1UPSA

Glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
404
structure length
402
Chain Sequence
b'AKDFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKESLNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA-GALACTOSIDASE
publication title Three-dimensional structure of GlcNAcalpha1-4Gal releasing endo-beta-galactosidase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Glycosyl hydrolase
total genus 111
structure length 402
sequence length 404
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1upsA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1upsA02
1PUUB 1IOAA 3H6SE 3WDWA 2VSEA 4OW4A 1RIRA 2ARXA 1LU1A 3RG0A 4ZGRB 1CN1A 4IONA 1GLHA 4USPA 3A0NA 3PUBA 4Q8LA 2X2SA 5JDBA 2WSUA 3IM7A 1FNYA 1MC9A 1JN2P 4DCKC 2DTYA 1AX1A 4A7YA 2LIEA 3WCSA 1XHBA 1DLLA 3IPVB 4P6AA 3T2TA 3WINA 1WW4A 5DUYA 4JPZA 3USUA 5DG1A 1MACA 2VW2A 2UUSA 4FPGA 4JAWA 3OJMA 4GKYA 1W6QB 5T5PA 4FPEA 1W3FA 2GMEA 1HCEA 3PVNA 5GZDA 3AP5A 2FDBM 1ULCA 2DU1A 4I7IA 1QU0A 2SBAA 3SNMA 3WHTA 1ITBA 4DS0A 3QR5A 3RTIB 1Y7BA 2DRZA 5DZEA 2FFUA 5KXEA 1M2TB 1FN0A 3BRFA 4HJJA 4ZBVB 2A3XA 4DRVA 4L8QA 2E4MC 1LJ7A 3IN9A 4PCRA 1EVTA 2D3RA 3C2UA 4I96A 3I8TA 3ZXLA 3ILNA 1W6MB 3LCPA 4XJ9A 1PUMB 1DFCA 4Y20A 3NBCA 3A23A 3BRGC 1DQ0A 1E0OA 4QBVA 1DZCA 4IYBA 4LO1A 4I1EA 3ZXEA 3A21A 3WO4A 1UPSA 1IS3A 1RINA 3ZVXA 3W59A 1G7YA 4QBCA 2BEAA 2NN8A 1WD4A 1G9AA 1CONA 4YZ1A 1LCLA 1PZ9A 4ZLBB 5L73A 1V6VA 3UD7A 1TTUA 5DUWA 3FBYA 4YW5A 1ONKB 3N36A 2DU0A 5FRAA 2DVGA 4XZPA 4FOWA 4X3AA 2ZMLA 1GYKA 2MLLB 1G9BA 3JUUA 1D0HA 5EYYA 3WOGA 1A78A 3WDVA 3LSEA 2WBCA 4GWNA 3ZSLA 2F2FC 4Y26A 5DZFA 1LEDA 1C57A 3CA0A 1SCRA 2P3IA 1CVNA 4LO0C 4XJ8A 1AZDA 1Q8SA 3VKNA 2HWAA 4YFZA 4UW6A 1G86A 1JUIA 2ZZJA 2AR6A 4WV8A 2AAIB 2BQPA 3R4UA 3ZXDA 4XTPA 2WT0A 4BMEA 5GLUA 1BXHA 1WD3A 4BPZA 3FFZA 1BFGA 1MZ5A 1UX6A 3BRDA 1N1SA 4ZFUB 1Q03A 5BP5A 4GA9A 3DUIA 3FLPA 3A4UA 1LOBA 3FJJA 1CPMA 4Y1UA 5GZEA 2ZGUA 2FFVA 2ZGLA 1N1VA 1WW7A 4IHZA 2ZGKA 4EFQA 3AYCA 1LHOA 3V0AA 4QC4A 3I2AA 3AZXA 4CZSA 1YI7A 5IK7A 1NLSA 4IZEA 5I1BA 4Y1YA 5FNWA 5T55A 1HQLA 2P23A 4XIKA 4Q27A 5D61A 3HOMA 3POSA 3POWA 2CYFA 2P37A 2A3YA 4Y1XA 1KDKA 1ISVA 4LO2C 1HKNA 1N3QA 4XFSA 4Q9PA 2OUHA 4GAFA 4WZFA 1ZA4A 4ZFWB 1Q8VA 3GALA 3D6EA 2C5DA 3CA6A 4NO4A 2JJ6A 3AP6A 1II4A 3V65A 3POKA 1TWMA 2B7YA 3B69A 1D2SA 1MS3A 5DVHA 3VSZA 4G1RA 3BOPA 2ESUA 1DIWA 2I1BA 4Q2FA 2R0HA 3HR9A 3CA3A 4LBLA 4EFRA 2KH2A 3VSFA 2D1ZA 1W6MA 3NBNA 3NV3A 1S0BA 2VY0A 4P9YA 4Y24A 3ZPYA 2DUQA 2RHPA 3OBTA 1V6LA 3H6RA 4YZ2A 1LULA 2ZGSA 2E53A 3AH2A 1BQPA 3QYDA 2YZ4A 1Z2VA 3PHZA 3TAYA 3Q9OA 4XJZA 3FLTA 1DQGA 3I4IA 2VUAA 2P39A 3BX1C 4OUJA 4I8MA 1T4QA 2VXRA 1S0GA 3E8LC 2ZACA 1EYLA 2EXKA 2JDZA 1O4ZA 1MS1A 3OY8B 3IKWA 1VAMA 4C1XA 1JT5A 1V6KA 1DQ1A 4K1ZA 4FP3A 4HA2A 3SLIA 2WLQA 3V64A 2LIQA 2Q5TA 2F8XC 2H0BA 3FJ8A 1SLLA 2ZABA 1P63A 1QQKA 4P14A 5GZGA 2J3PA 3WUDA 2Z48A 3WDTA 3AH4A 1F31A 2E4MA 1R8OA 3WVJA 2DREA 1JHNA 1H30A 3GNEA 4XFTA 4P0LA 2IHOA 3FJCA 2FMDA 1CPNA 4ISRA 2A7AA 1MR5A 1UMZA 2M49A 1OQ1A 1W6NB 2KLLA 3ZSMA 4J2KA 5GZCA 3HSMA 1LOEA 4GP0A 3B00A 4I4QA 1J0SA 4YGDA 4XE9A 4RL7A 4EB2B 5E24E 3V0BB 3FJKA 1RG8A 1DQ5A 4XBQA 3A07A 2GDFA 1SBEA 4I4XA 1W6OB 3WHUA 5F8YA 2YROA 1AVAC 3O4CA 2ZAAA 4PQ9A 9ILBA 5T52A 4R9AA 5JMCA 4XMIA 4W65A 1LENA 1ULFA 3C9ZA 3N3HA 3BAHA 2ARBA 2AYHA 1G9CA 4GOYA 2GNTA 5DXDA 1HIBA 4XBLA 2E7QA 3O5WB 2WKKA 2Y9FA 1AX0A 4ITCA 3LLPA 2FGFA 4TLPA 1KNMA 1QDCA 1I3HA 5GJ6A 4R9DA 2LALA 2ZMNA 3OYWA 5T5JA 1QOTA 1SLBA 4Y1VA 3FJFA 1SFYA 5H9QA 3B9UA 4FPJA 2PHWA 1KITA 3ILRA 4QO3A 2R9KB 4L4HA 3NBDA 1UZZA 2VLCA 3AJYA 4PF5A 2DV9A 3P6IA 2AH2A 3SH3A 2FHRA 3OJVA 3JUTA 1HWOB 4YW4A 3O5SA 3S8KA 2C9AA 2VW0A 4FGFA 3WNXA 2BFHA 4G6JA 3WO3A 1BFBA 2NMOA 4FPFA 1QNWA 2JECA 1MVQA 4LBQB 4YLZA 5B2HA 3AXDA 1QKQA 3KQRA 4ZOTA 1GGPB 1XG6A 1G9FA 3AKGA 3ZXGA 3WMVA 3ZXFA 1SR4A 5F8WA 5GZFA 1DJSB 4ZFYB 3AJZA 3OY8A 4LBJA 2GALA 4IY8A 2VXTI 1YYNA 5BQUC 2V73A 3VV1A 1H9WA 1IILA 4LO3C 4ZA3B 3VT2A 3NWKA 2EXIA 1JYIA 1JW6A 1A8DA 1L2HA 3WG2A 3BAQA 1J1TA 3BADA 2Y9GA 1LECA 2RSTA 4ATFA 3IM0A 2D20A 5JOYA 1ONAA 1RITA 2ZHMA 1KJLA 1Q56A 4EFPA 1DZDA 4BMBA 2DVFA 3JRRA 2K4AB 2R1BA 1OQLB 2D23A 2WNEA 4YG0A 4X38A 1DHKB 1QGLA 2VW1A 2ZKNA 3OPZA 4SLIA 1S0CA 2D6PA 2EF6A 3WG4A 3BAUA 1JT7A 4R9CA 1XYFA 4ASMB 3W58A 4I4VA 1LTEA 4YGEA 4Z8BA 3M1HA 2K43A 1LU2A 1KJRA 3T8SA 4FPLA 1GZWA 3D5OA 3LSDA 1V6UA 1LGCA 1QNYA 1FMZA 3CNAA 4J2SA 3JU9A 1V6MA 3BIWE 4H55A 4HL0A 3UJ0A 5BOWA 4AYUA 4YM1A 3ATGA 3M2MA 1YO8A 3O49A 2P3JA 5EC5A 2ZHKA 3VKFC 1JBCA 31BIA 4JQ0A 4TYSA 3FJEA 1TEIA 1DQ4A 5LK5A 4Y22A 1K5VA 1U0AA 4EEEB 2Y9XE 4EKXB 4I0YA 5F90A 3VKLA 2UWAA 1Z78A 2GNDA 2GMMA 5HCAA 5T50A 4KEKA 1AXMA 1UZYA 4JP0A 2D6MA 2X2TA 3ILFA 3ASIA 2KM2A 1IS5A 3OJBA 1NUNA 4X37A 3FJDA 1WCSA 4GOVA 2ZGNA 5DZUA 2ZBJA 3D4KA 3WDXA 2W68A 4D0TA 4WVWA 1VCLA 4M3CB 4I2SA 2DUPA 4DQAA 3CAHA 1ULGA 1DQ2A 2A5ZA 2OVUA 2UU8A 4IY9A 4FPHA 2PHXA 1MS4A 3B01A 3BODA 1DGLA 2P2KA 4M00A 4DENA 3W9TA 1TOOA 1WBAA 5GLVA 5IK5A 4XDQA 1WBLA 2UWBA 2DTWA 1VAVA 5DUVA 5IT6A 4X39A 1CE7B 3RMYA 1BARA 1LODA 3AJ5A 2GO2A 2A6ZA 4YG3A 1LGBA 4KC3A 2PHUA 3O4BA 3MW2A 4I3NA 2D7IA 4LBNA 2KKIA 2QYIB 5IK4A 4P9XA 3UJ4A 2I2SA 4YZ3A 1Q04A 5JVVA 3IPVA 4XHBA 1H9PA 1FV3A 5IUQA 5KXBA 3OBRA 3NV2A 1Q8PA 4YM2A 3BAGA 2YXSA 4QALA 3PG0A 1KQRA 1FV2A 3A0KA 1W6QA 4DFSA 4YOLA 5D62A 5BYNA 2L5XA 3ZXJA 1FNZA 3WG3A 1V6OA 4XXAA 3BAOA 3O4OA 4I4OA 5DZGA 1W3GA 3OGFA 4D69A 4XOGA 1HQWA 2D6OX 5GLZA 2XG3A 3SH4A 2CWMA 1SCSA 4K21A 1RY7A 3AXEA 2GN3A 2P34A 5CNAA 5BXTA 1JXNA 1PC8B 2ZMKA 4H9WA 1R8NA 3WINC 2D6KA 1AJKA 1Q1UA 1IHKA 5HCFA 1QDOA 2DWRA 2ET2A 4UW3A 1BASA 21BIA 5DSSB 3ZYRA 3O0WA 4XIOA 2GMPA 3AZZA 1T9FA 2UWCA 3AZVA 4P0JA 4BM8A 5F5QA 1N47A 3KM5A 2RG9B 3LTQA 2LTNA 3AFKA 1V6XA 3BAVA 2Q9XA 2ZR1B 2XOAA 2SLIA 4R9BA 4L4IA 4YFWA 5JOZA 5GLWA 1AVXB 2WJSA 3S8JA 3FUOA 2V5YA 3R4SA 3UD9A 1YTOA 5DUXA 3AK0A 2JE7A 1AFCA 1WBFA 4Q1RA 1W6PB 4XTMA 5BQUA 1QOSA 2EAKA 1SBFA 4XKIA 4ENDA 5CB7A 4YW1A 4LO3A 3UJQA 3UK9A 4I37A 1ZM1A 4LBMA 1MVEA 4XJAA 1W3AA 4LO1C 2OW4A 3VKMA 4OWJA 2EALA 2JE9A 4Q1PA 1S0IA 4XILA 1LOCA 3CA1A 2R1DA 1I1EA 2CTVA 4H04A 1Z4SA 5H9PA 2HWMA 5BVPI 3UJOA 5FNXA 3VUOA 3CQAA 1HLCA 3AKIA 1DZQA 4Q8KA 1AXKA 2YUGA 2PHRA 1ISXA 3QCWA 4USOA 1BLDA 4Q26A 1TP0A 2AENA 2YY1A 3R05A 4QD2C 2AUYA 1AVUA 2W52A 5EG6C 3OJ2A 4AWDA 4M3CF 4OWLA 4GP3A 3USUB 2DVBA 2D43A 1HWMB 1MZ6A 2A6WA 1G9DA 3K1XA 1V00A 4WBCA 2DS0A 1VLNA 3PMEA 1I1BA 1A3KA 2A6VA 4AVSA 5EHAA 2ENRA 3M3OA 2JD4A 1RMLA 1YF8B 4KEJA 2DVDA 1GZCA 1IOBA 4AVVA 3ZSKA 3SITA 1ISYA 2EIGA 1CQ9A 2DRYA 1TIEA 1EPWA 3VWCA 5DG2A 2E7TA 1BFCA 2R0FA 5JOWA 4ISQA 1SZ6B 1TFMB 1NXD1 3POYA 2D7RA 3NBEA 2GZBA 4Y20B 1BJQA 3KMVA 3O44A 1FX5A 1IS4A 1ENRA 2VSAA 2GNMA 2QN4A 5FZYA 4BOWA 3CU1B 1FYUA 4BQ1A 2F2FA 4XXPA 41BIA 1VALA 4LO0A 1QOOA 1PZZA 2AXMA 2D6NA 3NV4A 1LOGA 3BA5A 4RA0A 3N7JA 1BKZA 4Q91A 3RMXA 2D24A 4I30A 1JT3A 3FJHA 1GANA 4II0A 4AGRA 2D22A 2Z42A 1JY0A 4P9WA 1N4KA 4LO8B 4XJWA 3SNVA 3F62B 1GNHA 4LBKA 2ZGPA 4YZ5A 3V79C 4QD2B 1S1AA 5EYXA 2ZGQA 4YM3A 2P3KA 4WVVA 3IIRA 4XFUA 3RTJB 4KBBA 5F8SA 1CIWA 1BA7A 1LHNA 2W08A 3ZXKA 4I1BA 6I1BA 2AREA 1CVSA 1G82A 5BXRA 4ATEA 4Q9GA 1MS9A 1FWUA 3AZWA 5AVAA 3CA5A 4QKSA 3AYEA 2ZQOA 1SLIA 2Q3NB 3RQ0A 5E88A 4C1WA 3VEQA 3D7WB 2ZGRA 3RRDA 1LGNA 1C4RA 4FQZA 2ZQNA 1WLWA 2A75A 4LO2A 4FQ4A 3B3QE 1MD6A 4OEGA 4HANA 4XYXA 2CY6A 3AKFA 1XZZA 2ZGMA 3WO2A 4JCKA 3MALA 2HZ9A 3AX4A 2Y9WC 5T5OA 2TEPA 5E8AA 1WLCA 1Q8QA 3B9CA 3M3QA 4LBQD 2ES3A 4CTEA 3V0AB 3A22A 1FGAA 3IAGC 1UL9A 2ZHLA 4KEIA 2BEBA 1IRAX 1B09A 1W0OA 3HBWA 3ZSJA 2A6YA 3PJQA 2CL2A 1S0DA 4ZXKA 1IS6A 1ABRB 3QLQA 1AXZA 4PBPA 3HN1A 1W6NA 1ISZA 2NM1A 2NP0A 3WA1A 1PWAA 5T54A 1JQZA 1Q8OA 4FP2A 1YXWA 2ZA9A 2MC2A 4G9NA 3MW4A 1WW5A 3V0BA 4AN7B 5GLTA 1KDMA 5HCBA 1W6OA 1UAIA 3L2YA 3N35A 3WUCA 4JKQA 4GWMA 1XQNA 2VU9A 2GNBA 4AGGA 5FZUA 2R16A 4IQPA 1IRPA 1S0EA 2R49A 4OEEA 2PHFA 2EXJA 3OGGA 2NYYA 3H6RB 1BFFA 3RSJA 3WLUA 5H9SA 2NMNA 1ULDA 4FOYA 2JKBA 3BA7A 5GM0A 5CA6A 1FQ9A 1ENSA 5GALA 3HMYA 5GAQA 3BA4A 4I6IA 1QQLA 3ZX7A 4M01A 5G00A 2NZ9A 4MYEA 2ZHNA 3O3QA 3P6JA 4K1YA 2K8RA 1LHUA 1RZOB 4I4PA 3WDUA 5FREA 2XB6C 1OFSA 8I1BA 2EXHA 5CAZA 4Z8SB 3P53A 4PC4A 2A70A 1G8WA 1GNZA 4G9MA 1SLTA 5F9TA 4LBQA 3N7MA 1HWPB 5BXSA 3AH1A 1BZWA 1DYKA 3EF2A 3TB0A 1GSLA 1DFQA 1GZ9A 3WV6A 3Q7WA 4YGCA 3MW3A 4OWKA 1K5UA 1AJOA 4J2XA 3FLRA 4A7ZA 1LOFC 3FJ9A 4YW3A 4I4UA 4LBOA 1LOAA 1OKQA 1UN1A 3AP7A 3AP9A 1YBIA 3O12A 2KI6B 2DURA 4IZXA 1JYCA 2ERMA 3ZYPA 3BTAA 4F34A 5FZZA 3N0KA 1QMJA 1JLXA 4JC1A 1AVBA 1FMMS 1ISWA 4K20A 3Q7YA 4HR6C 1JLYA 2OUJA 1CR7A 2AGSA 1PZ7A 4I4SA 1CJPA 4P0KA 1SR4C 2RQ9A 3SH5A 2DUOA 2YV8A 4AGVA 1GBGA 4F83A 2PELA 3IMNA 5KXDA 2Z49A 1QXMA 1FWVA 7I1BA 4BLIA 2E6VA 1BLAA 3FJIA 4Z9WB 3WMUA 1NZKA 3VT1A 4YGBA 4J23B 3MEPA 4FPYA 2WQZC 4NOTA 2G4IA 1M16A 4LO7C 3ZC8A 1URXA 4D8HA 1V6IA 1CESA 3PVOA 1IKQA 4QKRA 3I2XA 3IM6A 1AXYA 3ENRA 3O0VA 1ENQA 1QF3A 4D0ZA 4FPOB 2WRYA 3ILAA 4GKXA 4M3CE 3Q7XA 4U2AA 2WT1A 3OYWB 1MS0A 3RS6A 4DPNA 2CWSA 1HDKA 2E51A 2KI4A 5EXOA 3CRIA 1F9KA 5SV8A 1TWEA 5T5LA 3VT0A 1SACA 1IT0A 4XJUA 4YW2A 2A3WA 1APNA 3CA4A 3WDYA 4YZ4A 3DGTA 3NV1A 2ERFA 1LHVA 2D3SA 5EWSA 2W39A 5IK8A 4FPCA 3UL2A 3N7KA 1AVWB 1X50A 4U36A 2NVHA 2D7FA 4I4RA 1GV9A 3H0OA 4TZDA 1F5FA 3MPPG 5JOXA 1LHWA 1GKBA 1N3OA 4M3CA 1O4YA 2YMZA 1DYPA 3M3CA 3AYAA 4XMAA 1AX2A 4I4YA 1WBCA 3WG1A 5BXPA 1R1ZA 4XHXA 3I29B 3FJBA 1JT4A 4FOVA 3UDAA 3ZC9A 1FATA 2FO1A 3F1RA 4OZXA 1MS5A 2ZGOA 5HPZA 1Z0HA 3VKOA 1IJTA 4LO7B 1UKGA 1LESA 3AZYA 4AVTA 3APBA 1WW6A 2DYCA 1AF9A 1W0PA 3AJ6A 1FAYA 3IM5A 1N3PA 1C1LA 3H6QA 1DQ6A 4OEFA 1YIFA 1ULEA 1YRZA 3WCRA 1C1FA 1DBNA 5D63A 4DRRA 3UD8A 1LEMA 4XBNA 4FPKA 3O0XA 5CBLA 5JLVA 1BYHA 3PVEA 4DEPA 5BP5C 4CRQA 1S0LA 2VH9A 5DUUA 1HKDA 2D44A 4JKXB 1KRIA 2CNAA 2HYKA 4GXLA 2DVAA 4ZKTB 2AQZA 1HWNB 1N1TA 4BLJA 4G6MA 4UW4A 4GAIA 4GALA 1GZWB 2A71A 1WUVA 1PZ8A 3CRGA 4PBOA 4R6UB 4CJMA 3U4XA 4Y1ZA 3INAA 1N1YA 3O4DA 3AP4A 3T1MA 1GICA 2WSVA 4A7KA 1S0JA 1V6NA 3AKHA 2AFGA 1JOJA 3SISA 5E89A 4FOQA 1HCDA 4YG6A 2WT2A 1SLCA 2PHTA 4Y22B 1V6JA 2D6LX 3FGMA 1JTCA 1VIWB 3HALA 4YM0A 1V6WA 2GN7A 1EV2A 1WLDA 3FJAA 4J2YA 1ILR1 4FVVA 3FUQA 1SBDA 2D3PA 4JRAA 1MS8A 5H9RA 3AYDA 3T1LA 2MIBA 3CRHA 3N7LA 1SLAA 1W6PA 2IWTB 1LOFA 1IKPA 4AN6A 1DQOA 3WZ1A 3O4AA 2HW9A 2ZGTA 2A6XA 3TC2A 5KXCA 3NJ5A 3M3EA 4UW5A 2NTDA 3BB2A 2UURA 1S0FA
chains in the Genus database with same CATH superfamily
1PUUB 1IOAA 1HN0A 3H6SE 3H1YA 1D0GA 1HRI2 3WDWA 3NNLA 2DCTA 2QVSB 5FFOC 2VSEA 4OW4A 1RIRA 4AI8A 4DIQA 4XURA 3S7IA 5E1RA 4AXOA 3H3UA 2VZPA 1JHJA 2ARXA 2K9ZA 3CQOA 4KWUA 4WVMB 3UT0A 3VBFA 1LU1A 1Y9MA 3RG0A 2VNVA 4O9GA 3LKJA 3U10A 3RZGA 4ZGRB 1CN1A 1R64A 3I2IA 2OQ6A 4E8DA 5HV4A 3KB5A 1GLHA 2GU9A 2OYZA 2W9XA 1EP0A 3THDA 5A33B 2RVAA 4IONA 4USPA 1E5IA 3A0NA 3JXSA 3IDEA 1YQ6A 3PUBA 1VBD1 4Q8LA 4CU9A 2X2SA 1R091 2WUHA 1IQAA 5JDBA 1BBT2 1OBNA 2WSUA 4N43C 3SHRA 5FWJA 3IM7A 1FNYA 1MC9A 1JN2P 1NY72 4DCKC 1FMD2 1PGSA 2DTYA 1NT0A 3C7OA 1AX1A 1EAH3 4A7YA 2WQ8A 4XAAA 1JUHA 2P17A 5F2WA 1K45A 3R4DB 4LTAA 4XF3A 2Q8DA 1OFNA 2LIEA 5BNPA 4BIOA 1NLRA 3WCSA 1XHBA 3I3DA 4IE4A 1KS4A 1PIV1 2OA2A 4AL9A 1YJKA 3MIBA 4XUPA 1DLLA 2F4LA 5FXXA 3WXPA 2XLGA 3IPVB 4P6AA 4IGQA 3T2TA 5A1FA 4NIGA 3WINA 1WW4A 5DUYA 4NVPA 4JPZA 3ZYHA 3USUA 2IXIA 2J1EA 5DG1A 3O1VA 1LR5A 1MACA 1W8ZA 2VW2A 4QHBA 4NRPA 3E5UA 3VN4A 4CP1A 5L7OC 4EWAA 1JYVA 4FPGA 4PLMA 3T09A 3ST7A 2UUSA 2BVVA 4CDWB 4OYUA 4LO7A 4JAWA 1Q5OA 5EPAA 4XFCA 4IESA 4GKYA 3OJMA 1TMF2 2C1FA 2NPIA 3RI9A 4XETA 1W6QB 2XHNA 3LIHA 1DGWX 4FPEA 3PTYA 5T5PA 1W3FA 1VRH2 1DLCA 1OLQA 3EO6A 4A44A 5IJRA 1OOPA 1H4HA 3UYJA 1NCRB 2GMEA 2VR4A 3RZLA 1HCEA 1UU5A 4JRLA 2V4VA 3PVNA 5GZDA 1UQXA 3DECA 1P8JA 1D4M3 1UCXA 3AP5A 5FO7B 5IVJA 4A45A 2VNOA 2B8MA 1RUD1 5FY0A 4CCDA 2BOIA 2FDBM 1GFF2 1ULCA 2RS53 4QKBA 2WDBA 2DU1A 1H6YA 3K75B 4QPIC 3RPQA 3WQ7A 1QU0A 2SBAA 4I7IA 3LE0A 4EJRA 3SNMA 3WHTA 4AAPA 4DS0A 2W95A 1ITBA 2B5HA 2RR12 4I0BA 3QR5A 5ERLA 3RTIB 1Y7BA 2DRZA 4V2VA 4HFSA 5DZEA 3X29B 2XKPA 3WF3A 5KXEA 3ON7A 1M2TB 2FFUA 1FN0A 3BRFA 1OVPA 2UY9A 3J8F3 4HJJA 4ZBVB 4WM7C 3SCGA 1ZA7A 2IC1A 1BMV1 2A3XA 5IYYA 4DRVA 5FKBA 4L8QA 2E4MC 1F4HA 1LJ7A 1OHFA 2Q0AA 2QBXA 1PHMA 3BPZA 4RHV3 1HV0A 3IN9A 4PCRA 1EVTA 4CDQA 5DMYA 2LUWA 4Q4V1 2D3RA 3AVSA 3I3MA 5FPUA 3J4UH 4META 5C6CA 3C2UA 3T0BA 2R6QA 4I96A 1J84A 3I8TA 5AVPA 3ZXLA 4A41A 3AVRA 3ILNA 4XW3A 1W6MB 4E8CA 3LCPA 5DPNA 3VZKA 4XJ9A 1PUMB 5A32A 1ALYA 4Y20A 5EJ3A 2E31A 1DFCA 1ZBA1 3A23A 3VHNA 3O1OA 3NBCA 3BRGC 2XWJB 2R043 1DQ0A 1E0OA 4QBVA 3OGSA 3URFA 4RFT0 2BFUL 5LRSA 4XDPA 1DZCA 5HV0A 5K9YA 4IYBA 4LO1A 4I1EA 3ZXEA 4OCTA 5B2GB 2RE9A 1CZSA 3A21A 4EYUA 1PO21 3WO4A 1UPSA 4OI0A 3PTRB 1IS3A 3T0AA 4BK5A 1MQTC 3OUIA 5BNNA 1R1A1 3E6DA 4BQYA 4OMDA 1YQ8A 2VOTA 4Y5SA 1RINA 2WA4A 3ZVXA 3W59A 1G7YA 4QBCA 2BEAA 2W1SA 2NN8A 5KR7A 4XAEA 4AQ6A 4AAXA 1DF0A 1WD4A 2D40A 2L9LA 3VL9A 5DAWA 4CCEA 1G9AA 4F3JA 1CONA 4N43B 4YZ1A 2WNVA 1LCLA 1PZ9A 2QFEA 3D8CA 3GHMA 2PA7A 3ITQA 4W6YA 4XUOA 5L73A 2CU5A 4AI1A 5I0RA 3T0DA 1V6VA 3RWKX 3UD7A 4H75A 5L9VA 1TTUA 2Z79A 1JI6A 5HXVA 4LO8A 5DUWA 4B29A 4M0HA 4BQ2A 3FBYA 4CXWA 4YW5A 1JOPA 3OD0A 1ONKB 3N36A 4LA3A 1OF4A 1WCKA 2DU0A 3EYPA 5FRAA 1SG3A 2RJ2A 4LHKA 5K8SA 4KG0A 3CJIA 1C8M2 2VZTA 5FLHA 1WCDJ 2DVGA 4AQ2A 3N9LA 1DGWA 4QD2A 2B4KA 4XZPA 1W2UA 4FOWA 4X3AA 3AKHA 2Y60A 2ZMLA 5FZ9A 5BY5A 1XE0A 5KHKA 1ODNA 3U11A 1GYKA 2MLLB 4GB33 4Q4X3 4FXKB 1G9BA 2AEZA 1HRI1 3JUUA 4X8NA 5FYBA 1J59A 2ORXA 1D0HA 5JSPA 2KR2A 5EYYA 3WOGA 5L7OB 3D3AA 1A78A 3WDVA 3LSEA 3QD6A 4GWNA 3ZSLA 4AW7A 5F5CA 5JZGC 3HBZA 4Y26A 5DZFA 1LEDA 2F2FC 1C57A 2A73B 2XBO1 1SCRA 2WZR2 3ZMNA 2P3IA 1CVNA 4AI9A 3KHCA 3CA0A 4LO0C 4XJ8A 1AZDA 4JDMA 1QY4A 2B42B 2DDUA 4OQ8A 1Q8SA 5FYMA 3VKNA 4BB3A 3CA4A 4YFZA 2HWAA 1UZ0A 1G86A 3E6BA 4UW6A 2F6BA 5FZHA 1JUIA 3AM2A 1POV3 2ZX2A 2Y6GA 2AR6A 2ZZJA 4WV8A 5LW9A 1BBT1 2AAIB 2BQPA 3OF1A 4TN7A 3R4UA 3H50A 3ZXDA 4XTPA 1NY71 1A8MA 3POGA 1FMD1 1RTVA 3PIJA 1OH4A 2WT0A 4LLOA 4GAZA 4HG6B 4G9SB 5M0TA 4BMEA 5GLUA 1BXHA 1WD3A 1UXZA 3FFZA 4BPZA 1BFGA 1HJFA 4WVMA 1MZ5A 4I3PA 5A7PA 3KF5A 4CA9A 5FK8A 2JDYA 2VGDA 1UX6A 3GZEA 5AC93 4GMP3 2YU1A 1XNDA 1ZRRA 3BRDA 1N1SA 4NROA 4ZFUB 1TNRA 2WAOA 1JZ4A 1Q03A 4FAHA 4WM7B 4CCOA 5BP5A 4GA9A 4ARXA 1TZOA 3DUIA 3FLPA 3CKHA 3A4UA 1LOBA 5AFBA 3FJJA 1CPMA 4QB6A 1PVC3 1JYXA 1ZRCA 1NE4A 2PFWA 3I3QA 4Y1UA 4LT5A 2ZS6B 4UT5A 5F2SA 5GZEA 1YQ5A 2ZGUA 2FFVA 2FCUA 3MF9A 2ZGLA 1N1VA 4ZZ8A 1WW7A 4IHZA 2H0VA 3IIIA 5FZAA 2Y34A 5FZBA 4BQWA 1J0SA 1FOD2 2XJVA 2ZGKA 2RMU3 1W9SA 2KA3A 5JXHA 3AYCA 3FHAA 3K4ZA 1GP4A 3WF1A 3OCPA 1LHOA 1OT5A 4EFQA 4URTA 1VRH1 3F95A 1O4TA 3V0AA 3ZMOA 4QC4A 3GDBA 1DYOA 3I2AA 3BCWA 3TN92 2D5HA 3WMUA 3AZXA 3WNOA 3USSA 1W8HA 1X82A 3CO2A 4CZSA 4R4ZA 3TEXA 1YI7A 2EA7A 2HWE3 4YWAA 5IK7A 1MZEA 1NLSA 1AL22 4MADA 1M06G 4IZEA 1K5MC 2Q8OA 3S7EA 5I1BA 4LKEA 4M0NA 2FBEA 2PLV3 3WW1A 4Y1YA 5FNWA 3KSCA 2O8OA 5T55A 1HQLA 2LROA 2RR11 2P23A 1PGW2 3EJKA 3MIFA 4XIKA 4KH9A 4Q27A 2IUWA 5KC6A 1TME2 5D61A 2ZOEB 2Y26A 1MQTB 3HOMA 2VQAA 3POSA 3POWA 4COVA 2CYFA 2P37A 1NX9A 4IEOA 5D8AC 3LGRA 2FZ2A 5DAVA 1FXZA 2PQSA 5JI7A 4ZY9A 3ZFEC 2A3YA 3OB8A 4D6SA 4Y1XA 4RD7A 5C3OA 3AKPA 3LFMA 1KDKA 4LNVA 5FJKA 1ISVA 3I59A 4LO2C 2QZ2A 1E5RA 5A3WA 1GWMA 2FDHA 4AZZA 1N3QA 1HKNA 4XFSA 3ZYIB 2OUHA 1YI9A 4GAFA 4Q9PA 3RI8A 1EUUA 4FFFA 3WW3A 4WZFA 3S5AA 2JIJA 5HXMA 1ZA4A 4ZFWB 1RUF2 2EICA 4CSWA 1Q8VA 2PAKA 3WT3A 3GALA 1YEWA 2BFUS 2C5DA 3CJXA 3D6EA 4LULA 2HWB3 2YG0A 4IV3C 4NO4A 2JJ6A 3AP6A 1II4A 3V65A 3CA6A 3POKA 1ZVFA 1TWMA 4O7XA 1WGPA 4QAWA 1SDWA 1HXS2 2B7YA 3B69A 5FZKA 4RFRB 1D2SA 3WQ1A 1MS3A 5DVHA 4QX2A 3PUQA 3WW4A 3VSZA 3ACHA 4G1RA 3BOPA 3KCCA 5I0UA 3J7MA 2ESUA 5FUPA 1YC61 2IXKA 4NPRA 1BEV2 5JI9A 2QQOA 1DIWA 4HVQA 4QQ2A 2TUNA 4DOUA 3T30A 2I1BA 3OGVA 4Q2FA 1VBB3 1QJY3 2R0HA 2VOXA 3HR9A 4Z82A 5FWEA 5FZLA 2W1WA 3ZFGB 2VXJA 2XPJA 2VBBA 3MI8A 3GBWA 5C9AC 2ET1A 3CA3A 4LBLA 4EFRA 2RS31 2KH2A 3VSFA 4LKDA 3WF2A 1X9PA 1WMFA 1W6MA 2D1ZA 4RR3A 3NBNA 2ZTNA 1VBA2 3NV3A 1S0BA 3MLJA 4DEVA 1JMUB 1COV2 2VY0A 4LXLA 4P9YA 1PM4A 4Y24A 3ZPYA 2BGOA 2DUQA 1OD5A 2RHPA 4Q29A 3OBTA 1V6LA 5JR2A 4NWWA 1HRV2 3J7LA 3H6RA 4XF4A 4QPGC 4I01A 3Q8CA 4YZ2A 1LULA 4FCAA 2JKXA 4E9KA 1UY0A 3K2OA 3ZR5A 4PIZA 1CZVA 5BNOC 1GNYA 2ZGSA 1UYPA 4XCAA 1HW5A 4CCKA 1H8VA 2E53A 4AEDA 1PVXA 3AH2A 2R062 2VTXJ 1OVSA 4PLNA 2WRAA 4QPYA 4QX8A 3CLPA 1FPN2 1BQPA 4OHYA 4IV1A 3QYDA 2BTVC 1BK0A 2YZ4A 1Z2VA 1H6XA 2IZWA 3MIEA 2BPA2 1S4CA 5LRRA 5FAXA 3PHZA 3K46A 3TAYA 1XPWA 3R6SA 3ZXAC 4CP9A 1VBC3 3KZ4C 4BQ3A 2ID4A 2VMCA 3Q9OA 4Q4Y1 2X05A 3NRUA 4KG8A 2CSGA 3JZVA 4BXFA 4A2UA 4HPKB 3T2QA 5IFTA 3E5XA 4XF9A 4XJZA 1DP0A 3HQXA 5F6KA 3FLTA 1DQGA 5FZ6A 3SCFA 2WZR1 3I4IA 3WEZA 3ZLIA 4CVUA 2VUAA 5F1RA 3THTA 2P39A 5A7WA 4B4PA 3W20A 3BX1C 4OUJA 4I8MA 2RV9A 3ZM8A 4AF9A 1T4QA 2TNFA 2VXRA 4UWDA 3UKVA 4MGYE 2QQLA 1L3JA 1S0GA 2ZX0A 3BN6A 3U0ZA 5FO9B 1KXGA 3KV9A 4OLLA 2WWUA 1CD3G 4QXHA 1VBD3 1L7QA 1K5MB 4NRMA 4W4ZA 3E8LC 2ZACA 1R093 3ZN6A 4AOCA 1EYLA 2ETEA 4H7LA 5FPVA 2QQIA 3VBSC 1VB4A 4WZCA 2EXKA 2JDZA 4X8PA 1PO12 2JDNA 1S2EA 1O4ZA 1MS1A 3OY8B 4LO7B 3IKWA 4K6BA 1O7FA 1C3HA 1VAMA 4C1XA 5LBFA 3DCQA 1JT5A 5D8AB 1V6KA 2IWGB 1DQ1A 3O14A 4QGMA 1SHWB 5CIRA 2IVIB 4K1ZA 3PURA 4XQWA 3HT1A 3WW2A 5A80A 1PIV3 3JB8A 4NN0A 5FZOB 4FP3A 1K42A 3GJBA 2IXJA 1H2LA 1ZREA 4MHUA 4K7JA 4HA2A 1POV0 2P4EA 2WLQA 5APAA 3SLIA 4QPIA 3V64A 2Q5TA 3BI3A 2LIQA 4RGKA 1CAXA 2F8XC 4AQTA 1FOD1 1XNCA 2H0BA 2WNOA 4LK6A 4LO5B 5F6LB 1SLLA 1ZZBA 2ZABA 3MYXA 4HKLA 2AC1A 3FJ8A 1RUOA 1XNBA 4NPMA 1P63A 1QQKA 4P14A 5GZGA 5IHRA 5I8SA 4CUAA 4D3WA 2J3PA 5FKCA 3WUDA 2Z48A 4WM7A 3WDTA 3RGBA 4CDUB 4GMP0 2WFF1 2XL7A 1BVP1 3AMNA 2RDSA 1VP6A 3PIGA 3VLBB 3WF4A 3WQ0A 3AH4A 3LEMA 3GZAA 4EN9B 3VBUC 1F31A 1AL21 2E4MA 4ZPIA 3WVJA 1R8OA 5J3UA 2BGPA 2FDJA 5I91A 2DREA 1JHNA 1UY3A 3KT4A 1H30A 1OF3A 3GNEA 1RUD3 4XFTA 2WYFA 3IAQA 1PGW1 3KVAA 4P0LA 2IHOA 3FJCA 4CCCA 1TME1 2WFPA 2FMDA 1UOGA 3WY6A 4ES8A 5L36A 1V70A 1CPNA 3M8LA 2A7AA 4ISRA 1ZX5A 5D2AA 4AHZA 4EZ4A 2WN2A 4CDXC 5C9AB 1W28A 1MR5A 1UMZA 1ULPA 1OQ1A 2M49A 4E2QA 1LNSA 2VNGA 4IGOA 5CEHA 1W6NB 4YVSC 2V09A 3VDDA 5F37A 3NAPC 2KLLA 3UKTA 1DG6A 1K12A 1R082 3ZSMA 4J2KA 4E4DX 5GZCA 3RZZA 2YC4A 4UFMA 3VZOA 3MZHA 2EVXA 2WINB 2ZCWA 4QPGB 4WVZA 3HSMA 1LOEA 3NJYA 5LEJA 4KWKA 4CPBD 1HX6A 4GP0A 3B00A 4I4QA 4LEJA 1OA3A 1RUG2 4H7MA 1NYWA 4YGDA 2J1AA 4XE9A 4AHYA 5BNOB 1ZZ8A 1RUF1 5FZ4A 2Y6LA 3NL1A 4INDA 3FBMA 4RL7A 4V1PA 4OQ9A 4EB2B 3V0BB 5E24E 1ND3C 3FJKA 4DY3A 3K51A 4CEWC 4LPLA 3UV9A 4B3NA 1RG8A 4Q4V3 2Z69A 1DQ5A 2ZEYA 4JTNA 4XBQA 1VBE2 1HXS1 4DINB 1ZZ7A 1S2BA 1W90A 4P02B 3A07A 2GDFA 2VQUA 1E5HA 5C5TA 2VZQA 1SBEA 1YUDA 2VZVA 1W6OB 3MIHA 3WHUA 4I4XA 5EV7A 4WBBA 2WABA 2B9UA 2A1XA 5ABJA 3FMGA 1BEV1 5F8YA 3H1WA 5FV3A 1J58A 2YROA 4PLOA 4UFHA 1AVAC 3AKTA 1V9U2 3WX5A 1ZBA3 3QH7A 5CKNA 3O4CA 4HXCA 4A3XA 1H2NA 3I3BA 3POEA 2ZAAA 3P5BA 3EHKA 3MUZ1 4PQ9A 1K3IA 9ILBA 5T52A 4R9AA 5JMCA 4OHVA 5IATA 4XMIA 4W65A 5CG8A 1LENA 2BUKA 1ULFA 4AI3A 3N3HA 3VZMA 2Q1MA 4PHZA 3C9ZA 1UMIA 2XJQA 3BAHA 5CYYA 2ARBA 2AYHA 3LF7A 1G9CA 4GOYA 3C7HA 1VBA1 2GNTA 2J7MA 5DXDA 4ZXEA 3K4DA 1HIBA 1W8NA 5A3UA 1COV1 3J7NA 4XBLA 3T2OA 2E7QA 3O5WB 1R1A3 4HN1A 3HEIA 3MPBA 4W6WA 5L9RA 5LB6A 3VBOA 1HRV1 5FBZA 2WKKA 1HB1A 5BUVA 2Y9FA 4O61A 2ZEXA 4K9SA 1AX0A 4ITCA 2VVFA 4UFIA 2QQJA 3LLPA 4EQVA 2FGFA 4TLPA 4NIDA 3PUIA 1KNMA 2WA3A 4BDVB 3RYRA 1GP5A 1QDCA 2MPFA 2VZ1A 1XRUA 2J1SA 2R061 3GHNA 4HKWA 1I3HA 4QX1A 5FTTC 5K0UA 3VBSB 5JZGA 4JGZA 3H8OA 1O59A 1FPN1 2I74A 5GJ6A 2P1BA 1RUC2 4R9DA 2LALA 2ZMNA 1ZZ6A 3OYWA 1QOTA 1SLBA 2OS2A 5T5JA 4AEMA 4Y1VA 2VO5A 5F32A 2XMLA 4KU7A 3FJFA 4HBNA 1SFYA 2V72A 3I3EA 5F3IA 5IW0A 2CDOA 2VG9A 2FDKA 2W91A 5H9QA 3B9UA 1HB4A 4B4QA 4N90A 5BV6A 5FXZA 3KMHA 1C5IA 1UZVA 2Y0OA 3K48A 4L11A 4D7SA 1KD7A 3MFCA 4FPJA 2PHWA 3NKTA 4IDZA 5FZEA 1VAKA 1KITA 2XJRA 5A3OA 3ILRA 4QO3A 1CAUB 2QZ3A 5BXXA 3PU8A 2R9KB 3NBDA 2Y6JA 4L4HA 1HRI3 1UZZA 2VLCA 1QEXA 1U5XA 2JDMA 3AJYA 3PUAA 4PF5A 5KHGA 4MGTA 3PLQA 2DV9A 3K3OA 4COYA 3P6IA 5DAXA 2AH2A 4LOSA 3SH3A 3AMQA 4C0HA 4QDQA 2FHRA 3OJVA 4W6XA 2XBO3 4TWTA 4HKOA 3JUTA 5EJZB 3KV4A 3N9QA 1HWOB 4YW4A 3O5SA 3S8KA 2C9AA 2VW0A 4AFCA 1PK6C 3S30A 3HJRA 3POJA 4HSLA 3VBUB 4EN8B 4FGFA 4AN6A 5FMDA 3WNXA 3E1F1 4GULA 2BFHA 4G6JA 5EZWA 3WO3A 1BFBA 2NMOA 2CHHA 4FPFA 1BBT3 1QNWA 1W8OA 3S0MA 2JECA 1MVQA 2E33A 1PO11 4OMCA 5FZIA 4LBQB 3ZN5A 4YLZA 4AEJA 1H8TA 5B2HA 3AXDA 5A3LA 5FPXA 2KD7A 1AR92 1QKQA 4AHXA 3GXUA 1QIQA 3KQRA 3I49A 3D0SA 4HK9A 4YVSB 4ZOTA 3NAPB 1GGPB 1XG6A 1MZFA 3KVBA 3AKQA 2RM22 5FPZA 3C7FA 5FZ7A 1OQEA 5HPOA 4IE5A 1G9FA 2KI6B 3B94A 3AKGA 4AE2A 3CZUA 4IY8A 1XNKA 3OGRA 2GP5A 1AR81 3ZXGA 1UYXA 3O1RA 3WMVA 1RUNA 1OPMA 2XLFA 3ZXFA 5C33A 1SR4A 5F8WA 5FY9A 5GZFA 1QJU2 3EQEA 4QXCA 2JICA 1DJSB 3VD7A 4J25A 4ZFYB 1H4GA 3AJZA 1ND3B 2GALA 3NJZA 1C8NA 3OY8A 4LBJA 3ROUA 4CEWB 2VXTI 1YYNA 5BQUC 2V73A 3HBKA 3VV1A 2R32A 3CDZB 2JG8C 3ZFEA 1H9WA 3MFAA 3PNAA 4CPBA 1NLQA 2VULA 3C7GA 2JDAA 1IILA 4LO3C 4CU7A 3WD5A 2MEV2 4ZA3B 3VT2A 3NWKA 1O5UA 2WN3A 5FZOA 4NE9A 5CZKA 2EXIA 1RL3A 4NPLA 3N9OA 1JYIA 1RGSA 5DN2A 1JW6A 1Y3TA 1A8DA 1L2HA 3WG2A 1MEC2 1QH7A 5C8WA 3BAQA 1J1TA 2XONA 1NXMA 3I7DA 4L99A 1SEFA 5A1LA 3BADA 3S57A 3VHPA 2Y9GA 1LECA 2H6CA 3ES1A 4UFKA 4IV3A 4CUGA 2RSTA 4ATFA 4Z1VA 1O3QA 2RR13 4JGYC 4PQQA 5IVCA 3IM0A 4TSVA 5JOYA 2D20A 3I2GA 4P08A 4UF0A 1ONAA 3LIGA 1RITA 5IVFA 4LITA 1R081 5C5UA 5KWRA 2ZHMA 4Y5TA 1KJLA 3ZR6A 1Q56A 4EFPA 2WWJA 1UIKA 4OVEA 1XYOA 1DZDA 3WP5A 3RFRA 4QGLA 4BMBA 3RNSA 1JZ3A 2DVFA 3JRRA 1RUG1 2K4AB 3VHOA 2R1BA 2YFUA 5DDJ1 5FYZA 1OQLB 2D23A 2WNEA 1G6NA 3MICA 4J6GA 3BTZA 2IVJA 4H14A 5C9AA 4GWJA 3JB4C 1VBE1 2JG9A 3H3ZA 3KLSA 4XFHA 4YG0A 2VZ3A 2BVBA 3IZOA 4X38A 1HJGA 3THCA 1XNTA 1ND2C 4MGZE 5A7QA 1UX7A 3IB3A 1DHKB 1DU3D 3M70A 4P9LA 1QGLA 4LO3A 2DCZA 2VW1A 3LDKA 4KL1A 2BERA 2FDIA 3DXTA 5LBCA 2VECA 2GC0A 4YVWC 3RYPA 2ZKNA 3OPZA 4SLIA 2ZEZA 1HIXA 1V9U1 4Y4RA 4DB5A 1S0CA 2D6PA 5CFCB 3NQHA 1JH5A 4CUBA 2EF6A 3TWIA 1ZRIA 5JXGA 3WG4A 3BAUA 3TEZA 5ANNA 2HWD2 1JT7A 4R9CA 5BPXA 5C3PA 2O8QA 1XYFA 4LJHA 4ASMB 1NZIA 3W58A 1LTEA 4I4VA 4L92A 4YGEA 3CL1A 4RQPC 4Z8BA 1CAWA 3HAGA 3M1HA 1W03A 4Q0UA 2K43A 3OGJA 1LU2A 3ALQA 1KJRA 3T8SA 2RS33 1GZWA 4FPLA 3D5OA 3LSDA 3V56A 1D4M2 1HN1A 1HQNA 1V0AA 2E32A 1V6UA 3QH6A 2JWPA 1LGCA 1QNYA 1FMZA 3CNAA 2RS52 1PK6B 1L7RA 4M4RA 4J2SA 3JU9A 1V6MA 3GCXA 1IPKA 4IE0A 2D98A 3BIWE 1EY2A 2VMEA 4FSJA 4H55A 4HL0A 4EZHA 2JE8A 2OQ7A 1RHI2 3UJ0A 2IFRA 4N7IA 5BOWA 5FK7A 5FYSA 4AYUA 3J9SA 4YM1A 3ATGA 4B7EA 4I02A 3M2MA 1AL0G 1YO8A 3O49A 4QKDA 2P3JA 5EC5A 2ZHKA 3VKFC 4RYDA 1JBCA 2RDRA 4RHV2 4AQSA 1WLTA 2G9ZA 4TYSA 1TEIA 31BIA 3FJEA 4JQ0A 3NO8A 1DQ4A 3VZNA 1E5SA 4GH4A 3KGZA 5CVRA 3VBRA 2J1VA 5LK5A 4Y22A 4DEQA 1K5VA 1U0AA 1O5LA 1QXPA 5JR7B 1YFWA 2Q8CA 4EEEB 2JX9A 2Z2SB 1JZ6A 1LAJA 2Y9XE 4EKXB 3KGLA 4A3ZA 4I0YA 5F90A 4N53B 3ACIA 4Q4Y3 3UESA 4A4AA 3VKLA 4XUTA 2UWAA 5FQ0B 1Z78A 2GNDA 4XFFA 4Y3OA 1HV1A 2XVKA 4MXWA 3ZN4A 4JKLA 3H42B 2GMMA 1SZBA 5HCAA 1OA4A 1B35C 1XBFA 5T50A 3ZKYA 1J1LA 4KEKA 1UOJA 1UZYA 4PI2A 1AXMA 5LZ6A 3RZKA 1IPSA 2J1UA 1RUE2 2D6MA 2WZR3 3NVCA 2X2TA 4JP0A 2JG8B 2J1RA 3ILFA 1HB3A 3THPA 3ASIA 2R042 2ZX1A 2KM2A 2XKOA 1IS5A 3OJBA 4CXXA 3DYOA 1NUNA 3BOWA 3H8RA 4X37A 1OD3A 1WA6X 3FJDA 2B9VA 1WCSA 4GOVA 3ME2A 1XE8A 2ZGNA 5DZUA 2ZBJA 3D4KA 1X8EA 3ZFGC 2XR4A 2VJXA 3WDXA 1GP6A 2W68A 4D0TA 3K77A 4S2FA 4WVWA 1VCLA 1H1IA 3TRSB 5LBEA 1RUH2 5L19A 2QKDA 3JCIA 4M3CB 1AR91 4O65A 4I2SA 4QX0A 2DUPA 4JGYB 4DQAA 3CAHA 1ULGA 1W0NA 1W8FA 4AFDA 2KXLA 1DQ2A 2A5ZA 2BU9A 4JKKA 2OVUA 2UU8A 4LKFA 1DDLA 4IY9A 1I6XA 1NE6A 5EQUA 2YDEA 2X09A 2G19A 2PHXA 1MS4A 3B01A 4FPHA 4MX3A 1PMJX 3BODA 3DYMA 2RM21 1W9TA 3KV5A 1DGLA 1TQ5A 2P2KA 2VCMA 2WS92 4M00A 5C8CC 4P00B 3ZYBA 5JXJA 1TOOA 5FY7A 3W9TA 1O91A 4LE3A 4YNIA 1WBAA 2W94A 3IDCB 3NNMA 5GLVA 2WNUB 5IK5A 1QJX2 4XDQA 1U5YA 1WBLA 2UWBA 1QJU1 1UY2A 3VBHC 3BKZA 2DTWA 4D6QA 4COUA 1VAVA 3OTFA 5DUVA 5F7UA 5IT6A 4X39A 2J22A 5FMBA 3ZFFC 4CDXA 1CE7B 3DPRC 3RMYA 1FOD3 1SFPA 4DUXA 3AMMA 1BARA 1DGRN 4B1LA 4YVSA 5JCTA 1ND2B 1LODA 3AJ5A 5A33A 2GO2A 3ZOIA 1OI6A 4JQTA 5C70A 1VB2A 2MEV1 4AVBA 2A6ZA 4YG3A 1LGBA 4KC3A 2XLAA 3EMRA 4BQ5A 2PHUA 2LRPA 4YVWB 4CP0A 2WFF3 3E5QA 3N9NA 3O4BA 5FYCA 3MW2A 4I3NA 4RSUA 4BQXA 4JX0A 1MEC1 3PDQA 2WBKA 4IW3A 4N9IA 5EHDA 4GZ9A 5FZ3A 1AL23 3BUCA 5HCHA 3ACLA 2D7IA 4JKMA 3NJXA 1AR62 4LBNA 3DL3A 4L0PA 2KKIA 2QYIB 3R0RA 4GWIA 3VD3A 5FYHA 5IK4A 1REFA 1TMF1 2OKXA 3WNLA 3TBDA 2FZ1A 4P9XA 5FO8B 4UY4A 4RQPB 3UJ4A 1TME3 2I2SA 4GD4A 2Y8KA 1UIJA 3K3NA 3CZJA 5CADA 5LCWL 3O1SA 3I97A 2RS12 4YZ3A 3HNBM 5LK7B 1VMFA 2QQUA 3FL7A 3RZMA 2PHLA 1Q04A 2BRTA 3AFGA 5JVVA 3IPVA 3UETA 1OQDA 2WO3A 4XHBA 4EE2A 1H9PA 1XJAA 5I8TA 1FV3A 1IG3A 4MGQA 4I09A 5FUIA 5IUQA 3KWVA 1UF2C 5KXBA 4UI9L 3OBRA 3NV2A 4DXRA 2IXHA 4OHXA 3QOPA 1Q8PA 1GQHA 2WC2A 4YM2A 1XE7A 1QJFA 4AG4A 4DO0A 4I0AA 3BAGA 2YXSA 1BK1A 2R072 4QALA 4ZS3A 4CDWA 3BGAA 5C4WC 3PG0A 5J36A 1KQRA 1FV2A 3L9JT 4O9EA 4D8MA 3A0KA 5FZCA 1RUF3 2CV6A 3VBFC 5AFEA 2FCVA 2Y9WC 3AL5A 3TNQA 1W6QA 2OPWA 3LEIA 4QPWA 4DFSA 5FR3A 4YOLA 4HZFA 4NHKA 5D62A 5BYNA 2L5XA 1O8PA 3DF0A 1FNZA 1GZTA 3WG3A 1V6OA 4YW6A 3ZXJA 4HOOA 1NQDA 4AEDC 1HXS3 1NCRA 4XXAA 5IAXA 3VL8A 2OPKA 4BWOA 3BAOA 3O4OA 4I4OA 3W5NA 1WWYA 4G4FA 5DZGA 5CG9A 2W5FA 1W3GA 3OGFA 4D69A 4XOGA 1RMU2 1HQWA 1BEV3 2D6OX 3FFQA 4OUMA 5GLZA 2XG3A 3SH4A 4AI2A 2CWMA 2HWD1 4L9BA 3DN7A 1SCSA 4K21A 2VVDA 2BEOA 3M4FA 4BQ4A 2P6HA 1W39A 1PX4A 1RY7A 3AXEA 5KHIA 5CFDC 5BNPC 2GN3A 1B35B 2WZ8A 2D97A 1JYWA 3FHIB 2P34A 4M4PA 5CNAA 5FP9A 5BXTA 4CDUC 1JXNA 4LORA 1VBA3 4AHWA 2ZMKA 1PC8B 5JPMB 1COV3 4PIYA 4H9WA 1R8NA 3WINC 2D6KA 1AJKA 1OH3A 1Q1UA 3NNFA 2HBUA 3CBNA 3DKQA 5HCFA 1IHKA 1IZ3A 1HRV3 1QDOA 4XEZA 2DWRA 4MXVA 4MGIE 2ET7A 2ET2A 3W21A 4UW3A 1BASA 4MGKE 2BV4A 4XC9A 3D82A 4AEKA 4EWEA 21BIA 1RHI1 5DSSB 3JBG2 3ZYRA 3LD8A 1GUIA 3O0WA 2GMPA 4XIOA 4XDOA 4NIAA 3AZZA 1W8UA 5FZFA 1T9FA 2OZJA 2R063 2UWCA 4FFHA 4XQ4A 4ET7A 3HOBA 2QTWB 1W04A 4XZUG 4IXLA 3AZVA 1FPN3 1JS9A 4BM8A 1NOVA 5F5QA 4Z2WA 4P0JA 1N47A 4HETA 3U78A 2Q8EA 2BGCA 5C8CB 1NQJA 1CAVB 1WMXA 3KM5A 2GAUA 4Z07A 3H1MA 4PJYA 2RG9B 3IIAA 3LTQA 3OOXA 2LTNA 3AFKA 1V6XA 3BAVA 1GU3A 2Q9XA 5D1IA 3T4VA 2ZR1B 3WNPA 1H0BA 2XOAA 3AB0A 2SLIA 3IDBB 3SKVA 3FHQA 2GC2A 4UBHA 3W5MA 4OHWA 1LRHA 3OPWA 4R9BA 2IXCA 5FY8A 5L9BA 3VBHB 4L4IA 1T6GC 4YFWA 2YFZA 3MLLA 3KV6A 4KGGA 3KD4A 1AYN2 2XGXA 2DBIA 2JENA 4S2GA 4XVHA 5GLWA 3ZFFB 5JOZA 1AVXB 3DPRB 2WJSA 3FE5A 3S8JA 3FUOA 1RUE1 2V5YA 3R4SA 3UD9A 1YTOA 2DCKA 1EUTA 3WR0A 2GC1A 1C8M1 1UPIA 5DUXA 3RYKA 3AK0A 4AK3A 5I0DA 2JE7A 1AFCA 4KU8A 4HLTA 5FP7A 1IG0A 4GJYA 5LASA 1W8TA 4N43A 3P3PA 5LA2A 2HWC2 1NZCA 1RUI2 4DMIA 1OA2A 2QE3A 1WBFA 2VBDA 4CUCA 1Y4WA 4Q1RA 5CISA 1RUH1 4WM8C 5SV5A 2NS2A 4AFAA 1W6PB 1PO13 4XTMA 2NQYA 5BQUA 4JTOA 1QOSA 1WZXA 2EAKA 4NHLA 1SBFA 2WAAA 4Q0QA 4CU8A 4XKIA 4MOAA 1PNFA 4PDWB 4XCBA 4ENDA 1KFXL 3U07A 3B02A 3ZYFA 5JWPA 5CB7A 4R52A 2WS91 2ADDA 3HNYM 4YW1A 4CXYA 2WBCA 3UJQA 3UK9A 1F15A 4OUEA 4I37A 1ZM1A 4CE8A 4LBMA 4EN7B 1MVEA 4YSFA 4QDSA 1QQP2 2W92A 4I2OA 1AR72 3HIFA 4XJAA 5FDBA 1QJX1 1QWRA 2GH8A 1W3AA 5FZ0A 4LO1C 4QX7A 2OW4A 5FP8A 1UKRA 2Z4FA 4GQ7A 5L7OA 3VKMA 3H7JA 4OWJA 1SMVA 1AR83 2EALA 4K40A 1UY4A 1W3XA 5C4WB 2JE9A 2PHDA 5BNNC 2TBVA 4Q1PA 3VBFB 1S0IA 4XILA 1LOCA 4D7TA 2VZRA 3CA1A 2R1DA 1GR3A 1I1EA 1UU4A 1K5JA 1ZNPA 2CTVA 1YHFA 4H04A 4LQRA 2ZEWA 1Z4SA 5H9PA 2BW8A 2XHKA 3T08A 2HWMA 5BVPI 1US2A 1OURA 3IDAA 3UJOA 3VUOA 1IPJA 3ETQA 3NNGA 5FNXA 3IMMA 2XJTA 3CQAA 1HLCA 2MNGA 4B8EA 3AKIA 1DZQA 2BNOA 4Q8KA 1AR61 3WP4A 4YPJA 3HVDA 4Q0PA 1JU3A 5FY4A 1AXKA 3ZYGA 2YUGA 3ACFA 2PHRA 3LDRA 1ISXA 1NA1C 3QCWA 4BYYA 4USOA 2W2IA 1DCSA 1BLDA 3OG2A 4Q26A 5BNPB 2JEMA 2LW8A 2WR9A 3SC7X 5CFDB 2AENA 1REDA 1TP0A 1WCUA 2RS11 3BVCA 2YY1A 1US3A 2BJSA 1ASJ2 4E4ZA 2RDQA 3ZIXA 3CJIC 3TN91 3O1TA 3R05A 4QD2C 2W46A 2AUYA 1AVUA 1R083 2W52A 5EG6C 3OJ2A 2BWAA 4QQLA 5LY1A 2HYXA 3ZPOA 4AWDA 4M3CF 4OWLA 3ZIWA 3USUB 4LO6B 4IEYA 1EV12 1YQCA 4GP3A 2QQWA 4MV2A 1RUJ2 4Z92B 3JD72 3LOBA 2DVBA 2R071 2D43A 1RUG3 1HWMB 1MZ6A 5FYVA 5DDJ3 1AUYA 1Z7S2 2QQVA 4HK8A 2ZZQA 2A6WA 1G9DA 4DNYA 3UGFA 4XFAA 3K1XA 1VPHA 3UGHA 1XNAA 3H7YA 1V00A 2Z5WA 5C71A 4WBCA 1VBE3 4Q4W2 4QB1A 5C3SA 1OOPB 4FI9A 2EIBA 2B39A 2WL1A 1VLNA 2DS0A 3PMEA 2E9QA 5DABA 2HH9A 2UY8A 1I1BA 3SCHA 1A3KA 2A6VA 1RMU1 4ASKA 3A7QA 1W9FA 3MV11 5TSWA 3B9IA 1V9U3 4AVSA 5EHAA 3MHZA 1XSRA 2ENRA 1X8MA 3M3OA 2JD4A 3POBA 1RMLA 5DQ0A 1BCXA 5G04L 1F35A 2O14A 1YF8B 1YQ2A 2DVDA 4KEJA 1GZCA 1IOBA 5FUNA 1MQTA 2UYAA 2WO7A 2IXLA 2ZKLA 4QKNA 3ZSKA 4AI0A 4AVVA 3SITA 1ISYA 2EIGA 1CQ9A 4MG2A 2CAUA 1W3VA 3UGGA 4AFMA 2DRYA 1TIEA 4BK4A 3W9AA 5FPAA 1W2AX 2VTFA 2W1UA 1EPWA 4DUVA 1Y9GA 5CKQA 1RC6A 2G1MA 3VWCA 4NUBA 3OEBA 5DG2A 4D0QA 3J26N 4MSVA 1UOFA 4XF1A 2VMDA 3JBG1 3TYJA 5A1AA 2E7TA 1BFCA 2R0FA 5JOWA 4ISQA 3MIDA 2YB7A 4W50A 4WM8B 1SZ6B 4LHNA 1TFMB 4K8FA 1B35A 1PO23 4HMZA 1C5HA 1ZZCA 2BDRA 4IL7A 1NXD1 3POYA 5JUVA 1RVF2 2LS6A 2D7RA 3NBEA 1SDDB 4CEYC 2GZBA 4Y20B 2DCYA 1BJQA 3KMVA 3O44A 1FX5A 3Q8FA 4HT1T 1IS4A 1ENRA 2BYVE 4CCJA 1NAEA 2VSAA 3G6JB 1ZRFA 4QQHA 1UD1A 2GNMA 5IVVA 2QN4A 5FZYA 2DCJA 3ZFGA 4BOWA 2ZX4A 3CU1B 1FYUA 2EAAA 2XL9A 1AYN1 4BQ1A 2F2FA 4PF1A 5BNNB 1OXCA 4XXPA 1XU2A 2DFBA 2QQKA 1VALA 3WNKA 41BIA 4LO0A 1QOOA 1PZZA 2AXMA 4GJZA 2D6NA 3NV4A 1AYM2 1LOGA 3OBAA 3LWCA 1RJ8A 2K0GA 3BA5A 5DAPA 5C8CA 4QMAA 2VNRA 4MZFB 2VCCA 5F8PA 4IE7A 4RA0A 3N7JA 1BKZA 1OMIA 4Q91A 4CYDA 3ZDSA 3AL6A 1UYZA 4OI2A 3HQRA 3RMXA 4COWA 2D24A 3LOIA 5FIXA 4I30A 2HWC1 1RUI1 1W2TA 5FZMA 3GYDA 5CFCC 1JZ5A 1JT3A 3FJHA 2JDUA 2P6CA 2YGLA 3KCXA 4UBGA 5CFCA 2WWSA 1GANA 4II0A 3BTYA 4AGRA 2D22A 2Z42A 1NA1B 1U5IA 3UKNA 2WO2A 4P9WA 1JY0A 1N4KA 4RS5C 4QDRA 4LO8B 2YGMA 3ZFFA 4XJWA 3SNVA 1DZTA 3FJSA 3F62B 2YYOA 5LA0A 2N7GA 3HN3A 4DXZA 2XUEA 1GNHA 4JVAA 1AR93 2C9KA 4LKSA 4LBKA 3CJIB 4MZHA 2ZGPA 2HWF2 5EFUA 4YZ5A 4FFGA 2ZX3A 4QD2B 3V79C 1S1AA 3POFA 5EYXA 1QQP1 1S55A 2ZGQA 1CZTA 1AR71 1BVVA 2RM23 2YBKA 4GIQA 2P3KA 4WVVA 4YM3A 3IIRA 2E63A 4XFUA 5HI0A 4HPKA 2B46X 4FBFA 4KBBA 3IAPA 3RTJB 4OI1A 2WLPA 1ODMA 5F8SA 1CIWA 1BA7A 5FP4A 4YARA 1UO9A 1LHNA 1FMD3 4LK7A 3VHRA 1QJU3 2W08A 4QHOA 4IETA 3LA7A 2E26A 3NJVA 5FPBA 4DXTA 1PX3A 1YIPA 2HKXA 2YHJA 4H2AA 4RR3C 1CWPA 5A7OA 4JQRA 3ZXKA 3NSTA 3AMHA 2VUJA 1XB9A 1IGOA 3GBFA 4I1BA 6I1BA 2AREA 4V2WA 1FT9A 4JDNA 1CVSA 3WINE 1G82A 5ACA2 5BXRA 3PMSA 2I45A 1Q3EA 2CGNA 2MEV3 2WYSA 4ATEA 4Q9GA 1K5MA 3F2ZA 2Q1ZB 1MS9A 2VMHA 3D0JA 3TNPB 4C91A 1FWUA 3AZWA 1OC1A 1CJDA 2Y64A 3KCYA 4N53C 2YPJA 1MEC3 2AACA 5AVAA 5C4WA 2DFCA 5BNQA 3CA5A 4QKSA 3AYEA 2ZQOA 1SLIA 2YBSA 2Q3NB 3RQ0A 1YJLA 5E88A 2XBO2 4C1WA 3VEQA 3D7WB 1CIYA 2ZGRA 3OUJA 4IV1C 3RRDA 1AHSA 4X6RB 1ASJ1 1TMF3 5D8AA 2EIEA 1ZBE2 3T3YA 5CU1A 5F3GA 5FOBB 1O3TA 1LGNA 1C4RA 5C7GA 3KQ4B 4FQZA 4MZGB 2OXBA 4UXAA 4E2SA 3LQCA 1VRH3 2ZQNA 1WLWA 2A75A 2FMYA 1O3SA 4LO2A 1T2XA 2G9FA 4FQ4A 3B3QE 4KWJA 3M3IA 3VGIA 4CDXB 1MD6A 3NMBA 1EV11 2CGOA 4OEGA 5A3TA 4HANA 1RUJ1 3ORJA 2CY6A 3JD71 4XYXA 1XZZA 1YFUA 3AKFA 4C0BA 4IEZA 1X7NA 2ZGMA 5J96B 3WO2A 3AMPA 4JCKA 4KMQA 2Y0IA 1M4WA 1Z7S1 4Q0SA 3SQOA 3MALA 2I07B 2HZ9A 5B4XA 3AX4A 4LIVA 2O0OA 4IGPA 5CFDA 5T5OA 2TEPA 5E8AA 5JXIA 1WLCA 1UU6A 2VOVA 2VCAA 5I93A 4QU2A 4XFGA 5FMOL 1Q8QA 3B9CA 3M3QA 4LBQD 1GQPA 4Q4W1 2ES3A 4CTEA 1VMHA 4CDUA 3A22A 5FBJA 4BE3A 3V0AB 1UL9A 2ZHLA 1FGAA 4UFJA 1ULOA 4XFIA 3IAGC 4DUWA 2BEBA 4KEIA 4CEYB 1IRAX 4P9GA 1B09A 4G3YC 2GH2A 4W8JA 3VD9A 1W0OA 4XQDA 2WNUC 3WNNA 3VD5A 4JHTA 5FZDA 3HBWA 3ZSJA 2JXAA 1EAH2 4ORFA 3L2HA 4N9HA 4OULA 2A6YA 3PJQA 4NJ4A 1YCIA 2JDKA 2CL2A 1S0DA 1W99A 4ZXKA 2XH6A 1IS6A 3ELNA 1QJEA 2X29A 3QLQA 3VD4A 2HWD3 4N7UA 1ABRB 1AXZA 1E57A 2OT7A 1J3PA 3HN1A 1F5JA 4PBPA 4IEQA 1A6CA 3GM8A 3OD4A 1W6NA 3PU3A 4PI0A 5F39A 1ISZA 5F5AA 2VVEA 2VE1A 1I5PA 3TOJA 2NM1A 2NP0A 2R30A 2XXZA 4IEUA 1RXGA 3I59B 3WA1A 3VZJA 1PWAA 3ZSEA 4QPGA 5T54A 4LE4A 4QX3A 1JQZA 2WIIB 2X10A 5IVBA 1Q8OA 4FTSA 4FP2A 2P5BA 1YXWA 2ZA9A 5BNOA 5FZ1A 2MC2A 2HEWF 4L97A 4G9NA 3MW4A 1WW5A 5A70A 3WNMA 3VDAA 3V0BA 4AN7B 4NHMA 1QJZA 3EXUA 4LLFA 4RS5B 2XQRA 1JU4A 1RHI3 5GLTA 2RG4A 1VMJA 1KDMA 5HCBA 2VZOA 3NW4A 2CAVA 2BBAA 1RVF1 4QKFA 5F3CA 1W6OA 2GSYA 4FAGA 4IEVA 1CGPA 4BIFA 1UAIA 2C0ZA 2RJKA 3L2YA 3U75A 3O1PA 3RZJA 1O3RA 1J3RA 2YC0A 3KT1A 3QBQA 1OUXA 3MLKA 3OPTA 3GJAA 3N35A 3WUCA 4URAA 2OIIA 2VL4A 2X8KA 4GWMA 1XQNA 2VU9A 4JKQA 4UYBA 2ILMA 2GNBA 4FT8A 4AGGA 5LA1A 2ARCA 4LMFA 5IAVA 5FZUA 5LY2A 4RGAA 2ZXQA 4Y33A 3P6BA 2YU2A 4WM8A 4ZLBB 5A3MA 4E27A 2R16A 3J8F2 1EYBA 3U14A 1JYTA 4IQPA 1RUC1 2VMIA 3GZTB 4QXBA 4ONUA 2UYBA 3CHXA 4RR3B 1AYM1 3P1IA 3VDDC 1IRPA 4ZU7A 3FX3A 3FWEA 1S0EA 2R49A 4OEEA 1RXFA 4MHRA 2D93A 1RUE3 2PHFA 4A6OA 2JB8A 2EXJA 3H8XA 3OGGA 3ZKUA 2Q30A 2NYYA 2BZDA 3H6RB 1C8M3 1WA4A 1ZYBA 4XFBA 1BFFA 3RSJA 5JSRA 1PNGA 3WLUA 1D7PM 1DGRA 2FQPA 4I3GA 1ZZ9A 2NMNA 1ULDA 2Q1FA 5H9SA 4FOYA 3T4HB 1OKOA 2JKBA 3VBSA 5GM0A 4AEDB 3BA7A 5CA6A 1FQ9A 1W2NA 5FMCA 1ENSA 3CMGA 5A7NA 2C4XA 2R7EB 2RS32 5GALA 2FCTA 4QX5A 3MIGA 4IV1B 1RUH3 3FZ3A 3HMYA 5GAQA 3TEWA 3BA4A 4I6IA 1QQLA 2VOWA 2HWF1 4M01A 3ZX7A 5G00A 2NZ9A 1O8SA 5ABJC 4MYEA 1UWWA 2FDFA 2BP6A 2X5IC 3HWJA 5T3NA 2QJVA 2ZHNA 1W2OA 2WS93 4CP9B 3O3QA 3P6JA 4K1YA 5FY1A 2K8RA 4QQPA 1LHUA 1RZOB 4I4PA 1CAUA 3WDUA 4YW7A 1QJX3 1I5ZA 1NA1A 4RGGA 5LEKA 2IFWA 4Q0VA 5FREA 4XF0A 5KBFA 3Q8AA 2XB6C 2VBPA 1OFSA 4E4SA 4YYOA 8I1BA 4HVOA 4X6QB 1GQGA 3DEMA 2EXHA 5A7WB 2FDGA 2CGPA 1Y43B 1JTZX 5CAZA 1A34A 1NCQC 4C8DA 1YFYA 1CX4A 4Z8SB 2Y6HA 3VBOC 3P53A 4COZA 4PC4A 2A70A 5JSOA 5ACA1 1H1MA 1GOFA 2W1QA 3GGLA 3I54A 4JHZA 2HLEA 3VBUA 1G8WA 1GNZA 4CU6A 2Y33A 4Z2AA 4Q4Y2 4YRDA 3BU0A 4XUQA 2EIDA 3ZN6B 2AEYA 5KHJA 3PHMA 4G9MA 5FYYA 2F17A 2QDNA 4QGNA 1SLTA 5F9TA 5K0UC 4LBQA 4JGZC 1AR63 3N7MA 2WQ4A 5DAQA 1UW8A 1HWPB 5BXSA 4C90A 1JODA 3AH1A 1U5ZA 3VDCA 4D94A 1PGL2 1BZWA 1ZBE1 1DYKA 5FCCA 5IVYA 3EF2A 1XU1A 3RWNA 4ZU4A 3TB0A 2BBVA 1GSLA 3NAPA 2ZJCA 1DFQA 3IBMA 1OLRA 1GZ9A 4A6SA 2P3YA 3WV6A 2RS13 2YBPA 3Q7WA 4IUGA 4GB32 4Q4X2 1BLZA 2BWCA 4YGCA 4QB2A 5FMOS 3TN93 2HJIA 3LFIA 5FYTA 3RZHA 1GOGA 2CDPA 3GCWA 3KHBA 4QPIB 3MW3A 4N8MA 1REEA 4OWKA 1K5UA 1CAXB 1AJOA 3CEWA 5A7SA 3M7AA 5J1XA 1PMHX 3BTXA 1ND3A 4KGQA 4J2XA 5FPLA 1Y9QA 2R073 3FLRA 3SKJE 4A7ZA 2VMFA 4CEWA 1LOFC 1KFUL 5F3EA 3FJ9A 5K7PA 4PDWC 1XC6A 5JPNB 2BNNA 4YW3A 4UAPA 4I4UA 4LUKA 4LBOA 1LOAA 1OKQA 1SPPB 1UN1A 1S2KA 3AP7A 4AVAA 5I0TA 3AP9A 4CP2A 1EAH1 4TXWA 2FD8A 5FLIA 1W8WA 3HPNA 1YBIA 3N9PA 3O12A 5JAXA 4E4HA 2DURA 1OSGA 3KT7A 3MF6A 4S2HA 4OI4A 5JMOA 1RMU3 1DZRA 1KGYA 1JYCA 5FXVA 2ERMA 5AC92 3ZYPA 4IZXA 2W87A 3BTAA 4EWDA 1H8TC 3ZYJB 4IEPA 5FZZA 4F34A 3T2PA 3ETPA 1I9RA 3N0KA 1QMJA 5I8YA 1JLXA 5FYIA 4MGSA 4MLOA 4JC1A 1AVBA 2VZUA 1FMMS 1ISWA 1UY1A 3VDDB 5J7MA 1PVC2 2YPDA 2WFF2 4K20A 4CEYA 1CX1A 3Q7YA 4HR6C 1JLYA 2OUJA 2PAMA 1CR7A 1XXNA 2BNMA 2AGSA 2XVLA 1PZ7A 5FP3A 4I4SA 1CJPA 5A3PA 5J98B 1F2NA 4P0KA 1SR4C 2PQQA 4LO4B 4NHYA 3C3VA 3FN9A 2RQ9A 4OZOA 2DUOA 2RMU2 3SH5A 2W3JA 2XJUA 2YV8A 5FOJB 4AGVA 1GBGA 3H9AA 4F83A 3H3LA 4LOTA 3JBG3 3I2JA 1XYPA 5ISLA 5B4NA 2PELA 4F8AA 5JIAA 3IT8A 3IMNA 1D4M1 5KXDA 3MV01 1QXMA 3HNMA 1FWVA 2Z49A 4F7ZA 2HWE2 3UNPA 7I1BA 4R4XA 4BLIA 5ABJB 2X5IB 2RS51 1YFXA 1NUKA 2PLV2 2E6VA 1JZ2A 1BLAA 5EP9A 3POIA 3FJIA 4Z9WB 3K4AA 3LZZA 4LHSA 5A3NA 1X33A 3KS7A 4HVRA 4MVTA 3S5QA 1MPXA 3WP6A 1NZKA 1UNBA 4YGBA 3VT1A 3CF6E 4J23B 2QQPA 2ATFA 3MEPA 4FPYA 2WQZC 4NOTA 1QXJA 2G4IA 4XACA 1M16A 1YNAA 1URXA 4RS5A 4A42A 4LO7C 3J8F1 1TVGA 4Y5Z0 3ZC8A 2OX0A 1OLME 3ECQA 2VMGA 4D8HA 1YWKA 1AYN3 3H8UA 1V6IA 1NCQB 2XWBB 4JDOA 4EROA 1OOPC 1CESA 3RJRA 1SQ4A 3GZUC 2QCSB 4IERA 2XJPA 4RHV1 5FXWA 3VBOB 2J1TA 3AKRA 3HD8B 1UMHA 3IWZA 1IKQA 3JQXA 3PVOA 4J1WA 4FTEA 4NWVA 1PK6A 4QKRA 3E97A 3I2XA 4XABA 3IM6A 1AXYA 3DXUA 3ENRA 5J09A 3O0VA 1VE0A 3BYWA 1ENQA 4NHXA 1QF3A 4OUSA 4CCLA 5IFPA 4P5YA 2HWB2 3TC2A 4I0WB 5A6XA 2HWC3 1RUI3 2PAEA 1GWKA 2ADEA 3SEEA 5JZGB 1L7LA 5K0UB 4JGZB 4KI5M 4D0ZA 4FPOB 2WRYA 3ILAA 2JG9C 4GKXA 4M3CE 1JYNA 4JAAA 3Q7XA 2HEVF 1TG7A 4U2AA 3DYPA 2WT1A 3OYWB 1MS0A 3RVHA 3RS6A 4DPNA 2CWSA 1HDKA 1WMEA 2E51A 2YUEA 3I2DA 1QHDA 3I2HA 5FZGA 1PMIA 3PVBB 2R041 5C3QA 2GZWA 2KI4A 2VOKA 3OSDA 5ANQA 2QQMA 5EXOA 3B93A 3CRIA 1F9KA 5SV8A 1ENXA 5G05L 4PT6A 2Y38A 1TWEA 5T5LA 4NAOA 1SACA 2VPVA 2VZSA 4AVCA 3VT0A 1VBB2 2ORZA 1QJY2 1IT0A 4XJUA 3O7OA 4CDQC 1QQP3 4FO9A 1IHMA 4YW2A 1TE1B 1APNA 1AR73 2A3WA 2VTXA 3AKSA 3WDYA 3O1MA 3MGUA 4HSJA 4N53A 3DGTA 4UFLA 4YZ4A 5EJ1B 1W9WA 2PYTA 2XDVA 3NV1A 2ERFA 5FQ0A 1LHVA 2D3SA 5E6HA 3PJYA 5EWSA 3SXWA 2VD7A 1HB2A 1OLMA 2VUCA 3I2FA 5LBBA 3TEYA 3U4SA 1EPZA 2W39A 5IK8A 4FPCA 3UL2A 3N7KA 2JG8A 3LAGA 4EN0A 1AVWB 1X50A 4U36A 3EB7A 4B1MA 2NVHA 4DY5A 3MO4A 2WO1A 1GMMA 4PIXA 4D7YA 3DV8A 4B4RA 2ZPXA 4QM9A 4TLFA 4LA2A 4B7KA 2D7FA 4I4RA 5LA9A 1GV9A 1WMDA 4ZONA 2VQTA 4QHZA 3SMHA 3H0OA 4TZDA 3BB6A 1F5FA 1C28A 1UYYA 3EBRA 4EN6B 3MPPG 3RDIA 3LPFA 5JOXA 1LHWA 5GKAC 1GKBA 2JB4A 1H8TB 3BPSA 1N3OA 2AZ5A 2DBNA 4M3CA 5FJHA 4NIHA 1PGL1 3BU7A 1O4YA 3LPGA 4JGYA 1U12A 4KNCA 1QXRA 3I2KA 2RJLA 2YMZA 5LATA 1VJ2A 4LHLA 1DYPA 3HQUA 3M3CA 3AYAA 4ZS2A 4BU2A 4XMAA 3J7HA 1AX2A 1ASJ3 1VBC2 4GB31 4Q4X1 4DENA 4AR2A 4GH4C 4ARYA 4BH9A 4IEXA 5A6QA 4ZU5A 2WNUA 3VBRC 3WQBA 3C8XA 3LB9A 3C7EA 5E16A 3CIHA 4I4YA 1J3QA 2WNVC 1WBCA 3WP3A 2O1QA 4NMIA 1XYNA 1EV13 1LKNA 3PUHA 3WG1A 4BJ0A 1RUJ3 3B5LB 3JD73 5BXPA 1R1ZA 2OZ6A 2E7AA 4XHXA 1NG0A 5IVEA 3I29B 1W9YA 2Y6FA 4CCMA 3FJBA 4K3UA 4BA6A 1JT4A 1Z7S3 5IWFA 4ZZ5A 1ND2A 1W06A 2D5FA 4FOVA 4NIIA 3ZFEB 1POV1 2YC2A 4Y4YA 5FY5A 3UDAA 3ZC9A 4FTBA 1FATA 2HBTA 2XUMA 4Q4W3 2FO1A 4NR1A 1VBD2 4YVWA 3BALA 1R092 4LR4A 3F1RA 4OZXA 3VB9A 1F8VA 1MS5A 1X36A 1AR82 3LA2A 2BOJA 2PMWB 2ZGOA 2C26A 5JIUA 4SBVA 4UOJA 5HPZA 2H6BA 3QACA 4P9JA 5AC91 1Z0HA 3FC0A 1RJ7A 2F4PA 2QNKA 3NNJA 4GMP1 3VKOA 1IJTA 4OFGA 1UKGA 4LUMA 4P5HA 1LESA 2VM9A 3AZYA 4IV3B 4TLGA 5FZ8A 4AVTA 4D6RA 4BXSV 4RQPA 3APBA 1WW6A 1UOBA 4UF0B 3WSOA 3AC0A 4R8HA 3LA3A 2DYCA 3G7DA 4QM8A 4DXSA 1AF9A 1PVC1 1ST8A 1W0PA 3AJ6A 1PIV2 1FAYA 4KBZA 1YLLA 1GWLA 2LM3A 3IM5A 4JV4A 1N3PA 1SPPA 1C1LA 3H6QA 4RN5A 3PL0A 1DQ6A 4OEFA 1YIFA 5CKMA 1KS5A 1ULEA 3MDPA 1YRZA 2RMU1 4IEWA 4JZRA 3WCRA 3ACGA 1C1FA 1VRBA 4HONA 4QT6A 4ASLA 2V5DA 5C3RA 2PN5A 1OPOA 1DBNA 1O6UA 2JG9B 4BCUA 5D63A 4DRRA 3UD8A 4XPVA 1LEMA 1OUSA 3GF6A 4XBNA 1J83A 4FPKA 3O0XA 4DZGA 5CBLA 5JLVA 1BYHA 2QUOA 2B45X 2K46A 3PVEA 2HWE1 4DEPA 1LB2A 5BP5C 1Q43A 1WKYA 4EV0A 1T6BX 4CRQA 2DF7A 1S0LA 1RVF3 2VH9A 3MBWA 4XUNA 2PLV1 1QH6A 2ARAA 1RYYA 1WCQA 4J1XA 5DUUA 5FLJA 1RB8G 2VUDA 1HKDA 2D44A 4JKXB 1KRIA 1RUD2 2CNAA 2V4AA 4HN0A 2HYKA 4GXLA 2DVAA 4CDQB 3S6PA 4ZKTB 5DDJ2 3I2OA 4FFIA 2NLRA 2AQZA 1HWNB 3RJ2X 1ZRDA 2ZAHA 1N1TA 2JDPA 3N9MA 4BLJA 1CAWB 4UW4A 4G6MA 1KEXA 3MUY1 4GAIA 4GALA 3HT2A 5D21A 1H2MA 3OBZA 1GZWB 5FYUA 2PXJA 1RUC3 2A71A 1WUVA 1PZ8A 4MUVA 1BMV2 1AYM3 2VC9A 5A32B 2X5IA 3CRGA 1STMA 3LEKA 1POQA 1UXXX 1JZ7A 2K2SA 4PBOA 1D2QA 4R6UB 2C24A 2JIGA 2GC3A 4CJMA 5KC5A 3U4XA 1SFNA 2HWB1 4Y1ZA 4CCNA 5A6ZA 3Q8BA 1XSQA 3P3NA 2WZEA 4Q4V2 3GBGA 4CDWC 3DKWA 1N1YA 3INAA 4S2DA 3O4DA 2PTMA 2VAUA 3B7MA 4BZ4A 3AP4A 2J42A 3T1MA 5J48A 1GICA 2WSVA 4BHPA 4OHZA 4A7KA 1S0JA 1NCQA 3PUSA 1V6NA 2G9GA 2X53S 2JD9A 2AFGA 3ZDVA 1JOJA 1NCRC 2XJSA 4MO3M 2Y6KA 3SISA 5A6YA 3VDBA 5J37A 1H1AA 5E89A 3ZO0B 4FOQA 1CAVA 5K4LA 1ZBA2 3U1XA 3E6CC 2HWF3 1HCDA 4GH4B 4YG6A 2GP3A 1VBB1 1QJY1 2QDRA 1SLCA 2WT2A 2PHTA 3VBRB 4Y22B 2XVGA 2C6SA 3N4MA 1V6JA 2D6LX 2Q4SA 2MHFA 3LEGA 1ACCA 2WNVB 1JTCA 3FGMA 1BHGA 1VIWB 3HALA 3VZLA 3VBHA 1PO22 4YM0A 2WZPP 2XOMA 3CU7A 3NKGA 4QU1A 2VCBA 4ES9A 4MXWB 1V6WA 2GN7A 2QQNA 1EV2A 1WLDA 2VQ0A 3FJAA 1W05A 2W0XA 3DPRA 4LIUA 4P9IA 1R1A2 5F5IA 4J2YA 1FI2A 1ILR1 3LDBA 4KWLA 4FVVA 1H2KA 3FUQA 4KQ7A 1SBDA 1IQDC 3KF3A 3Q8EA 2D3PA 1TNFA 4JRAA 2XQXA 1MS8A 4QQOA 4QXKA 4H3WA 5ACA3 5H9RA 1UZWA 3WF0A 3BIEA 1X9TA 3ES4A 4QWNA 3AYDA 4MZUA 3T1LA 2HEYF 2MIBA 3SEPA 1NKGA 4TTGA 5EIYB 3OUHA 3JQWA 4IE6A 3OEAA 4NRQA 5I0SA 3U37A 3N7LA 1SLAA 1W6PA 4FXGB 1LOFA 1IKPA 2IWTB 3CRHA 4L2NA 1JOBA 1XOYA 1GOHA 2W47A 4Q5OA 3WZ1A 1DQOA 3O1UA 3O4AA 2HW9A 4AFBA 1PM7A 2RDNA 2ZGTA 4K8RB 4PDWA 1F4AA 5LWBA 2A6XA 2JDHA 3ABZA 4MH0E 4ZHNA 1VR3A 1VBC1 1ZBE3 4BISA 5HBAA 5KXCA 3M3EA 4UW5A 1JZ8A 2NTDA 3NJ5A 5KHHA 3BB2A 2UURA 1D4VB 4E2GA 4NAMA 1S0FA
chains in the Genus database with same CATH topology
1PUUB 1IOAA 3H6SE 3H1YA 1D0GA 1HRI2 3WDWA 5FFOC 2DCTA 2QVSB 2VSEA 4OW4A 1RIRA 4AI8A 3S7IA 5E1RA 4AXOA 3H3UA 2K9ZA 2ARXA 4WVMB 3VBFA 4CDXB 1LU1A 3RG0A 4O9GA 3U10A 3LKJA 4ZGRB 1CN1A 3KB5A 1GLHA 2GU9A 2OYZA 5A33B 1EP0A 4IONA 4USPA 3A0NA 3IDEA 3PUBA 1VBD1 4Q8LA 2X2SA 1R091 1IQAA 5JDBA 1BBT2 3SHRA 2WSUA 4N43C 3IM7A 1FNYA 1MC9A 1JN2P 1NY72 4DCKC 1FMD2 1PGSA 2DTYA 1AX1A 1EAH3 4A7YA 1JUHA 2P17A 3R4DB 4LTAA 4XF3A 1OFNA 2LIEA 5BNPA 4BIOA 1NLRA 3WCSA 1XHBA 1KS4A 1PIV1 2OA2A 1YJKA 3MIBA 1DLLA 3WXPA 2XLGA 3IPVB 4P6AA 3T2TA 3WINA 1WW4A 5DUYA 4NVPA 4JPZA 3USUA 2IXIA 5DG1A 1LR5A 1MACA 3VN4A 2VW2A 4QHBA 4CP1A 3E5UA 5L7OC 4EWAA 2UUSA 4FPGA 4PLMA 3ST7A 2BVVA 4CDWB 4LO7A 4JAWA 1Q5OA 4XFCA 4IESA 4GKYA 3OJMA 1TMF2 2C1FA