PC8B 3V65A 3RSJA 3AK0A 1PUMB 1G86A 1IOBA 2VU9A 1LECA 3AYEA 4XBNA 1W6MB 3OJVA 3OYWB 2C5DA 5IK7A 3WDUA 3USUB 3FJBA 3UD9A 2NYYA 2ZGQA 4PBPA 1CIWA 5GJ6A 1LOFC 4P9XA 5IK4A 1HKDA 5SV8A 4UW6A 1UKGA 1ULGA 1DGLA 1XZZA 1TOOA 1HWNB 2DVAA 1TIEA 1DLLA 3OPZA 1BKZA 3RG0A 2HYKA 2R0HA 5GAQA 1VAVA 1XHBA 4P6AA 3CA1A 3QLQA 3BIWE 3RS6A 2ARXA 1WUVA 5GZCA 4USPA 1ULDA 1XQNA 3BADA 3OGFA 3M3CA 4YZ2A 1HCEA 3ZXDA 1WLDA 1F31A 3SH3A 5FNWA 2D1ZA 2VXTI 2K4AB 3AJYA 1ISWA 5FNXA 1GZ9A 1Z4SA 3O4AA 4X38A 3N36A 3TB0A 4D0ZA 1AXZA 5BYNA 1PWAA 1V00A 3N0KA 3BRDA 3B69A 1K5VA 4LBKA 1SR4C 4GP0A 1LOEA 2L5XA 5EWSA 3AH4A 1WD4A 1VAMA 3PVOA 3FJ9A 1H9PA 4FP3A 4XFTA 3B9CA 4M3CE 1QDCA 4QBCA 3T8SA 5FZZA 3B9UA 1S0GA 4QO3A 3ZX7A 4YW2A 5E24E 3NV2A 2SLIA 1CJPA 1PZ8A 5BQUA 2R16A 1AJOA 4I7IA 3GNEA 3ENRA 2HWMA 3PVEA 3SISA 5HCFA 4I30A 2D22A 4EKXB 1URXA 2I2SA 1GICA 1MS9A 3CQAA 2DU1A 2ZACA 3V79C 2EAKA 1LHVA 3ZXGA 3HMYA 3V0AA 2E6VA 2GALA 4GOVA 3H6QA 5JVVA 1ENRA 3RTJB 5F8SA 1C4RA 1BFCA 1PZ7A 1NUNA 2WT1A 4ZFUB 1VIWB 2ZBJA 2AR6A 4AN7B 4Y1XA 1YXWA 4LO0C 4ASMB 1YRZA 4IY8A 5GLWA 1S0LA 2DUQA 4LO8B 3HOMA 1LHWA 2D6OX 2WSVA 3ZXFA 4H04A 3O0XA 5IT6A 3EF2A 2ZQNA 2CL2A 2EXJA 2W39A 3DGTA 1LOBA 1CPMA 1CVSA 4QBVA 4YW5A 4XBQA 3O3QA 2UWBA 4I4PA 4BMEA 4Q2FA 1AXMA 1II4A 1FMZA 1Z78A 5DZFA 5E88A 1TWMA 2MIBA 2P34A 4XJWA 2W52A 1HWMB 1MS4A 1IHKA 4XMAA 2Q5TA 3SNVA 2GNTA 1BFGA 2ZGSA 1Q03A 2EF6A 4QD2B 5GLZA 1DIWA 3ZSMA 4MYEA 3APBA 4AYUA 1TWEA 4DS0A 3AYCA 2FGFA 3FJIA 3VKMA 5IK5A 3VV1A 2ZMNA 2F8XC 1G9BA 4LBQD 1WBCA 3V0BA 1W3AA 4P0LA 5GLVA 2M49A 1S0EA 2CNAA 1WD3A 1SLBA 3CA5A 3VSZA 5EYYA 2E53A 1HIBA 1GNZA 3ASIA 3NBDA 1DQ0A 1GNHA 1W6MA 2P23A 3OYWA 1Q8QA 1AX0A 3USUA 1H9WA 1DBNA 4YW4A 3H6RB 5HCBA 1YTOA 3ZYRA 2A6WA 2D23A 4DFSA 1D0HA 2NMNA 3AYAA 4FQ4A 4BMBA 1BZWA 1JT7A 1LHUA 4DCKC 1DQOA 2RSTA 2DTYA 4RL7A 3FJDA 4WZFA 2GNBA 3AJ5A 3S8KA 2P37A 3FJJA 2WSUA 4DQAA 1QKQA 4IQPA 5DZUA 4W65A 1M2TB 1J1TA 1VALA 4BLIA 3A23A 5L73A 5JOXA 4AN6A 4TYSA 4R6UB 1N1SA 4J2KA 2ZGRA 4FQZA 4YGDA 5EYXA 2AXMA 4GOYA 2VSAA 1AVWB 4Y1ZA 4JC1A 2D3RA 2A7AA 3HR9A 1M16A 4Z9WB 2TEPA 5CB7A 1WW4A 2GNMA 5DG2A 3N7MA 3N7JA 3VKOA 2VW1A 3A0NA 5DZEA 2Y9GA 3BTAA 3KMVA 1ITBA 3KQRA 3A4UA 1DZCA 3OY8A 3ZYPA 2PHTA 1LTEA 2NM1A 1VLNA 4KEIA 1V6XA 1FATA 3AZVA 3JUUA 4HL0A 1AFCA 1YIFA 1DYKA 1DQ1A 1G9DA 4I4UA 4AVSA 2EXIA 5T55A 2G4IA 3BAUA 3W59A 5JOYA 4FPJA 2Q3NB 3AP7A 1Q1UA 5DUYA 1PZZA 1AVAC 1B09A 3DUIA 1VCLA 2DRZA 3O0VA 4Q26A 2NTDA 1OQLB 1O4ZA 1JHNA 1C1FA 3O4OA 3WG4A 4YG6A 1W3FA 3T1MA 3CU1B 1V6JA 1SLCA 1C1LA 1FNYA 1SBFA 1FYUA 4NOTA 1QMJA 5CAZA 3AXEA 4XYXA 3VKFC 2ERMA 3WDWA 1L2HA 3POSA 4L4HA 1SFYA 1V6UA 3POYA 5T50A 1F9KA 4YW3A 4XFUA 3BRGC 1MZ5A 3LSEA 2EALA 4BOWA 2KKIA 2D24A 4LO2A 4NO4A 1JUIA 4JKXB 4XHXA 4YW1A 4OEEA 5H9QA 1UMZA 2X2TA 3C9ZA 2BEAA 1ULFA 2DUOA 4AVVA 2UU8A 3M3OA 4Y20B 3ZPYA 2ZQOA 4FP2A 4LBQB 1S0BA 3PJQA 1W6PB 5GZFA 2WT2A 2YMZA 1HLCA 1LHOA 1GZCA 5CNAA 3Q7WA 3AP5A 1IS3A 1W6NB 1ONAA 4U36A 1SZ6B 4I8MA 3IM7A 4IZEA 1IKPA 1QNYA 1FV2A 3I2AA 2GN3A 1BJQA 1IS5A 1FMMS 4P14A 1MD6A 3FJ8A 1GGPB 1G9CA 5EXOA 3ILFA 5DZGA 1DQ4A 3CAHA 5DUUA 5FRAA 5BXRA 4Q27A 4YGCA 2ZHLA 1KDMA 1LGCA 3VUOA 1SLLA 1N1TA 3NWKA 4H55A 3M2MA 3BRFA 3UJ0A 1AXKA 4YM3A 3UJ4A 4LBMA 1TP0A 4GXLA 3AH2A 4QD2C 3T2TA 1MVEA 4ZLBB 4L4IA 4DPNA 2P39A 3T1LA 4ATEA 2D7FA 1V6VA 1QDOA 3POKA 4XMIA 4GA9A 4YFZA 4QKSA 1W6QA 3AZXA 1NZKA 2ERFA 3SITA 4SLIA 1LEDA 4J2XA 4YZ4A 1ENQA 3CA4A 2PHWA 2P3IA 1CONA 1AZDA 1TEIA 2LIEA 3I4IA 4Y24A 3WCRA 2QYIB 4HJJA 4LO7B 1JXNA 1Z0HA 3WO2A 1KQRA 4I4VA 4XJ9A 1H30A 3N35A 5GZEA 2BFHA 3UK9A 5G00A 4QALA 4EFRA 2ZGTA 4L8QA 3I2XA 1JT4A 3A22A 3ZXLA 3F1RA 1DZQA 1T4QA 3AXDA 2BEBA 1LU2A 2R0FA 3B00A 3OGGA 5KXEA 3JU9A 3UL2A 1CR7A 4CJMA 4FPYA 3NV4A 2IWTB 2X2SA 1MS8A 4GALA 2DS0A 2D43A 4YOLA 3O4BA 3F62B 2R9KB 4ISRA 3FFZA 4ZBVB 1LGBA 3OY8B 3IN9A 3IM6A 4XJAA 1SCSA 1CVNA 3R4SA 2ARBA 1JBCA 1HQWA 1MZ6A 1V6LA 1FV3A 2VXRA 5H9PA 3U4XA 2DVBA 2WNEA 3CA0A 3ILAA 1V6MA 4AVTA 3OJBA 4Z8SB 4Y1YA 3WMVA 5JLVA 2E51A 4AGVA 3O5WB 5H9SA 1K5UA 4I4QA 2EXHA 1CE7B 1N3OA 5T5JA 3OBRA 5DXDA 3WHTA 1N3QA 1AXYA 5DVHA 3ATGA 1SLAA 2YUGA 2DVFA 2DVGA 3VKNA 1D2SA 2WRYA 5FREA 4TZDA 3O0WA 4FPGA 4FPKA 1WCSA 4OZXA 1RIRA 1YYNA 2PELA 2D6NA 5FZYA 4AGGA 1UX6A 4DRRA 2OUHA 4Y20A 3VKLA 1TFMB 1UAIA 1OKQA 1GANA 3PVNA 4LBQA 1W6PA 5HCAA 3AFKA 4QC4A 5BQUC 2ZA9A 3MW3A 4TLPA 1S0DA 1IJTA 1IRPA 2DV9A 1A78A 1W6NA 2W08A 5BXSA 1I1EA 1T9FA 1EPWA 2CTVA 2ZMLA 4G6MA 2D6KA 1Y7BA 4PF5A 3WDTA 3Q7XA 3O4DA 3P6IA 5E8AA 1E0OA 4YLZA 3CRGA 1EV2A 1HQLA 2ZKNA 2FMDA 5D62A 3WG3A 1R8NA 2A3WA 3N7LA 3OJ2A 2E4MA 1FQ9A 4Q1RA 5DSSB 2DRYA 4FOQA 4U2AA 4ZA3B 3W9TA 5F90A 1EYLA 1JN2P 4Q8KA 1FN0A 2VY0A 5CBLA 1LEMA 3IPVB 2CWMA 4LO3A 1SBDA 1LULA 3ZXEA 2R49A 1BARA 3SLIA 4UW4A 4XBLA 2VW0A 2IHOA 5BOWA 4I6IA 5GZDA 1RINA 3OJMA 2E7TA 3IMNA 3WNXA 4DRVA 2P3KA 1WBLA 1WLWA 2DVDA 3O4CA 3BAOA 4YM1A 1G9FA 3VT0A 3ILRA 3BA4A 1LENA 2I1BA 4ZFWB 5BP5A 4I96A 3A0KA 2CY6A 4JPZA 4R9AA 3M3EA 2ES3A 2ZHKA 1W0OA 1JY0A 3WO4A 5F9TA 1QNWA 2A5ZA 3WINA 1DQ2A 2UWCA 4FPEA 3HSMA 5JDBA 3FLRA 4XTPA 2PHRA 1PUUB 5E89A 2C9AA 1W6QB 4XJ8A 1S0JA 3D6EA 3IIRA 4KBBA 4USOA 3ZC8A 4HA2A 2PHXA 3VWCA 4PQ9A 4RA0A 1U0AA 1LU1A 3M1HA 3WV6A 5BXTA 4I4RA 1I3HA 4OEFA 4F34A 4YG0A 1BA7A 1JYIA 1A3KA 2A6VA 4HR6C 2ZGLA 5KXCA 2VUAA 1DFQA 1DFCA 4X39A 3JUTA 1O4YA 2ZABA 4PBOA 5LK5A 1ILR1 1HKNA 2ZGMA 3P53A 2XOAA 3LCPA 1R1ZA 1Q8PA 1UPSA 4XIKA 3WDYA 4LBLA 5EC5A 3BA5A 4M3CF 1JQZA 2ZGPA 4LBNA 4LO7C 2BQPA 4BM8A 3BAVA 1AVBA 4XXAA 1SBEA 4I0YA 2ZGUA 5T5PA 3FUOA 1X50A 2RHPA 2AREA 3PHZA 1UZYA 3I29B 1KJLA 4FOVA 3QYDA 3FJKA 4K1YA 3AH1A 3AP6A 2F2FA 3H0OA 4FPCA 2K43A 1ULCA 2V73A 1Q8VA 2P2KA 4BPZA 2RG9B 4I1BA 2HZ9A 3WLUA 2A6YA 1ISZA 1MACA 1WBFA 4I3NA 2MC2A 1LJ7A 3AJ6A 1P63A 2QN4A 4D0TA 3B01A 1S0FA 2Q9XA 2AYHA 2J3PA 2DYCA 4R9DA 2KI6B 2NVHA 4JCKA 4WBCA 2UURA 3SH4A 3WO3A 1DJSB 4FOWA 4C1XA 1N3PA 4P0JA 4XKIA 3IKWA 4K1ZA 3RRDA 3L2YA 5DUVA 1AX1A 2KLLA 2GDFA 2D6PA 1YBIA 5DUWA 5T5LA 2NP0A 4IYBA 5IK8A 4EB2B 4ZGRB 3R05A 1YO8A 1CESA 2ZR1B 3BAHA 1KNMA 5F8WA 4FPLA 1RG8A 3CA6A 1WW7A 4Y22B 3VT2A 1QGLA 5DG1A 2EXKA 2WQZC 2YV8A 2D20A 2A3YA 1W6OB 3MEPA 4Q9PA 1V6NA 2UWAA 2D6MA 4Q9GA 3MW2A 1IKQA 1GZWB 2W68A 3OBTA 3JRRA 2AGSA 3PUBA 4EFPA 1G8WA 5T5OA 1WBAA 8I1BA 4A7ZA 4LO1A 3IPVA 3IM0A 1TTUA 4G6JA 21BIA 3ZSLA 4OEGA 4ATFA 3WVJA 1V6KA 3FLPA 4LO2C 4D8HA 1A8DA 4J23B 3Q9OA 4CZSA 2A75A 1JLXA 2A70A 5IUQA 3MALA 4GWNA 5EG6C 2AQZA 4XILA 1BXHA 4YM0A 1JYCA 3A21A 2WJSA 5DUXA 1MS3A 2R1BA 1LOFA 5AVAA 3FBYA 1RZOB 3FJHA 3WUCA 2DU0A 2NN8A 5EHAA 1S0IA 1GLHA 9ILBA 1G9AA 4YM2A 41BIA 1ISYA 4Q91A 2AFGA 1GBGA 3D7WB 4I4YA 2PHUA 3TAYA 1MS5A 3MW4A 2KI4A 4I4OA 1WW6A 1FWVA 3NBEA 3WDXA 2Z48A 4A7KA 4M3CB 1ABRB 1LODA 1CPNA 2JECA 3AKGA 3IAGC 2R1DA 3O12A 1F5FA 4I2SA 3D4KA 1IT0A 4UW5A 5JMCA 1ONKB 4ENDA 3VEQA 3NV1A 2KH2A 2FO1A 1N1VA 3UJOA 3N3HA 4GP3A 1MS0A 5H9RA 4XOGA 1Q8OA 2GMPA 2P3JA 2H0BA 1DYPA 4OWKA 4M01A 3AKFA 2D6LX 1SR4A 1WLCA 1HDKA 2GMMA 1GSLA 1QOTA 3M3QA 3ZSJA 2A6XA 2WLQA 1KDKA 4K20A 1BLDA 1NLSA 3I8TA 2JJ6A 4IHZA 5GM0A 3NJ5A 2Z49A 1C57A 2OUJA 2GZBA 1S0CA 1AJKA 5D63A 6I1BA 2VH9A 1MR5A 1OFSA 4XJUA 1UL9A 5I1BA 1GYKA 1AVXB 3FJEA 4J2YA 5JOZA 4YG3A 3WA1A 1MC9A 2WT0A 3SH5A 5BXPA 2AAIB 3BA7A 3K1XA 2ZAAA 3NV3A 3H6SE 4OWLA 5T54A 1DQ5A 4FPHA 3AP9A 3VSFA 2AH2A 3AX4A 3UJQA 4IONA 4II0A 4XJZA 2SBAA 3UD8A 3O5SA 5BVPI 2GMEA 5CA6A 4XTMA 4LO0A 3AKIA 3WZ1A 2ZZJA 3N7KA 4I4XA 1LGNA 3AZYA 1QU0A 4ZOTA 3WHUA 3AYDA 3BB2A 3RMYA 3B3QE 4HANA 1N1YA 2D7IA 4YZ5A 2AENA 4R9BA 1JW6A 3PG0A 1OQ1A 4JRAA 4GWMA 1SACA 4FPOB 1HWPB 4CTEA 4XHBA 1ISXA 1DHKB 3UDAA 2K8RA 4PCRA 1QQLA 4GKXA 4Y22A 2JDZA 1ZM1A 2B7YA 2Z42A 2HW9A 1JLYA 2LALA 1W6OA 1HWOB 1GV9A 5D61A 3BOPA 5HPZA 1GZWA 1QXMA 2A3XA 3V64A 4PC4A 4IZXA 3FJAA 1V6IA 5FZUA 3SNMA 1G82A 1BFBA 4ZXKA 3NBCA 2GO2A 4YGBA 2XB6C 5GALA 1G7YA 3O44A 4A7YA 1CQ9A 2LIQA 5GZGA 2DREA 2WBCA 3NBNA 2A6ZA 1QQKA 7I1BA 4FPFA 1PZ9A 2FFUA 4R9CA 2JE9A 4M00A 1BFFA 2WKKA 3LTQA 3Q7YA
chains in the Genus database with same CATH superfamily
5C8CB 1HQNA 1HN1A 1XU1A 3NNLA 1BLAA 1RB8G 3FJSA 4NWWA 4IETA 3Q8AA 4ASKA 1AR83 3W58A 2FFVA 4I2OA 3VDDB 2QZ2A 5K0UB 2D5HA 4LTAA 5C3QA 3MPPG 4JDMA 5JOWA 4O61A 4GH4A 4NIAA 1QF3A 1JZ6A 3OTFA 1H2LA 4OWJA 1VP6A 3ZFGB 5B2HA 2NPIA 3AZZA 4BK4A 3VZOA 3FZ3A 2EIGA 4CVUA 4WZCA 5IVBA 4WBBA 1BQPA 2WA3A 3AKHA 3MIHA 5A1AA 3MLKA 1OPOA 4Z8BA 2JD4A 3V56A 4M3CA 3B7MA 1UY0A 4FGFA 1ASJ2 2Y9FA 4NIHA 4HKLA 1JTCA 2ZAHA 1MS1A 3INAA 3E6DA 2GN7A 3WP3A 5BNNC 4XFIA 4OHWA 2XPJA 2E4MC 5EHDA 2C4XA 3MIFA 2CYFA 2QQMA 3AC0A 1LOGA 3NNJA 1V6OA 1APNA 3UGFA 5IATA 3K75B 2C26A 4LA2A 4JQ0A 4K21A 4QBVA 3NSTA 2ENRA 2VLCA 4PDWB 4AG4A 4JAWA 4ZU5A 1AR61 2R043 3POEA 4CDUC 2VOTA 4QPIA 5FKBA 3FBMA 5GLUA 2WZR2 5FKCA 3BAGA 4Z2WA 3O1RA 5ABJC 3CHXA 1RUE3 1RC6A 3UD7A 3I2GA 4LK7A 3ACGA 2WABA 2VSEA 4E27A 5C9AC 3UETA 1FPN2 1EVTA 31BIA 4LO3C 3GALA 4AEDC 1K5MA 2ET2A 1CN1A 4HKWA 2GC1A 4EJRA 1QQP1 1UYXA 3WF2A 1MQTB 4JKLA 4P9WA 3IIAA 4CDWA 3CQOA 3FHIB 3POJA 3POGA 4AE2A 3D5OA 1UZZA 1W8HA 1SHWB 2RS13 2LTNA 3IDAA 4W6WA 5F8YA 1RMLA 1E5HA 3J7HA 3D0JA 2ZGOA 1YF8B 3ME2A 4DZGA 2VZTA 4AWDA 1W9FA 4JKQA 2PLV3 4QXCA 4N9HA 1HB3A 5L36A 1BHGA 4B3NA 4Y3OA 4NROA 4HXCA 3TOJA 1JT5A 4M4RA 4N43A 4META 4LHKA 4NMIA 1V9U1 3B94A 5FZAA 3U75A 4CDQB 4CEWB 1J59A 2JEMA 4MADA 3QCWA 3LSDA 1UXZA 2A71A 1SLTA 2CAVA 3WR0A 3CZJA 1RITA 4LLFA 3LFMA 4AQTA 5B2GB 5A3NA 5BNOC 1KS5A 3O49A 1UF2C 4D7TA 1FI2A 1YI7A 4B1LA 5EQUA 5BP5C 4Y1UA 2UUSA 4QHZA 3MF6A 1QHDA 2E32A 1GWLA 4XFCA 4XQDA 3VBOB 1ZBE3 1L7QA 3M70A 2RJ2A 2YPDA 4CPBD 1J84A 4XXPA 1R1A3 4AGRA 4AVBA 4Y26A 3PTRB 3ST7A 2DCZA 5CFCA 3VZMA 4QDQA 2RQ9A 1AR81 3JD71 3WXPA 3LOBA 1J3RA 1WW5A 3ZDVA 5C5TA 4LPLA 5FUPA 3WINC 4QX7A 3FGMA 3WMUA 1GQGA 2VTFA 4HG6B 1AL0G 3T2PA 3TNPB 2QQIA 2RJLA 4DEQA 3KHCA 1IILA 1W8NA 1NX9A 2YXSA 4L2NA 4QKDA 4UW3A 3SKVA 4ET7A 4KC3A 3FJCA 2VOWA 3SHRA 4JP0A 3A07A 3POWA 5JIUA 1FNZA 4OUJA 1KITA 1Z7S2 2XOMA 1DGWA 1MVQA 2AZ5A 3VBSA 1BMV2 1JOJA 2Y9XE 4NIIA 1OF3A 1DGRN 1S1AA 4B8EA 4AFDA 1O8SA 3C7HA 3VHPA 3WUDA 4EWEA 2JKBA 3WDVA 2IUWA 2V4AA 1DQ6A 4UF0A 1W9TA 1XE8A 2VUCA 2ZMKA 4QXBA 5F6KA 3S8JA 3DKWA 3ILNA 1JU4A 2D44A 2AC1A 2O1QA 5F5QA 3ZVXA 3S30A 4Q4V1 2D7RA 4DEPA 2W0XA 3PJYA 1W2NA 1DZDA 3T3YA 3CRHA 1CZTA 2Y60A 3MLJA 1XJAA 1OKOA 1ENXA 4MXWB 1RUC3 1PNFA 2IVJA 2RR11 2G9ZA 3JBG3 3THTA 4AQ2A 3A7QA 1RUE1 2HWE1 1VB4A 5KXDA 3WCSA 2DCKA 4NRMA 2Q1ZB 4CDXC 3P5BA 1Q8SA 2QQLA 4Y5SA 1UZVA 2HEVF 4K7JA 4J25A 3R0RA 3ZPOA 2ET1A 2HWC3 2G1MA 1DYOA 3NAPC 4BQWA 4OW4A 2R063 3FMGA 4QQ2A 1KJRA 2BNMA 3JB8A 4GKYA 2RS11 4GJYA 4QQOA 4AW7A 4WVWA 4CCDA 1U5YA 3R4UA 4X37A 3NJXA 4S2DA 5FFOC 1GNYA 1W8UA 3PUAA 4XIOA 5KXBA 4W4ZA 4QXKA 4DENA 2PN5A 2KM2A 2Y34A 4INDA 2JG9A 2FHRA 3HN1A 4XZPA 4O65A 1RY7A 4ISQA 4CP9A 5JZGB 1RUH1 2VZQA 2V72A 2BBVA 1ZYBA 2AUYA 2QQOA 3IDCB 3MHZA 3MYXA 3THPA 1LHNA 1IQDC 4Y1VA 2QVSB 1OLME 4N7UA 2JE7A 1QOSA 1ZBE1 2D3SA 4WM8C 1OLQA 1US2A 2RDQA 1R1A1 4FVVA 3VBHC 2WNVB 2CGNA 3WG2A 1GKBA 4RQPB 4CCNA 1HIXA 1R082 4F83A 2FDBM 2HEYF 2ZGKA 1D4M2 2MNGA 3GYDA 3OEAA 4QQLA 3CMGA 4I4SA 5CIRA 3TN93 4OI2A 3WOGA 4QWNA 4P0KA 1I1BA 2QQWA 2NMOA 2HWB3 1V70A 2DTWA 2ZGNA 4COZA 4W8JA 3FUQA 4ITCA 1FAYA 4JGZC 1ZA4A 2MLLB 5KR7A 5JPMB 4QX1A 5T52A 3CRIA 1LCLA 2GP5A 2VZ1A 1POV0 2VW2A 3C8XA 3TRSB 3ZYGA 5JSRA 4HMZA 1W05A 3IM5A 4EFQA 3U14A 4C0HA 2CWSA 2JB4A 4AQ6A 4LE4A 2PYTA 1R8OA 4WVVA 4UY4A 4G9MA 4GAIA 3KCCA 3WEZA 1IS6A 3AJZA 2F2FC 1LOAA 2QQUA 2JDPA 2VBPA 2DUPA 4S2GA 2Q8OA 4CUBA 4BQ5A 1H8VA 3RMXA 1W0PA 4P9YA 4KEKA 1RUF3 2QQJA 4CP2A 3LA7A 3MFCA 3BODA 3C7EA 4Q8LA 2X05A 5J36A 2GNDA 4D69A 1N47A 1FGAA 5GLTA 4G1RA 2D3PA 2DBNA 3ZC9A 1IRAX 4JX0A 2K46A 5FK8A 3ZXKA 1SCRA 2Y6HA 3AKPA 1Q04A 4RHV1 1H6XA 2FDHA 4I0BA 2V5YA 3RQ0A 3ZO0B 1W9WA 4RS5C 3AZWA 5FUIA 4MX3A 3TC2A 4W50A 3UKVA 2D98A 3BVCA 3CNAA 1PVC2 4BU2A 3L9JT 2CDPA 1J1LA 1JODA 3CKHA 5I0DA 3V0AB 3P6JA 4AFAA 1AF9A 2OPKA 4UFHA 1AVUA 2HWD3 2E7QA 1ODMA 3PMEA 4YFWA 1LOCA 3VD7A 2Y6GA 1Y43B 2FQPA 4FOYA 4IDZA 3ZKYA 3G6JB 4D7SA 4J2SA 2BUKA 1O91A 4Z1VA 3FLTA 1QOOA 1OA4A 3VLBB 3LLPA 1QJFA 4XDQA 4LBJA 3VZKA 3ZFEB 1V6WA 2HWAA 4ZFYB 3CZUA 5EZWA 4JGYB 3CJIA 5FO7B 3AP4A 3X29B 1PGSA 4Z07A 1W3VA 1QQP2 2FMYA 1H4GA 3R6SA 1NCQA 2YY1A 4ES9A 3FJFA 4WM7A 2VZVA 2DURA 3S7EA 3CBNA 2F4PA 4QD2A 5LRRA 1QJY3 3WP6A 5ACA2 4B29A 1YLLA 4KI5M 4BLJA 3DPRC 4Q1PA 2Q0AA 2WFPA 4G9NA 3NNGA 4AXOA 3RYRA 1ND2B 4CRQA 2ZHNA 4M4PA 2UYBA 4Y4RA 4IEUA 2YROA 1UN1A 4WV8A 3KM5A 4LBOA 3HALA 4D7YA 4AEMA 2ZHMA 5FZFA 1V9U2 2WLPA 1IS4A 3ZXJA 2WN2A 3BTZA 3BAQA 1IOAA 3GBGA 2YB7A 3PUQA 1FWUA 2RMU2 3ZIWA 2I07B 1AR93 2P4EA 1J0SA 1HCDA 2XG3A 3P3NA 3OGSA 4IY9A 1W2AX 1JOBA 2HWB1 3VDDA 1FX5A 3WG1A 1MZFA 4S2FA 5A7WB 1UOGA 2DWRA 1W3GA 2PHFA 2BFUL 1NXD1 3S5AA 2FZ2A 1ISVA 1ZVFA 2Q8CA 4QKRA 3RTIB 4YGEA 1CD3G 2ZS6B 4XQ4A 5JI9A 3CA3A 3QR5A 4BQ1A 3ZFGA 2WNOA 3GCXA 1BASA 5JUVA 2WQ8A 5C8WA 3JD72 1BYHA 1ENSA 2Q30A 1XE7A 4DXSA 1OMIA 3PIJA 4LOTA 1LESA 4ZKTB 3VDCA 1Z2VA 4X3AA 4KEJA 3VT1A 1DQGA 1ZREA 3ZN5A 4H9WA 1UIJA 1Q5OA 5A3MA 2WNUB 2ADEA 3OPTA 1KEXA 4A4AA 5FZIA 2YZ4A 3ZLIA 1VAKA 4Q4X1 1ULEA 1SLIA 1FOD2 2NZ9A 2WAAA 4K8FA 2Y9WC 2IXIA 2OW4A 4LIVA 3HBWA 2XQRA 4OUSA 2EIBA 3LA2A 2ZOEB 3IAGC 1TMF1 2XLFA 3VBRC 3O1MA 3SMHA 3ZSKA 2FCVA 1JS9A 2X5IB 4EEEB 2B9VA 1TQ5A 5A6ZA 2WYSA 4XE9A 1M06G 2XJUA 4YZ3A 2FDKA 2OVUA 4RYDA 3O7OA 3H6RA 4LO1C 1ASJ3 4AAXA 4I37A 1HV0A 4H3WA 1ALYA 1XYFA 1MPXA 3V0BB 1S2BA 3IT8A 4YZ1A 3AMQA 4Q4V2 2JG8B 4A41A 5KHKA 1EPZA 5AC91 3I2OA 1NYWA 3GHNA 1O3QA 1N4KA 1AX2A 5F2SA 1JT3A 1XG6A 4P00B 3C2UA 1H1MA 2RR12 4QKNA 4Y33A 3W9AA 3NKGA 4BZ4A 4C1WA 5BUVA 4XF3A 2ESUA 2G9FA 4FO9A 4W6YA 1KRIA 1Q56A 3HQXA 1NY71 2WZR3 1PC8B 1C5HA 1G6NA 1GR3A 2XBO1 3AK0A 3RSJA 3V65A 1PUMB 2VMIA 1SDDB 4AEKA 1G86A 1IOBA 2VU9A 1LECA 1TG7A 3AYEA 5C8CC 4XBNA 1W6MB 3P3PA 5J1XA 4P9IA 3OJVA 3OYWB 4OFGA 1FPN3 2C5DA 4XUPA 1AUYA 5FPAA 3WDUA 2QUOA 3USUB 5IK7A 5K0UC 3FJBA 3UD9A 1HX6A 3BTXA 3VBFB 2NYYA 4CDQA 2ZGQA 5FZOB 5FMDA 4PBPA 3BCWA 4X6QB 1CIWA 4LR4A 5CG8A 4AHXA 1HB4A 5GJ6A 1UQXA 4IEOA 1LOFC 3SXWA 3BGAA 4P9XA 3KT4A 3O1SA 5IK4A 1HKDA 1RHI1 5SV8A 1ZX5A 3ZMOA 4UW6A 4EN8B 1W8FA 2ETEA 5FPZA 5FYTA 1UKGA 4A3XA 1ULGA 5HPOA 1DGLA 5A6YA 1RUH2 4PF1A 3OGJA 1XZZA 1AR91 2PAKA 2OKXA 3TEYA 2VZSA 3MIGA 1TOOA 1HWNB 4IEYA 4IV1C 4BQ4A 3D82A 5A3TA 2DVAA 2GH2A 2OPWA 1TIEA 2Q1FA 4QT6A 2WWSA 1DLLA 3PUIA 3KT1A 3OPZA 3HEIA 3DKQA 1I9RA 1BKZA 1T6GC 4GWIA 4H14A 4QDRA 3RG0A 1GP4A 1OOPB 1X8MA 2HYKA 3OCPA 4PDWC 5F39A 5IFPA 2QJVA 5LA1A 3DXTA 2VCAA 2R0HA 5E16A 5GAQA 2VULA 1VAVA 4OI1A 5FMBA 3OB8A 1MZEA 5A3OA 5BNPB 3RZMA 1XHBA 4P6AA 3CA1A 1IHMA 3QLQA 3BIWE 2ZEWA 2DDUA 4HN1A 3PDQA 2GU9A 3IDEA 1O59A 5F37A 4HKOA 2R32A 3U37A 4IE7A 3ZOIA 3RS6A 2ARXA 1WUVA 5GZCA 4USPA 5LW9A 5JAXA 1ULDA 1XB9A 1XQNA 5A6XA 2VTXA 2W3JA 3BADA 1MQTC 3K2OA 2Y33A 3OGFA 3M3CA 1TNRA 1KFUL 1Z7S3 4JQRA 5FJKA 3VBUB 4OHXA 4YZ2A 2EIEA 4FTSA 2XJPA 2Y0IA 4O7XA 5G04L 3T0DA 1HCEA 4KWLA 2DF7A 3JQXA 3ZXDA 1WLDA 1F31A 1POQA 3SH3A 3TEWA 5A6QA 3LEGA 2J1UA 4NJ4A 5FNWA 2D1ZA 1ASJ1 2VXTI 2ARCA 5SV5A 3NJZA 1UMHA 1YQ2A 3AJYA 1FT9A 1ISWA 2K4AB 5FNXA 1GZ9A 1WGPA 3I7DA 4CEWC 3IB3A 1XU2A 1Z4SA 4E2GA 1FXZA 5FZHA 4RHV2 5A33B 1JOPA 5EP9A 1D2QA 4URAA 1H2MA 3BU0A 4IESA 4X38A 3N36A 1F8VA 5FPVA 3RPQA 2CHHA 4KMQA 3TB0A 3WNPA 5HV4A 2IXLA 4D0ZA 1AXZA 1W39A 2WO3A 2WZR1 2DFBA 2YU2A 5BYNA 2GC2A 2G9GA 1V00A 1POV1 3VBOC 1PWAA 3FJHA 2K9ZA 4FAHA 1AR71 5FO9B 3C7OA 4XACA 4BQYA 1UZ0A 3N0KA 3BRDA 1FPN1 3B69A 4J6GA 1K5VA 4LBKA 1REEA 3N9QA 4FFGA 3JQWA 2Z4FA 1SR4C 2GH8A 4KWJA 3VHOA 5CFDB 4GP0A 5JZGA 1RUNA 1LOEA 1UX7A 5EWSA 2L5XA 4FT8A 3AH4A 1WD4A 5FUNA 1VAMA 1DGRA 3PVOA 2Z69A 3FJ9A 1H9PA 4FP3A 3PMSA 3FC0A 2QBXA 5FY9A 4FBFA 5IVEA 4XFTA 1ZZ8A 3B9CA 4M3CE 1FMD2 2WNVA 1NE4A 1OH4A 3WQ0A 1QDCA 4JHZA 2YGMA 5LA2A 4RQPA 4QBCA 5FZZA 3B9UA 3T8SA 1S0GA 3U78A 2BNNA 4PQQA 4QO3A 3ZX7A 4AI1A 4YW2A 5J48A 1XNDA 1O8PA 5E24E 3ZYBA 1UOBA 1UY3A 4XC9A 3NV2A 4LE3A 2HWF3 3ZN6B 2RDRA 2XLAA 2D40A 2SLIA 5FZBA 1CJPA 3VB9A 4A6OA 5FPUA 2WZEA 4IL7A 1PZ8A 5LA0A 5BQUA 2R16A 4IE0A 2RM21 5APAA 4C0BA 3KB5A 2YUEA 1AJOA 1BK0A 5L7OB 3VL8A 5HI0A 4I7IA 3GNEA 3ENRA 2HWMA 1LRHA 3PVEA 5KBFA 1R083 5C33A 3SISA 5HCFA 5I8SA 4I30A 3NMBA 2D22A 2AACA 3B93A 5F5AA 5EIYB 4EKXB 1URXA 4LO6B 4IE4A 3JZVA 2I2SA 4ZONA 1GICA 5EJ1B 1MS9A 2WWJA 5AFBA 4CCCA 1RUJ1 4A44A 3CQAA 1AYM2 2HLEA 4LKEA 3O1OA 1NA1B 3QD6A 2DU1A 2ZACA 1Z7S1 4A2UA 3V79C 2C0ZA 3BYWA 2Y64A 4QX8A 1BMV1 4ZU4A 3ETQA 4IE5A 2EAKA 4PIZA 4E4ZA 1XSQA 1C8M2 2JDNA 3WP4A 4E2SA 1LHVA 3ZXGA 3RYPA 5D1IA 3HMYA 5JXGA 1PNGA 2XKPA 2JE8A 3V0AA 2E6VA 4XW3A 2J1EA 2HBTA 3ZM8A 1S55A 2GALA 2W47A 3OG2A 1TMF2 1VBD2 4GOVA 2IFWA 5J98B 1YUDA 3EHKA 1ENRA 1OC1A 4N53B 5EJZB 5JVVA 1O3RA 3RTJB 5F8SA 1C4RA 4BXFA 4BHPA 1PZ7A 1BFCA 1NUNA 3SEEA 2WT1A 3GCWA 4ZFUB 3IAQA 1ZBA2 5FQ0A 1VIWB 2ZBJA 4A42A 3MICA 3D8CA 4RSUA 1PVC3 1VBE1 3CF6E 2AR6A 1XC6A 2E7AA 3J9SA 4UWDA 3ZFEA 4AN7B 1HJGA 4XF0A 3GZUC 1VPHA 3I2IA 4JGYA 4XFFA 2JXAA 4WVZA 4Y1XA 4H7MA 3VN4A 4EN6B 4I1EA 1YXWA 4LO0C 2AEZA 4ASMB 1AR63 1YRZA 4FI9A 5A3WA 5LCWL 4IY8A 5GLWA 4DNYA 1VMJA 1NY72 1S0LA 2DUQA 4LO8B 3HOMA 1LHWA 2D6OX 2WSVA 2Y26A 3N9MA 3ZXFA 3PTYA 3O0XA 5L9RA 1U5IA 4ES8A 4H04A 5IT6A 3EF2A 2ZQNA 1ND2A 3K46A 4B4PA 1SDWA 2CL2A 3LAGA 4FTBA 5KHJA 2EXJA 2W39A 3DGTA 1HN0A 3N4MA 5C3OA 2RDNA 1LOBA 1CPMA 3BX1C 3AKSA 2YGLA 1CVSA 3POIA 4YW5A 4XBQA 4OHZA 2UWBA 1QQP3 3I49A 1R8NA 3O3QA 4I4PA 1BLDA 4AI8A 1W8WA 4L99A 1M4WA 4Q2FA 4BMEA 1AXMA 5L19A 1NLRA 1II4A 3H8XA 1FMZA 1IG3A 1Z78A 1UNBA 1X33A 5DZFA 3EXUA 3ON7A 5E88A 1TWMA 2MIBA 2P34A 4XJWA 2W52A 1HWMB 2VQUA 1R091 1MS4A 1IHKA 4XMAA 2EIDA 1S2EA 2Q5TA 3SNVA 3I2KA 2GNTA 1K45A 4Y4YA 4XUTA 2ZGSA 1PK6C 1V9U3 2EF6A 4QM8A 4C90A 4BIFA 3RZJA 1Q03A 2P3YA 4QD2B 1SMVA 5GLZA 2VTXJ 5JXIA 2RMU3 2VCMA 1UW8A 1D4M1 1DIWA 3BI3A 4QPGB 3ZSMA 1F15A 4MYEA 2WNUA 3RWNA 4Q4W2 3APBA 1C8NA 1IPJA 2BU9A 3O1VA 4AYUA 1TWEA 5I91A 4AL9A 3K4AA 4Q0UA 5FPBA 1X36A 4DS0A 3UNPA 4IE6A 3H8OA 1DGWX 3AYCA 2FGFA 4ZZ8A 3FJIA 2BERA 1CZSA 1STMA 1OBNA 2X10A 3FWEA 3JD73 1I5PA 4XURA 3VKMA 4HN0A 2FZ1A 1ZRCA 5JCTA 2IXCA 2BGOA 5IK5A 2X5IA 5FMCA 3VV1A 3ZN4A 1CAXB 1JZ5A 3KD4A 1RTVA 2P6HA 2ZMNA 2F8XC 3DXUA 1FOD3 4OCTA 4YVWB 4LBQD 1G9BA 1WBCA 5DPNA 2ZX2A 3OEBA 2YBPA 3V0BA 4CPBA 3GF6A 4PHZA 2JG8A 5BY5A 5LZ6A 1W3AA 3K77A 4P0LA 1W8ZA 1ND3C 2OA2A 5GLVA 1HRV2 2M49A 1S0EA 2CNAA 1WD3A 1SLBA 4NIDA 1COV1 2D97A 4KWKA 2VGDA 3CA5A 3VSZA 3MBWA 4QMAA 5EYYA 1TME1 1PVC1 5DQ0A 1JYXA 1H8TC 2E53A 4CP0A 4QHOA 1HIBA 4ZPIA 1GNZA 3ASIA 3NBDA 5JWPA 1HW5A 2JIGA 1WMXA 1DQ0A 2CGPA 1VBC1 1GNHA 1W6MA 4UAPA 2P23A 4HFSA 2XHNA 3E8LC 2XL7A 3OYWA 4Q4V3 1A8MA 1Q8QA 2C24A 1HRI1 1AX0A 4XZUG 3USUA 1H9WA 1DBNA 4R52A 1IGOA 2X8KA 5F3GA 1ZNPA 3VBFA 2RR13 3EMRA 2VNRA 4KQ7A 5EJ3A 4YW4A 5FZOA 5HCBA 2XUMA 3ZYRA 3ZR6A 1YTOA 2A6WA 1RUG2 1AR72 2HWE3 2LW8A 5C3SA 2D23A 4PI0A 4DFSA 1RUI2 1D0HA 4HPKB 4CCOA 4JVAA 2NMNA 4QGMA 2XLGA 5FBJA 1QXRA 1HB2A 3AYAA 5FBZA 3WP5A 3SC7X 4FQ4A 1PMHX 1GOHA 1BZWA 4BMBA 3AMNA 5IAVA 1LHUA 1SEFA 2UY8A 4IV3C 5F7UA 1JT7A 4QB6A 1DQOA 4DCKC 5FY4A 1C5IA 2VC9A 4HT1T 5HBAA 4CA9A 3OUHA 2VQ0A 5IW0A 2RSTA 2DTYA 5ACA1 1QEXA 4G3YC 4RL7A 3MF9A 1J83A 3FJDA 3QH7A 4QX0A 4WZFA 3BN6A 3LWCA 2GNBA 4RN5A 3POFA 4LO7A 3VD3A 3AJ5A 3S8KA 2P37A 2ZTNA 4BXSV 5CU1A 4NPRA 3FJJA 2WSUA 4DQAA 1QKQA 4IQPA 5IYYA 3T4VA 5DZUA 1OF4A 2O8QA 1H6YA 5A7NA 1OOPA 4W65A 1JZ4A 3I3DA 1RUH3 5FZDA 2RMU1 4GH4C 1M2TB 4Q0PA 1J1TA 1VALA 5BNPA 3H1WA 4BLIA 1JZ7A 3A23A 4LKFA 4CCJA 5L73A 1OI6A 1EY2A 1YFWA 4TYSA 5JOXA 1XNBA 3Q8CA 2IFRA 2R7EB 4AK3A 2BPA2 4AN6A 4R6UB 1N1SA 4XCAA 4XAEA 2RM22 4J2KA 2ZGRA 1DG6A 4FQZA 4YGDA 4MGKE 1QXJA 5EYXA 3WX5A 5J3UA 2AXMA 4GOYA 5C4WB 1K3IA 2VNOA 3GGLA 4HETA 2VSAA 1AVWB 1B35B 3IMMA 2Y0OA 4BWOA 4EZ4A 2WS91 3VBUA 3WT3A 5DMYA 4Y1ZA 3K3OA 2XVGA 1JU3A 4AVAA 4EWDA 2OQ7A 1JI6A 4JV4A 4QX3A 4V1PA 1KFXL 2XL9A 2D3RA 4JC1A 5TSWA 2JX9A 2A7AA 2BRTA 3J7LA 1RUJ2 2ARAA 3HR9A 1FOD1 2BGPA 4HK8A 3LDRA 2P6CA 1O3TA 1M16A 4QPIC 2TEPA 4Z9WB 4NUBA 4GMP0 4UFJA 5CB7A 1WW4A 4FCAA 1X7NA 3ZDSA 5A33A 2V4VA 2GNMA 5DG2A 5C3RA 3N7MA 3M4FA 3N7JA 3T30A 3VKOA 2VW1A 3A0NA 5DZEA 3MZHA 2Y9GA 3PIGA 1K5MC 3BTAA 3KMVA 3KGZA 1ITBA 1LR5A 3KQRA 5GKAC 3PLQA 1ST8A 2C1FA 3A4UA 3OBZA 4GIQA 1BVVA 4CDWC 1DZCA 4L0PA 5FZMA 3H8UA 4HVRA 1YJLA 3OY8A 3ZYPA 3MUY1 3ES1A 2PHTA 5CZKA 4RHV3 5JIAA 3KV9A 1LAJA 2WQ4A 3MDPA 4JDNA 1LTEA 3TNQA 2RJKA 2NM1A 2VZOA 2JICA 5CFDA 1W03A 2GP3A 4N43C 1VBE2 5JXHA 1RXGA 4XFSA 3RYKA 3H7YA 1GUIA 1VLNA 4AI3A 4E8CA 5T3NA 4B1MA 3W5NA 3NJYA 3FN9A 1NXMA 1FATA 1V6XA 4KEIA 3AZVA 1H1AA 4DOUA 2ZX4A 2ZEZA 3H3LA 3JUUA 4HL0A 1AFCA 5KC6A 1YIFA 1DYKA 4R8HA 1DQ1A 3PNAA 3OGVA 1G9DA 4I4UA 3KV5A 1BBT2 2EXIA 3C7FA 4A6SA 4AVSA 3Q8BA 3HNBM 3HOBA 2XJRA 3HBZA 5T55A 2YFUA 3CIHA 2G4IA 3FX3A 3BAUA 5CFCC 3W59A 2OS2A 5DDJ2 5JOYA 4FPJA 1JYVA 2Q3NB 4Q5OA 5IVFA 3AP7A 3ZN6A 1Q1UA 5DUYA 1PZZA 3CEWA 3K3NA 5E1RA 3WQ1A 1AVAC 2LS6A 1B09A 3DUIA 3UKTA 5L7OA 1OVPA 1FMD3 1VCLA 2DRZA 2YC4A 3LF7A 1JHJA 3ACFA 4YVSB 3HBKA 4QPWA 3O0VA 2XVKA 4Q26A 1Q43A 3HT2A 2NTDA 3VBSC 3KCXA 3KCYA 5F3IA 3WW1A 1O4ZA 1R092 4RFRB 5A80A 1JHNA 3AKTA 1C1FA 4TTGA 3O4OA 3WG4A 4YG6A 2BGCA 3S5QA 3AVRA 4BQ3A 1W3FA 4XF9A 2QZ3A 3T1MA 3O4CA 3WF4A 2O8OA 1CWPA 1NA1A 3CU1B 4E8DA 1UOFA 1V6JA 2K2SA 1SLCA 2BYVE 3EO6A 2MEV2 1C1LA 5JR7B 2XVLA 1FNYA 1SBFA 5FJHA 1FYUA 2Y38A 2J42A 3LFIA 4NOTA 1VBA2 2P1BA 3HN3A 1QIQA 2ATFA 2BV4A 2LROA 2PHLA 4K8RB 3USSA 3VZJA 5A32B 1QMJA 4CCEA 5CAZA 3AXEA 4XYXA 4FFIA 3RI8A 1AYM3 2VOVA 3VKFC 4MVTA 4P5HA 4OI0A 2ERMA 3WDWA 4RR3B 3POSA 4N53A 5KHHA 3UGGA 1L2HA 4L4HA 1F35A 2ID4A 2ZEXA 1SFYA 1V6UA 4GAFA 3FFQA 1K5JA 3LPGA 1O5UA 3POYA 4GWJA 1C8M3 2J1TA 3ITQA 5T50A 5F3CA 1F9KA 2IWGB 4Q4X3 3LE0A 2J1AA 5D8AB 1YEWA 3N9LA 4PI2A 4YW3A 3QACA 1E5SA 3TBDA 3CLPA 1NZCA 1S4CA 4JQTA 3T09A 3BRGC 2VNVA 4YW6A 2QFEA 3N9PA 1TMF3 1OT5A 1U12A 1VBD3 1UOJA 4HBNA 3FE5A 5DAQA 1MZ5A 3LSEA 1COV2 2EALA 3LDKA 3LD8A 4G4FA 5L9BA 4BOWA 2D24A 2KKIA 4LO2A 4NO4A 2JG9C 5JI7A 5F5CA 1TME2 2IXHA 2PXJA 4PLOA 1JUIA 5FMOS 4LMFA 5LASA 4JKXB 4XHXA 4LO8A 1A6CA 2YBKA 4YW1A 1UXXX 3BOWA 4GB32 2E33A 4UFKA 5I8YA 1VBC2 4AAPA 4OEEA 3AFGA 5H9QA 3RZZA 1YFUA 1UMZA 2VZUA 5AC93 4YPJA 1HRI2 4UXAA 1IPKA 1Y4WA 3LPFA 2X2TA 1S2KA 1NLQA 5FQ0B 2GC0A 4Y5TA 3C9ZA 2RS52 3HQUA 2BEAA 1ULFA 4OYUA 2KXLA 2DUOA 2XBO3 2XWJB 4Y5Z0 2UU8A 3M3OA 3QOPA 4AVVA 4QU1A 3VZNA 1UU6A 4Y20B 4EQVA 5FYCA 1ZRFA 3ZPYA 2VJXA 3SQOA 4C8DA 4FP2A 4UBGA 2ZQOA 4LBQB 1UD1A 1S0BA 3PJQA 1W6PB 4EYUA 2VBDA 1C3HA 5GZFA 1FMD1 2WT2A 2YMZA 4GD4A 5A7SA 4XDOA 1HLCA 3I59B 4Z92B 5IWFA 4CE8A 5FZ6A 1LHOA 1GZCA 3UV9A 5CNAA 3Q7WA 1Y9GA 3AP5A 5LBBA 4PLNA 1IS3A 1W6NB 1ONAA 4IW3A 4NN0A 4QPGA 2VNGA 2P17A 4U36A 3I2HA 3LIGA 4KH9A 1SZ6B 4Q4Y1 1RHI3 1GFF2 3VDAA 4I8MA 3IM7A 1VMFA 4HVOA 2B46X 4IZEA 2ZJCA 2W1SA 3AL5A 1IKPA 4LIUA 3KV6A 3HAGA 1GOGA 1EV11 3E5XA 1UZWA 1QNYA 2B5HA 3H42B 2C9KA 1FV2A 3WY6A 2BBAA 5FYYA 1US3A 5FPXA 1O4TA 1TE1B 2KA3A 3ALQA 4OULA 4F8AA 5FZGA 5CEHA 1NCRA 4QB2A 2QQVA 3I2AA 2GN3A 4XF1A 4IGPA 1BJQA 2D5FA 1CAXA 1IS5A 1QH6A 4EWAA 1SFPA 1JYNA 1FMMS 3BALA 1AYM1 4KNCA 4N7IA 4P14A 2E63A 4YVWA 1MD6A 3FJ8A 1GGPB 1G9CA 2WS92 2XGXA 5EXOA 5BNNB 1RVF2 3ILFA 2B45X 1BEV2 5DZGA 5FP9A 3RNSA 1DQ4A 1KD7A 3NRUA 1C8M1 3RZHA 3CAHA 1HV1A 5I0TA 4NWVA 5DUUA 4CDUB 5FRAA 3W5MA 5BXRA 2W87A 1I5ZA 4HLTA 2ZPXA 2VMHA 4Q27A 1QJZA 4YGCA 2ZHLA 5JMOA 1GP6A 1KDMA 4MGIE 1NOVA 1LGCA 2A1XA 3VUOA 1UYPA 1VBD1 4IEXA 1SLLA 1N1TA 3NWKA 4H55A 3M2MA 1YJKA 3BU7A 3CJIC 3U10A 5C9AB 3BRFA 3UJ0A 3C3VA 5FXVA 1AXKA 2VVEA 4AEDB 5IVCA 5IVVA 1HRV3 4B4QA 3HIFA 5FY8A 4DUXA 4CU6A 1ZRDA 4YM3A 4XQWA 1NCQC 1ZBA1 2OX0A 3AM2A 4LBMA 2EICA 2W1QA 3BPSA 1E5RA 1O7FA 4W6XA 4WM7C 4EZHA 4GXLA 3AH2A 2W1UA 2J22A 1NUKA 3IDBB 1W90A 4QD2C 4GJZA 4Q29A 4HPKA 3T2TA 1ZZBA 1MVEA 2YC0A 3OBAA 4ZLBB 3KF3A 4L4IA 4DPNA 2P39A 3T1LA 4AI0A 1D0GA 2D7FA 3RFRA 4XFBA 4ATEA 4XUOA 3S6PA 1V6VA 5FZ9A 1QDOA 2R071 3VZLA 3POKA 3MUZ1 4XMIA 4GA9A 4OMCA 1POV3 3RGBA 5HXVA 3ORJA 3OOXA 4YFZA 1RUG3 1AR73 4HONA 3TEXA 1JYWA 4QKSA 1W6QA 4TWTA 5BNOB 3PU3A 3VDDC 3U1XA 4CU9A 1XPWA 1O5LA 3AZXA 1BLZA 4V2VA 1ZRRA 4ZY9A 2QQPA 3AMHA 1WKYA 1NZKA 2R042 1CAUB 3E5UA 2ERFA 2YC2A 4M0HA 4SLIA 3SITA 2WC2A 1JZ8A 1LEDA 3BTYA 1E5IA 1L7RA 1OXCA 1NT0A 3LKJA 3ZFGC 4J2XA 4KG0A 4MHRA 5L9VA 3PL0A 4YZ4A 1ENQA 3CA4A 4ARYA 2PHWA 3OF1A 2P3IA 5F8PA 1CONA 2AEYA 4TLGA 2D93A 5C4WA 3SCGA 1AZDA 5K8SA 1ZRIA 1TEIA 4XPVA 2ZX0A 3WW3A 2LIEA 1B35A 2FCTA 3I4IA 4Y24A 3WCRA 4BK5A 4LHLA 2QYIB 3CJXA 5A3PA 4HJJA 1OUSA 4LO7B 5FXWA 1JXNA 1Z0HA 4Q4W1 3TYJA 5FZ8A 1KQRA 3WO2A 3CU7A 4YRDA 4I4VA 2RM23 2TBVA 4P5YA 1H30A 3N35A 4XJ9A 4BQXA 5IVJA 1OD3A 1YC61 3H50A 1U5ZA 1XYPA 4N9IA 5GZEA 2MPFA 4V2WA 2BFHA 3W21A 1HXS1 2L9LA 3UK9A 5G00A 5IHRA 4QALA 2JWPA 1W06A 4EFRA 2ZGTA 4OQ8A 5LBCA 3MIBA 1UIKA 4L8QA 4ZXEA 3I2XA 1ULOA 3A22A 4ZS2A 1JT4A 1D4VB 1BCXA 2KD7A 3ZXLA 4RGKA 3F1RA 4I4YA 2PTMA 2WWUA 1VR3A 1RUJ3 2VD7A 4QGNA 4UI9L 5FTTC 1DZQA 1PHMA 3GJAA 4DINB 4XFHA 4CDXB 1T4QA 3AXDA 5JR2A 3KGLA 1LU2A 1OURA 4XFAA 2BEBA 4S2HA 2R0FA 3B00A 3EQEA 4QX5A 3LEMA 1HRV1 3MIEA 3OGGA 5KXEA 2WIIB 3JU9A 1YI9A 4PIYA 3J8F1 2XJQA 1CR7A 3UL2A 2DCTA 4CJMA 3NAPB 2LUWA 2IZWA 4FPYA 3NV4A 4QXHA 2IWTB 5A3UA 5A7PA 2X2SA 4CDQC 3E6BA 1MS8A 4GALA 3WNNA 2Y6LA 3SEPA 2DS0A 4MUVA 2D43A 3ZYFA 1XE0A 4YOLA 1PX3A 5E6HA 3MIDA 2JENA 1TP0A 1SQ4A 3O4BA 2XMLA 2F6BA 3F62B 1RGSA 2YDEA 4A3ZA 4ISRA 2R9KB 3FFZA 1PGW2 3UESA 4ZBVB 2BOIA 1YQCA 1RUG1 1LGBA 1VBE3 2PAEA 3LQCA 5FYSA 1RUI1 3OY8B 1L3JA 2OQ6A 4XFUA 1QWRA 3IN9A 4CCMA 3IM6A 1PO22 4XJAA 2VXJA 3F95A 1SCSA 1CVNA 2NLRA 3S57A 4WM8B 5C71A 2J1RA 3R4SA 2JD9A 4MSVA 3M8LA 1DU3D 4YVSA 5C7GA 4IGOA 4AHYA 2X29A 1ZA7A 1JBCA 1HQWA 1MZ6A 1V6LA 2ARBA 1FV3A 1F4HA 2VXRA 5FLHA 5H9PA 4AOCA 5DDJ3 1VMHA 3RVHA 3U4XA 2H0VA 5FY0A 5I0RA 4NAMA 5JPNB 1TNFA 4LUMA 2DVBA 2EAAA 4JGZB 2HWC2 3AL6A 2WNEA 1BFGA 3CA0A 3ILAA 1V6MA 4AVTA 1PGL1 3LGRA 3OJBA 3DYOA 4Z8SB 4Y1YA 2EVXA 3GJBA 3Q8FA 3WMVA 1OHFA 2FDIA 1UY1A 5JLVA 2E51A 4Q4Y2 4AGVA 3BUCA 2ORZA 4FAGA 3O5WB 4QQHA 5H9SA 1K5UA 1R093 5ANQA 3ZFFA 2PHDA 3ZYHA 3RZLA 4I4QA 4D94A 2EXHA 5A32A 1DP0A 2IVIB 2KR2A 1EV12 3IWZA 5FV3A 4D6SA 5C70A 1CE7B 1N3OA 3UKNA 1D4M3 4RR3A 4K9SA 2MEV3 1Y9QA 4D6QA 5T5JA 1YNAA 2GC3A 1AL21 1OD5A 1PIV2 4RS5B 4OZOA 3OBRA 5DXDA 4AQSA 3WHTA 4CU7A 1N3QA 2PQQA 5D8AA 1AXYA 3NJVA 5DVHA 1DZTA 1CAVA 3ATGA 2VMFA 1SLAA 2BJSA 1WA4A 2DVFA 2YUGA 3B5LB 3RJ2X 4YSFA 2DVGA 2FBEA 3VKNA 1D2SA 5FZLA 1YQ8A 4D6RA 2DFCA 2X09A 2WRYA 2ZZQA 3TN92 3WF0A 5FREA 4TZDA 3DL3A 1ZZ9A 2JKXA 1W2TA 3O0WA 3K4DA 3J7MA 4CXYA 5JZGC 1YIPA 4FPGA 3BPZA 4NVPA 4FPKA 4CEYA 1QJU1 1UU4A 1QY4A 2Z79A 5HXMA 2PMWB 1WCSA 4MGSA 4OZXA 1RIRA 4L9BA 4QM9A 1YYNA 4BDVB 2PELA 2D6NA 3W20A 1COV3 1RMU1 3GXUA 1XXNA 1ZZ6A 3WQBA 5FZYA 2BDRA 4AGGA 4WVMB 1TME3 4ZZ5A 2Q8DA 2WNVC 5HCHA 4NIGA 1RUF2 5CKMA 1UX6A 4RQPC 4MZFB 1YFXA 2OUHA 4GB33 4Y20A 3DPRB 4I01A 3VKLA 1VBC3 4DRRA 5I8TA 1TFMB 1UAIA 1OKQA 2WBKA 4J1XA 1GANA 3PVNA 2F4LA 4LBQA 4L92A 4UFIA 5D21A 1HRI3 1W6PA 2BTVC 3AFKA 3OUJA 5HCAA 4QC4A 2R072 2W2IA 3KLSA 5FZ7A 1BBT1 2V5DA 1OUXA 2QCSB 2ZA9A 3PVBB 3I59A 5BQUC 4SBVA 3MW3A 1PX4A 2WYFA 2B8MA 1W9SA 2HBUA 1S0DA 2PQSA 2RS53 3IIIA 4NHXA 4TLPA 4JDOA 3O1PA 2B42B 1IJTA 4AEJA 2DV9A 1A78A 1W6NA 2MHFA 5DDJ1 2WZPP 1IRPA 3JB4C 5C5UA 1WMEA 3DEMA 5LWBA 2W08A 1GP5A 5BXSA 4OHVA 2HWD2 1I1EA 2VMGA 1T9FA 1X9TA 2JB8A 1EPWA 3E1F1 4AFCA 1O3SA 2VMDA 2CTVA 2ZMLA 3EBRA 4G6MA 2QDRA 2B4KA 2D6KA 1DF0A 1F4AA 4X8NA 4KGGA 2RDSA 5ACA3 4Q0SA 1Y7BA 4PF5A 2JIJA 3WDTA 3BB6A 1GU3A 4ZU7A 3O4DA 3Q7XA 3P6IA 4AHWA 5E8AA 4UOJA 1E0OA 4QU2A 2VCBA 2BP6A 1LKNA 4YLZA 4CCKA 3CRGA 1EV2A 1HQLA 4HSLA 4HSJA 2ZKNA 2FMDA 4LO4B 4CSWA 4E2QA 4EROA 5D62A 3WG3A 1NKGA 4I0AA 1RJ7A 3G7DA 4UT5A 4MXVA 2A3WA 3N7LA 4LITA 4LLOA 2MEV1 3RWKX 4KU8A 1LB2A 1FQ9A 2E4MA 4LUKA 3J7NA 3OGRA 4Q1RA 3VBRB 3WNLA 5DSSB 2DRYA 4IUGA 4FOQA 4U2AA 3HNMA 5EFUA 2DCJA 1VBA1 5B4NA 4ZA3B 2RS31 3W9TA 4XCBA 3ZIXA 1WWYA 1PMIA 4CDUA 5F90A 1EYLA 1JN2P 2XXZA 2C6SA 3FHAA 2ILMA 4Q8KA 5ABJA 1FN0A 2VAUA 2VY0A 1HXS2 4ASLA 1LEMA 3IPVB 4IEPA 3ZFEC 5CBLA 2VUJA 2WS93 2CWMA 3H3UA 4UFMA 1RVF3 1NCRB 1ODNA 1YQ5A 4IEWA 4JGYC 5C9AA 4MGTA 4DB5A 4LO3A 1BEV3 1SBDA 4HZFA 4AEDA 1LULA 3GBWA 2VCCA 3ZXEA 2R49A 1RXFA 1BARA 5K9YA 2ZX1A 3SLIA 2XUEA 1OA2A 1UWWA 2VW0A 4UW4A 2Q4SA 4XBLA 5FOJB 2IHOA 4AZZA 5BOWA 4I09A 3F2ZA 2VUDA 4I6IA 5GZDA 1RINA 3OJMA 2VPVA 2WN3A 3KMHA 2E7TA 4LNVA 3IMNA 1AHSA 3WNXA 4MZHA 2V09A 4DRVA 1L7LA 1ND2C 2BFUS 5F2WA 3AMPA 1PO12 4GULA 3J8F2 3KSCA 2P3KA 3VHRA 4R4XA 5FYIA 3NKTA 5DN2A 4ZHNA 2JDAA 2W92A 3L2HA 3ETPA 1WBLA 2UYAA 1WLWA 2N7GA 2DVDA 3N9OA 2W94A 4BIOA 4BQ2A 3KVAA 3BKZA 2ZXQA 1RUD1 1GQHA 4IEQA 4JRLA 1UKRA 4YM1A 5LBEA 4CU8A 3NNMA 3PHMA 1G9FA 3NNFA 4GB31 2QDNA 3VT0A 2HKXA 3ILRA 4DY3A 3BA4A 1LENA 2I1BA 2JDYA 4ZFWB 4HOOA 5BNOA 4I96A 1YCIA 2E9QA 5CYYA 1WMDA 5LATA 5BP5A 3A0KA 2CY6A 4JPZA 2RE9A 4R9AA 3M3EA 1CAUA 2ES3A 2ZHKA 2RS51 1W0OA 2RVAA 3PUSA 2I45A 5DAXA 1JY0A 4XF4A 3WO4A 4IV1B 5F9TA 1QNWA 3H6RB 2A5ZA 4P02B 1XYOA 4EN7B 3WINA 1DQ2A 2UWCA 2BNOA 1NE6A 2NQYA 4FPEA 4AI2A 1H0BA 5JDBA 3FLRA 3HSMA 2WNUC 1R64A 4XTPA 2W46A 2ZCWA 3HWJA 4NRPA 5FCCA 2PHRA 2XH6A 5E89A 1PUUB 2JDMA 2YBSA 5FWEA 4BCUA 1OVSA 2C9AA 3LEIA 4BJ0A 1W6QB 4ONUA 1AYN2 3ROUA 1RUOA 4XJ8A 5FZKA 3ZSEA 1S0JA 3D6EA 4LK6A 3IIRA 4I0WB 2WFF2 2X5IC 3K51A 1MEC2 4KBBA 3VD9A 4USOA 3ZC8A 4OUMA 4RD7A 4HA2A 4L97A 1PGL2 4GAZA 5I93A 4G9SB 2PHXA 2RG4A 2Z2SB 3VWCA 1I6XA 2QQKA 4PQ9A 4XAAA 4RA0A 4DO0A 5FWJA 4P9LA 3ZMNA 3VGIA 1OFNA 1W8TA 1U0AA 1LU1A 2JG8C 3M1HA 2B39A 1VBB2 1HJFA 1PVXA 3MO4A 1YFYA 4XVHA 4K40A 3WV6A 4I4RA 5BXTA 3DV8A 1I3HA 4OEFA 2WDBA 1CX1A 4F34A 4YG0A 5FP8A 1W2UA 1SG3A 2TUNA 3SCFA 1RVF1 4CDXA 1BA7A 3ACIA 1JYIA 3WW2A 4OVEA 2OYZA 1BEV1 1A3KA 2A6VA 4URTA 2ZGLA 5KXCA 4HR6C 1AL22 2VUAA 3HD8B 4LQRA 1DFQA 1W2OA 2LM3A 1DFCA 4N90A 4X39A 2XQXA 3NAPA 4JHTA 3JUTA 1O4YA 4RGAA 5KC5A 2ZABA 4PBOA 2OXBA 3VBFC 5LK5A 4JTNA 5JXJA 1ILR1 1HKNA 2ZGMA 1OQLB 4TLFA 3P53A 3KWVA 2XOAA 3UJ4A 4JAAA 5EV7A 5FZCA 5K4LA 3LCPA 1PM4A 1KGYA 1R1ZA 1Q8PA 2YU1A 1UPSA 4QQPA 4XIKA 5F3EA 5CKQA 3PUHA 4FSJA 3WDYA 4D3WA 4LBLA 5M0TA 3H7JA 1GWKA 4Z82A 2O14A 5EC5A 2HH9A 3BA5A 4M3CF 2VL4A 3S0MA 3AVSA 1KS4A 1QJU2 3OD0A 2Y6JA 1JQZA 2VVFA 2ZGPA 3UT0A 4LBNA 4LO7C 2BQPA 1RMU2 4BM8A 5B4XA 4WM8A 1KXGA 3JXSA 3BAVA 3KV4A 4CP1A 3I2FA 4MGQA 1YHFA 3VBHA 1WCQA 2J7MA 1OOPC 4CCLA 1AVBA 4XXAA 1OA3A 1SBEA 3I2DA 3GZAA 1NQDA 4I0YA 1E57A 2WO2A 2ZGUA 4AR2A 4COWA 1W3XA 5BNPC 3DN7A 3EJKA 5T5PA 3FUOA 2CAUA 3BIEA 1X50A 1QJX2 1OLRA 1XOYA 4NAOA 4F3JA 2RHPA 2AREA 1PO23 4KGQA 1UZYA 1T6BX 2R30A 4JGZA 3PHZA 3I29B 4CYDA 1KJLA 4Z2AA 2R041 4FOVA 3NL1A 5KHIA 4OQ9A 3FJKA 3QYDA 3K48A 4K1YA 4AF9A 4CXWA 1JMUB 3AH1A 2IXKA 2WRAA 2BW8A 2XDVA 1VRH2 3AP6A 4NHLA 2QKDA 3VBUC 4QHBA 3H8RA 5FZ3A 2F2FA 3H0OA 4FPCA 2K43A 4NPMA 1ULCA 3D0SA 5IFTA 1UY4A 3NQHA 1D7PM 5ISLA 2V73A 1Q8VA 2P2KA 4N8MA 4BPZA 3ECQA 2RG9B 4I1BA 2HZ9A 5FYHA 1WLTA 2A6YA 3WLUA 4XUQA 1ISZA 2F17A 3THDA 1BVP1 1MACA 1WBFA 3LA3A 4GZ9A 4ZS3A 2VM9A 4I3NA 4FFHA 2MC2A 1LJ7A 3AJ6A 4DXZA 3MI8A 4Q4Y3 1P63A 4RS5A 3RDIA 2PLV1 4K6BA 3HQRA 4QKFA 2ET7A 2QN4A 4D0TA 5AFEA 3B01A 1S0FA 1GWMA 1XSRA 1EV13 2OZJA 2X53S 3H3ZA 2Q9XA 3DCQA 2AYHA 3OPWA 1EUUA 3AMMA 4CUGA 3ZXAC 2J3PA 1ULPA 3P6BA 4OLLA 1WCDJ 2DYCA 2RS32 4J1WA 4R9DA 3ZFFB 5C3PA 5FO8B 2HWF2 1PIV3 5JSOA 2KI6B 1EAH2 2NVHA 2BWCA 3MLLA 4JCKA 4COUA 5CFDC 3TWIA 4WBCA 4CUCA 4PLMA 2UURA 4E4SA 4MH0E 3SH4A 3WO3A 3E6CC 5FOBB 1DJSB 4FOWA 5A1FA 4C1XA 3MV01 1N3PA 3VHNA 4EN9B 4P0JA 5A1LA 5A70A 4XKIA 3GDBA 3HJRA 4E9KA 2XR4A 5BNNA 3IKWA 5G05L 4K1ZA 1C28A 1JUHA 4WVMA 3KQ4B 3RRDA 1CAVB 2QTWB 3OJ2A 3L2YA 1Q3EA 1UU5A 3WNMA 1TVGA 2VZPA 3DPRA 4NPLA 5CVRA 4Q0VA 2GZWA 2OZ6A 4MZUA 4D8MA 5DUVA 2VOXA 2IC1A 5FY5A 1AX1A 1H4HA 2ZEYA 3ES4A 3CDZB 2KLLA 1OQDA 2HJIA 5FK7A 1PGW1 2GDFA 2D6PA 1ZBA3 5DUWA 1YBIA 1RUD2 5L7OC 5T5LA 3OUIA 3I97A 3Q8EA 4CEYB 1QXPA 2NP0A 4IYBA 4OUEA 1JH5A 2YHJA 5IAXA 3RZKA 1OPMA 1PO21 3ZKUA 5IK8A 4IEVA 4EB2B 4PIXA 3R05A 4ZGRB 1YO8A 2WR9A 1CESA 4IGQA 1XBFA 2R073 1ZZ7A 4IERA 4TSVA 4YNIA 2ZR1B 1RUC1 1CJDA 1PK6B 3JBG1 4GMP3 3BAHA 1K12A 4KBZA 1SPPB 1KNMA 1NA1C 5F8WA 4P9JA 1CAWA 1RL3A 4FPLA 5I0SA 5KHGA 1RG8A 3CA6A 1SZBA 1WW7A 4Y22B 5FXXA 3VT2A 1QGLA 3M3IA 3OSDA 4NRQA 5DG1A 4OHYA 2E31A 1RZOB 2EXKA 3T0AA 2HWC1 5AVPA 4KWUA 2WQZC 2YV8A 3GM8A 3POBA 3WF1A 2GAUA 1AR62 5FP3A 5F1RA 2R061 5D2AA 2H6BA 2D20A 4OI4A 2A3YA 3SCHA 1W6OB 2VZRA 3VBRA 3MEPA 4Q9PA 1V6NA 4N53C 2UWAA 2D6MA 4Q9GA 1IQAA 3MW2A 1IKQA 1GZWB 2W68A 3OBTA 3T2OA 3JRRA 3KS7A 3MGUA 5CISA 5DABA 2AGSA 4EE2A 3PUBA 3KHBA 1VE0A 1F2NA 3O14A 4EFPA 2FDGA 1G8WA 5T5OA 1WBAA 8I1BA 3IBMA 4A7ZA 3GZTB 3GZEA 3O4AA 4LO1A 1NQJA 1NG0A 1T2XA 4AFBA 3IPVA 4MO3M 4DUWA 3IM0A 1TTUA 4G6JA 4BISA 3GBFA 3ZSLA 5F6LB 21BIA 5FYBA 4LOSA 2VZ3A 4OEGA 2LRPA 4ATFA 1ND3B 1PIV1 3WVJA 1V6KA 3FLPA 4Q4W3 1ZZCA 4DXRA 4XEZA 4RGGA 3WSOA 4LO2C 4D8HA 3O1TA 4D0QA 4FXKB 3FL7A 1H8TB 1A8DA 3J26N 4J23B 3Q9OA 3H6QA 1ACCA 1DDLA 4CZSA 1A34A 1SFNA 1HXS3 2A75A 2PAMA 5C8CA 3HT1A 1JLXA 1GQPA 3TN91 2A70A 5IUQA 5CG9A 3MALA 2W1WA 4LKSA 4GWNA 4MHUA 3H1MA 1QH7A 2YPJA 5K0UA 5EG6C 1EP0A 4M0NA 1Y9MA 2AQZA 4XILA 1BXHA 2FDFA 2YYOA 3D3AA 4GQ7A 5FYUA 5CADA 3WNKA 3VL9A 5ABJB 4MZGB 4YM0A 3AKQA 4YW7A 1JYCA 1BK1A 1Y3TA 3A21A 3I3MA 1J3QA 2WJSA 5DUXA 1MS3A 1JZ3A 1PM7A 2R1BA 1LOFA 5JSPA 4PJYA 1AR82 3FBYA 2OIIA 5AVAA 1YQ6A 2W5FA 5FP7A 3LIHA 1XNCA 4LHNA 3I3BA 4O9EA 2FCUA 5LK7B 3WUCA 1PO13 2DU0A 2OT7A 2NN8A 3J8F3 4IV3B 5EPAA 5F5IA 5EHAA 1S0IA 1REDA 1GLHA 4NE9A 5J96B 4QX2A 9ILBA 4CUAA 5FZ4A 5FP4A 2WZ8A 1RUF1 4LULA 4IV1A 4R4ZA 5LY1A 2VQTA 3ABZA 1G9AA 1OQEA 4EV0A 4QPGC 4YM2A 4QB1A 41BIA 5BPXA 4DIQA 4AI9A 3QBQA 4FXGB 5FLIA 4MLOA 4BH9A 5DAVA 5FDBA 1ISYA 4Q91A 2AFGA 1GBGA 3LB9A 3WQ7A 1EUTA 4GMP1 2H6CA 2PHUA 4IXLA 4PDWA 2Y6FA 5FXZA 3TAYA 4AHZA 3D7WB 1MS5A 4GH4B 2ZKLA 3E97A 3MW4A 4Q0QA 1RUI3 2KI4A 4I4OA 1WW6A 3HPNA 3C7GA 1FWVA 2K0GA 5LY2A 2HWD1 3NBEA 1NCRC 1X9PA 3WDXA 1JTZX 1OLMA 4B7KA 1W9YA 2R6QA 2Z48A 2VECA 2PA7A 3KF5A 4A7KA 4M3CB 3T08A 1ABRB 1DLCA 5LEKA 3UGHA 3OD4A 4YVWC 1MQTA 3ACLA 1RUE2 1LODA 1CPNA 2HWE2 2JECA 4LEJA 4F7ZA 2VMEA 3RZGA 2R1DA 3AKGA 3O12A 1AYN3 4OMDA 2I74A 1F5FA 4LA3A 4RFT0 4I2SA 3D4KA 4MOAA 2WFF3 1IT0A 4UW5A 3GHMA 1MEC3 5JMCA 4AVCA 1UO9A 2W95A 2Q1MA 4QPIB 4YWAA 5BNQA 1ONKB 4ENDA 2XKOA 1VJ2A 2RS12 1QJY1 3VEQA 4B4RA 4CEWA 1EYBA 3NV1A 1P8JA 3EYPA 2WO1A 3IAPA 5FZEA 2ORXA 2KH2A 1N1VA 2FO1A 3UJOA 3N3HA 2PLV2 3JCIA 4NHYA 5CKNA 4GP3A 1VBB3 4JKMA 1K5MB 1H1IA 3I2JA 4QDSA 4UFLA 4JZRA 1MS0A 4MV2A 5H9RA 4XOGA 3VBOA 1Q8OA 2GMPA 4CDWB 3HVDA 2P3JA 2HEWF 4XDPA 2H0BA 4COVA 4EN0A 1DYPA 4OWKA 4XUNA 2QQNA 2CSGA 3M7AA 4M01A 3ZYIB 5J37A 3AKFA 2D6LX 2WUHA 4I02A 1AL23 1DZRA 2JDHA 3MPBA 4TN7A 1VB2A 1UMIA 5BXXA 1SR4A 2O0OA 1IPSA 1WLCA 1QJEA 2XHKA 1HDKA 1ZBE2 4LO5B 2GMMA 1R1A2 4N43B 1GSLA 5J09A 2VO5A 3VD4A 1CX4A 3THCA 1OH3A 1QOTA 2VVDA 3IZOA 2BZDA 4JTOA 5FPLA 4CXXA 1PO11 3M3QA 3ZSJA 2A6XA 2WO7A 4LJHA 1W99A 2WLQA 1KDKA 3AKRA 3I3QA 4K20A 4FFFA 3U0ZA 4MG2A 1NLSA 2J1SA 2YG0A 3I8TA 3T4HB 3T2QA 1WCKA 2BVVA 1PMJX 2JJ6A 3LZZA 4MGYE 5GM0A 3NJ5A 4IHZA 1QJU3 5CFCB 2B9UA 2Z49A 1TZOA 3UYJA 2DBIA 3EB7A 1GMMA 1C57A 4HK9A 1UYYA 1DCSA 2OUJA 1RJ8A 1RMU3 2UY9A 2ZX3A 5A7OA 2WL1A 5FR3A 3DF0A 2Q8EA 2VG9A 4FTEA 2GZBA 4C91A 3FHQA 3P1IA 1S0CA 3BAOA 4MXWA 3ZR5A 1AJKA 5C4WC 2XWBB 2WINB 2WA4A 5D63A 5FYMA 3VD5A 1B35C 1LNSA 6I1BA 3R4DB 5ERLA 3B9IA 2VH9A 1F5JA 1MR5A 5FY7A 4ARXA 5FYVA 3VBSB 1OFSA 4XJUA 2QE3A 5IJRA 2FDJA 1UL9A 2Z5WA 1QJX3 2VR4A 2JDUA 1GYKA 2P5BA 4MGZE 5LEJA 1AVXB 5I1BA 4TXWA 3VBHB 3FJEA 4J2YA 1BBT3 3B02A 1RUC2 3JBG2 4P9GA 5JOZA 4YG3A 4A45A 1NZIA 5LA9A 3WA1A 1MC9A 4UF0B 5DAPA 2WT0A 4KU7A 1AYN1 4XABA 3SH5A 1VRH3 5BXPA 3KT7A 3I3EA 2XJTA 4NHKA 2AAIB 3BA7A 2WFF1 1XNKA 1MEC1 2ZAAA 3LOIA 2VE1A 3K1XA 3DYMA 2VQAA 2R062 3NV3A 1W0NA 3QH6A 4PT6A 3MV11 4COYA 3H6SE 2Y8KA 4QPYA 4OWLA 1RYYA 3LEKA 5T54A 4H75A 1DQ5A 1WA6X 1NAEA 1XYNA 2WAOA 4FPHA 3U4SA 3AP9A 1W8OA 5FY1A 3VSFA 4DEVA 2VOKA 1X8EA 4BA6A 1VBB1 2AH2A 1XRUA 3AX4A 3CL1A 3RJRA 3T0BA 4ORFA 4YARA 2XJSA 3UJQA 1V0AA 4UBHA 1REFA 1WCUA 4DXTA 4LHSA 4X8PA 4IONA 4II0A 1JYTA 4LKDA 2SBAA 4XJZA 3UD8A 4XFGA 3O5SA 4L11A 2BWAA 5BVPI 2GMEA 2XJVA 5CA6A 2EA7A 1IG0A 3WD5A 5KWRA 4QKBA 4XTMA 5DAWA 3NW4A 5C6CA 3WINE 4E4DX 1XNAA 2J1VA 3MFAA 4LO0A 3AKIA 3WZ1A 1VBA3 4BE3A 2RS33 2ZZJA 3N7KA 4I4XA 1LGNA 2JG9B 3AZYA 4K3UA 1EAH3 2CDOA 4I3GA 1J3PA 1QU0A 4B7EA 4YYOA 4CP9B 4ZOTA 1XNTA 3WHUA 3AYDA 3NO8A 4LT5A 4NR1A 3E5QA 3BB2A 2VMCA 5A7QA 3RMYA 3B3QE 4QGLA 5HV0A 4HANA 3U07A 1N1YA 2HWB2 1UYZA 2CU5A 2D7IA 1H2NA 5A3LA 4DUVA 3NVCA 4YZ5A 2AENA 3AB0A 2CV6A 4R9BA 5J7MA 1GOFA 1JW6A 3PG0A 4YVSC 5FMOL 1O6UA 1OQ1A 4DMIA 4JRAA 4KL1A 1YWKA 4GWMA 5LRSA 2VBBA 1SACA 1WZXA 1UCXA 4FPOB 1HWPB 4CTEA 4XHBA 1ISXA 4E4HA 5FAXA 2TNFA 3WF3A 1DHKB 1PK6A 3ZYJB 3UDAA 4Q4X2 1RUD3 3J4UH 5I0UA 2K8RA 1SPPA 4PCRA 1WMFA 4UYBA 5LBFA 1QQLA 3HNYM 1J58A 3DYPA 2NS2A 4GKXA 5FZ1A 4Y22A 2JDZA 1QJX1 1ZM1A 2B7YA 4BYYA 3DECA 1OSGA 2Z42A 1UPIA 3ZFFC 1X82A 2BVBA 2BOJA 3I54A 3URFA 2HW9A 5ANNA 2XONA 2LALA 1JLYA 3H9AA 2W91A 1VRH1 1W6OA 1HWOB 4AFMA 2JDKA 1GV9A 2YFZA 5D61A 3ELNA 3BOPA 4RR3C 5HPZA 1H2KA 1GZWA 1QXMA 3WNOA 5AC92 2A3XA 5FYZA 2Y6KA 5FZ0A 3V64A 4PC4A 1CIYA 2PFWA 1CZVA 4QAWA 4IZXA 5D8AC 2IXJA 3K4ZA 1V6IA 1CGPA 3FJAA 5FZUA 1CAWB 3SNMA 2CGOA 2XBO2 4IEZA 5FIXA 1W04A 1VRBA 4KG8A 1BFBA 1G82A 4I3PA 4ZXKA 3NBCA 1ND3A 3LDBA 3KVBA 4H2AA 4JKKA 3S7IA 4HVQA 4BB3A 2W9XA 2ADDA 4P08A 3ACHA 2GO2A 5BV6A 5FLJA 2FD8A 5IVYA 3U11A 1H8TA 4YGBA 2XB6C 5GALA 1G7YA 3RI9A 3TEZA 1QJY2 3H1YA 3O1UA 3O44A 4A7YA 3PURA 1CQ9A 4LXLA 3KZ4C 2HYXA 1K42A 4CEYC 2DCYA 3VDBA 2LIQA 2QNKA 1IZ3A 5GZGA 1U5XA 3CJIB 5F32A 2HWF1 1JZ2A 1RHI2 1EAH1 3PU8A 2DREA 2WBCA 3CO2A 5A7WA 4LORA 5K7PA 3NBNA 1NCQB 4XETA 2A6ZA 4WM7B 1QQKA 5LB6A 1GZTA 2BEOA 1AR92 2E26A 7I1BA 4DY5A 4FPFA 2G19A 3WW4A 1R081 1W28A 1PZ9A 2FFUA 4R9CA 4IV3A 4H7LA 1UY2A 4NHMA 4O9GA 2JE9A 3N9NA 4M00A 1HB1A 2RV9A 4X6RB 1BFFA 2GSYA 3SKJE 2WKKA 3LTQA 3Q7YA 2A73B
chains in the Genus database with same CATH topology
5C8CB 1HQNA 1XU1A 1BLAA 1RB8G 3FJSA 4NWWA 4IETA 1AR83 3W58A 2FFVA 4I2OA 3VDDB 2QZ2A 5K0UB 2D5HA 4LTAA 3MPPG 4JDMA 5JOWA 4GH4A 1QF3A 3OTFA 1H2LA 4OWJA 1VP6A 3ZFGB 5B2HA 2NPIA 3AZZA 3VZOA 3FZ3A 2EIGA 4WZCA 4WBBA 1BQPA 2WA3A 3AKHA 3MIHA 3MLKA 1OPOA 4Z8BA 2JD4A 3V56A 4M3CA 3B7MA 4FGFA 1ASJ2 2Y9FA 1JTCA 4HKLA 2ZAHA 1MS1A 3INAA 3E6DA 2GN7A 3WP3A 5BNNC 4XFIA 4OHWA 2XPJA 2E4MC 3MIFA 2CYFA 3E8LC 1LOGA 1V6OA 1APNA 4LA2A 4JQ0A 4K21A 3NSTA 2ENRA 4PDWB 4AG4A 4JAWA 4ZU5A 1AR61 2R043 4CDUC 4QPIA 3FBMA 5GLUA 2WZR2 3BAGA 4Z2WA 5ABJC 1RUE3 1RC6A 3UD7A 2VSEA 4E27A 5C9AC 4LO3C 1FPN2 1EVTA 31BIA 3GALA 4AEDC 1K5MA 2ET2A 1CN1A 4HKWA 2GC1A 4EJRA 1QQP1 1MQTB 4P9WA 4CDWA 3IIAA 3FHIB 4AE2A 3D5OA 1UZZA 2RS13 5F8YA 4W6WA 2LTNA