1UPSA

Glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
404
structure length
402
Chain Sequence
AKDFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKESLNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA-GALACTOSIDASE
publication title Three-dimensional structure of GlcNAcalpha1-4Gal releasing endo-beta-galactosidase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Glycosyl hydrolase
total genus 111
structure length 402
sequence length 404
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1upsA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1upsA02
1LHOA 3RMXA 1FAYA 2A6XA 4Y20A 4AGVA 4RL7A 1MS5A 3UL2A 4M3CB 1QQLA 5B2HA 1JLXA 3AH4A 5KXCA 2R0HA 2WKKA 4LBQB 1LJ7A 4XKIA 1LOCA 4K1ZA 3ZXLA 4YOLA 1HCEA 4Q8LA 2WQZC 5H9SA 3E8LC 2HYKA 3VEQA 1UX6A 3VSFA 3HSMA 2RHPA 4AWDA 1TP0A 2F2FC 4I4OA 1ULDA 5BXSA 4GOYA 1L2HA 5EG6C 2EALA 2GN3A 4OZXA 3N3HA 2ZGMA 1V6KA 3RRDA 4UW4A 3AZVA 2BEBA 5GLUA 3WNXA 5E8AA 3VKFC 4I4QA 1GZWA 1W3FA 5JOXA 2R16A 2DWRA 5L73A 5H9RA 1FMZA 1XYFA 2VXRA 4Y1VA 1V6UA 1PZ8A 1SR4A 2FFVA 1YRZA 2DUPA 2OVUA 1S0DA 4GXLA 5CB7A 3PVEA 1S0CA 3V0AA 2ZQNA 1MVQA 3AJ6A 1J1TA 1RZOB 4FPYA 1F9KA 3BTAA 1WBFA 5DUYA 4EFPA 5IK5A 3LSEA 1S0LA 4Y1XA 1V6OA 4DS0A 31BIA 1AJOA 3VT1A 4YM2A 1ONAA 3BA4A 5DUVA 4I96A 3ZXDA 3AH2A 4LO3A 1AVAC 2Z49A 3HOMA 1SLBA 2GNBA 1GGPB 4I4XA 3O0WA 2LTNA 2K4AB 2EXHA 4L4HA 4Y22B 3FJKA 1LHWA 3ZX7A 2I2SA 1CPNA 3OYWB 2A6ZA 2D6KA 4FPCA 4P9YA 4J2XA 3WDVA 3CAHA 2D7RA 2G4IA 1CONA 4IQPA 1K5VA 1QQKA 4W65A 1YTOA 5IK4A 1AVUA 5HPZA 3ZC9A 3O4OA 4LO0A 4I4SA 3WDTA 3WOGA 2VW1A 4YW3A 2BQPA 4GALA 2AR6A 3W9TA 4AVTA 1FV3A 4TLPA 2PHUA 3IM5A 3B9UA 3APBA 1WW7A 3AKHA 1ILR1 2D6MA 3TB0A 4BM8A 2Y9WC 1MS3A 4XJAA 4LO8B 4YW1A 4Q1PA 2WBCA 4L4IA 2DS0A 3AP7A 2CTVA 1N1YA 3ZXGA 3FUOA 2YMZA 4DEPA 3IPVA 3IKWA 5T55A 1DQGA 2GNDA 3TAYA 3B69A 4G6MA 1G8WA 2EXJA 4A7ZA 2GMMA 1W6OB 2WSVA 1VCLA 2AYHA 2NZ9A 4FPFA 5T50A 5BOWA 1DJSB 4C1XA 3V79C 4R9BA 3BAGA 2F2FA 1LULA 2ZGUA 1MZ5A 1MD6A 3BODA 2P39A 1A78A 4AVSA 1JQZA 5DVHA 3P6JA 1FQ9A 3RG0A 4LBMA 1XZZA 1UZYA 5GZFA 2E53A 3CA4A 2P34A 4I7IA 5DZUA 4XMAA 5F9TA 3OJBA 2DUOA 1JT7A 1I3HA 4X3AA 2VW2A 5E89A 1APNA 4HANA 5FRAA 4YZ5A 2JECA 2ZMLA 2D6NA 41BIA 1G9BA 1IKQA 1N4KA 3FJ8A 2A3XA 1RIRA 4U36A 1JUIA 3UD9A 5DXDA 3OJ2A 2HWAA 1FNZA 5F90A 3F62B 4Q8KA 3A07A 3N0KA 2D1ZA 1FATA 3HBWA 4EEEB 3AKGA 1R8OA 4G1RA 3PHZA 4JKQA 3BRDA 4YW5A 4Y24A 1IHKA 3DUIA 5BQUA 3T2TA 1DQ4A 2ARXA 4J23B 1N1TA 3ILRA 2A7AA 3WZ1A 3ZYPA 1CPMA 1AX2A 1QF3A 4Q26A 1TIEA 1AXMA 3UDAA 2D23A 5JMCA 2D6PA 4XJZA 3BOPA 2W52A 3B00A 1HQWA 4ZXKA 4XYXA 3AJYA 2KI4A 1CVNA 1N47A 1MS8A 3WMUA 3CA6A 1Q1UA 2AH2A 1M16A 2GMEA 2DVFA 4KEIA 1OFSA 3A0NA 3Q7YA 1QOTA 2ZGLA 1HIBA 1OQ1A 1R1ZA 3I2XA 1W6QA 4TZDA 4QALA 3WG3A 3CQAA 5IK8A 1MZ6A 2KKIA 3N7JA 2DTYA 1GZ9A 1VAVA 2WT1A 1JLYA 4IY8A 4FQ4A 1QNWA 4I4VA 4G9MA 4IZXA 1BA7A 3MW4A 1T4QA 4XJ8A 1HWOB 3WG4A 3FJHA 1C4RA 1GNZA 3VKOA 1TWMA 2Y9GA 1IT0A 2P3IA 3WA1A 4IYBA 4YW2A 2VY0A 2AENA 3AZXA 4PBPA 1MS1A 2CL2A 4CZSA 2D3RA 1JXNA 1X50A 2ZHKA 1I1EA 1AVBA 3OGFA 3AJZA 4ZFUB 3S8KA 1DZQA 1V6NA 2A5ZA 5JVVA 1HWPB 1SR4C 2WT0A 3ILNA 3FBYA 3V64A 3BRGC 1NXD1 4XBNA 4GOVA 3WUDA 4GAFA 1R8NA 4X39A 3ZSKA 1LEDA 1IS6A 4YM3A 2R0FA 4TYSA 4ZGRB 4FPGA 3ZXFA 1YO8A 4ZKTB 3ZXKA 5DZFA 4YFWA 5EWSA 1GV9A 3PMEA 4XBQA 2VSEA 3AX4A 3MALA 3AP5A 1LU2A 1KNMA 5T54A 4LO3C 3WO2A 2ZGTA 1BFFA 4M3CF 5D63A 4LBLA 2K8RA 3LSDA 2W08A 4FGFA 2D22A 4AN7B 2MIBA 4JRAA 3PVOA 2CYFA 4R6UB 1DQOA 4KEJA 1ITBA 4LO1A 3RS6A 5DUWA 1CIWA 3BAOA 4YM0A 1VLNA 1CR7A 5KXEA 1BLDA 4EB2B 4XILA 1DFQA 4LO0C 1CESA 4FPLA 1KDKA 3ZVXA 5BVPI 3HR9A 3N35A 4CJMA 1BZWA 2TEPA 1ONKB 3AP4A 1HKNA 3N7KA 2Y9XE 4Y26A 4U2AA 3O4AA 4IHZA 4G9NA 4XJUA 3MEPA 3HN1A 4XHBA 2NYYA 1BYHA 2ENRA 1LESA 2LIEA 1URXA 3MPPG 4Y20B 3ILFA 1Q8VA 1OQLB 3WVJA 4P0LA 5AVAA 5F8YA 3ZXJA 3K1XA 2GNMA 4NOTA 2DRYA 2E7TA 5BXTA 2RG9B 2ZMKA 3FJDA 1T9FA 1FYUA 4ZOTA 5HCFA 1PZ7A 2LALA 3USUB 3DGTA 2GDFA 1UAIA 4PF5A 1BQPA 3D6EA 1V00A 2DURA 3JU9A 1S0JA 2P3JA 1JN2P 3T1LA 3EF2A 4JP0A 1MVEA 1LEMA 2RQ9A 1Q8SA 1RG8A 2C5DA 5EC5A 2GALA 4XTMA 1XQNA 2NMNA 4LO7C 2ZA9A 2MC2A 3L2YA 3N7MA 4Y1UA 1G9CA 4XJ9A 5BXPA 4AVVA 2E51A 1LOFA 3OY8A 2A75A 4YG3A 3V0AB 1LOBA 1C1FA 2A6WA 3FLPA 3D5OA 4GP0A 4PC4A 3BA5A 4PCRA 1KITA 1BLAA 5E24E 3C9ZA 4SLIA 1Z4SA 1EVTA 1SLTA 4IY9A 2DVBA 3ZPYA 1FGAA 2A71A 3AJ5A 3AP6A 2WSUA 4C1WA 3CNAA 3KMVA 1ENQA 5BQUC 2L5XA 3I2AA 4Q9PA 1Z0HA 1N3PA 2NTDA 1SBFA 2ZR1B 5CAZA 4H55A 1BFGA 1UL9A 3BRFA 1W3AA 1RINA 2R9KB 1V6MA 4HL0A 5GALA 5SV8A 1AX0A 1HCDA 3QYDA 4Y22A 1Y7BA 1Q04A 5GJ6A 4FP3A 2DRZA 4J2YA 3VV1A 3SITA 1FWVA 4XFTA 2AXMA 1WUVA 4YGBA 4H9WA 9ILBA 2A6VA 3R4SA 1DQ1A 1BASA 2BFHA 4Q27A 4P0KA 4BMEA 1ENRA 2JE9A 1DQ2A 2A3YA 1QGLA 4YZ3A 2RSTA 4FPEA 5FNXA 5GM0A 4WZFA 1W6PB 3WG1A 3F1RA 1SACA 3SH5A 4IZEA 3VSZA 5JLVA 4Y1ZA 1W6NB 1IOBA 1II4A 4FOVA 4YZ2A 2HZ9A 4CRQA 4MYEA 1GNHA 1AXZA 1F5FA 2ZGQA 3SNMA 3IPVB 1NLSA 1ZA4A 4FP2A 3VWCA 2ZHLA 2UWCA 3UJQA 5EYYA 4CTEA 1MS0A 4Z8SB 5T5PA 4ATEA 2ZKNA 3FJJA 1H9WA 3FFZA 3WG2A 1B09A 4DENA 2ERFA 4OW4A 1YIFA 4K20A 1YBIA 3H6QA 3AK0A 4BLJA 1UN1A 1CQ9A 5FZUA 5GAQA 2MLLB 2XOAA 4D8HA 1N1VA 3UJ0A 1LGCA 4QD2C 4ITCA 3WDYA 1W6MB 3R05A 3SLIA 3IMNA 2D3PA 4I4YA 1JBCA 3OBRA 4XE9A 3OJMA 3V0BA 1QDOA 2VUAA 4ASMB 4ENDA 3VT0A 2GZBA 4K21A 1VAMA 8I1BA 2FGFA 3JUUA 3BADA 3WO4A 2R1DA 4XFUA 2YY1A 3A21A 2ZGRA 3NJ5A 1ENSA 2E4MC 1ULFA 3VKMA 4LO1C 3NV1A 4YGCA 1AXYA 4FOYA 3OBTA 1XG6A 1JT3A 4OWJA 3ILAA 3TC2A 5GZDA 2JE7A 1SLCA 2VXTI 1PZZA 5DZGA 1FWUA 1QMJA 4GWNA 3I8TA 3FLTA 2PHRA 4J2SA 3H6SE 4GAIA 1DGLA 2ZABA 1GICA 4OEEA 3MW2A 3R4UA 1G9AA 4XIKA 4X38A 3IM0A 4R9DA 4ZFWB 2EXIA 3AZZA 3WHUA 1ISVA 2AGSA 2QN4A 3T1MA 2P23A 1TOOA 3P6IA 1HDKA 2DVGA 1AZDA 2DU1A 3UK9A 1S0BA 3B9CA 1K5UA 1XHBA 1M2TB 5DUUA 2LIQA 1D2SA 2ARBA 1QU0A 2E6VA 1TFMB 3BAVA 5T5LA 3MW3A 4YG6A 2GO2A 1LHVA 3AZYA 3PJQA 2KM2A 1FV2A 4OEGA 1WBLA 2J3PA 3WDXA 5GLZA 1G7YA 1G9DA 3SISA 3AKFA 1V6IA 3H0OA 2CWSA 2Y9FA 1A8DA 3H6RA 3UJ4A 4WVWA 1JW6A 2PHTA 2IHOA 4M3CE 2FMDA 2P3KA 4USOA 2ZGKA 5BXRA 3WUCA 1QDCA 1Z78A 3U4XA 4XJWA 1MS4A 5EXOA 1KQRA 3LCPA 3ZYRA 4F83A 1O4YA 4LO2C 2VSAA 3OPZA 3D4KA 3FJAA 4AGGA 3B3QE 1JT4A 2DTWA 1IS3A 1IS5A 4P9XA 4M00A 2M49A 1U0AA 1WW4A 4OEFA 2A70A 3QCWA 2W39A 1H30A 2FO1A 4QC4A 2KLLA 1AF9A 1S0EA 4I1EA 1LOFC 3I29B 2D43A 1V6VA 1UZZA 4Y1YA 4I4PA 4X37A 2W68A 4XHXA 1JYIA 2ESUA 4QD2B 3A4UA 2DVDA 2C9AA 2KH2A 1SCSA 5T5OA 1ULGA 4L8QA 1NZKA 1VIWB 2QYIB 4GA9A 1ZM1A 4YZ1A 3PUBA 4A7KA 5FZYA 1WCSA 1PWAA 3V65A 1DFCA 1JHNA 3QR5A 5JDBA 1EV2A 2YZ4A 4I1BA 3ENRA 2CNAA 1AVWB 4ISQA 2ET2A 2E4MA 3NBNA 1CE7B 2FHRA 3RMYA 5GZCA 1V6WA 4IONA 3JRRA 1DHKB 2ZAAA 2Q5TA 1FX5A 2YROA 1HLCA 3ZSJA 1PUUB 2D7FA 1GANA 1LODA 4I0YA 3WO3A 2PHWA 4I30A 1WW6A 3Q9OA 1LHUA 4GKXA 4XMIA 3CRHA 1I1BA 4XBLA 2YV8A 3WDWA 4FOQA 2EIGA 2VW0A 4YLZA 5JOYA 1FMMS 2OW4A 1N3QA 4BQ1A 4KC3A 1DQ6A 1SFYA 1YYNA 3CRIA 4FQZA 2ZGOA 3NBCA 1G86A 3M3QA 1W3GA 1SLIA 4UW3A 4BOWA 1WD4A 3FUQA 1Z2VA 4II0A 1CN1A 1N3OA 1BARA 3O49A 1ULCA 2NM1A 5DSSB 3JUTA 5H9PA 3UD7A 4JAWA 4I3NA 3W59A 1JYCA 4M3CA 2Z48A 3O4CA 2ZHNA 4G6JA 1JOJA 3FJ9A 2NVHA 2A6YA 5GLVA 1ISWA 4J2KA 2FFUA 21BIA 3HALA 4LBQA 5GZEA 3O44A 3KM5A 1TTUA 2AFGA 1GBGA 2NP0A 5GLTA 4UW5A 2ZBJA 3WDUA 1QXMA 2XG3A 2AREA 2XB6C 1LECA 3POSA 4ZFYB 1IILA 5BP5C 3USUA 3RTIB 1IJTA 4Q2FA 1Q8QA 1HWNB 1MR5A 2D20A 2JDZA 5F5QA 4FPHA 2GMPA 3BX1C 1QNYA 1GZWB 2OUHA 3AXDA 5LK5A 4LO2A 1LOEA 3WINA 1OKQA 3WCSA 4FPOB 5IUQA 4P0JA 2JJ6A 4BPZA 3FGMA 4DRRA 4YM1A 4P9WA 4JC1A 3FJBA 4Q1RA 1DQ5A 5G00A 3AYAA 4ZA3B 4GWMA 4RA0A 3OY8B 1JT5A 1N1SA 2DVAA 1DYKA 4XXAA 2SBAA 2V5YA 1GYKA 3A0KA 3ZC8A 2VU9A 2EF6A 2D6LX 1WBAA 1DYPA 2D3SA 1A3KA 5H9QA 1PUMB 3P53A 3BAUA 2AQZA 1DZDA 2UURA 1AX1A 1FNYA 4I4RA 5D61A 2ZGPA 3M1HA 3ZSLA 1V6XA 3CRGA 3S8JA 1SCRA 3FLRA 4YGDA 2D6OX 2I1BA 3N36A 3WHTA 1CJPA 1YI7A 4LBQD 1GZCA 1LGBA 4ATFA 1Q56A 1G9FA 5DG2A 3NBDA 1YXWA 4OWLA 4QBVA 1UPSA 3RQ0A 2H0BA 1VALA 2PHXA 2V73A 3M3CA 5F8SA 1PZ9A 2EAKA 1Q03A 1IOAA 2GNTA 5FNWA 3OYWA 5BYNA 1MACA 6I1BA 1KDMA 4LBKA 4XIOA 4I37A 1DQ0A 3BAQA 4XDQA 3AYDA 3IN9A 2DREA 3O0XA 2D7IA 1J0SA 4YG0A 2D24A 1QKQA 1DIWA 5T5JA 1ISZA 3INAA 2DYCA 1AJKA 1LTEA 2ZACA 3RTJB 1GSLA 3AYCA 2UWBA 2WJSA 4XXPA 1H9PA 2NMOA 3BA7A 1PC8B 1ULEA 4LBNA 2WLQA 2P37A 2ZZJA 1W6PA 4XZPA 3ZSMA 1LOGA 2WNEA 4DPNA 2PHFA 1W6NA 2GN7A 2UU8A 1QOSA 1C1LA 4QKSA 3IAGC 3SH3A 1BKZA 4KEKA 3IM6A 3A22A 3FJEA 2YXSA 2UUSA 1W6OA 4FOWA 1WW5A 3C2UA 4EKXB 2OUJA 1TWEA 3M3EA 2R1BA 2VH9A 3PG0A 5BP5A 4JKXB 2ERMA 5F8WA 3ZXEA 3AYEA 1GKBA 3CA0A 4H04A 5EHAA 4F34A 5KXDA 1BJQA 5EYXA 4Z8BA 4Z9WB 3OJVA 4LO7B 5D62A 3O12A 3V0BB 4YZ4A 1S0IA 1DBNA 3NV3A 1W6MA 1WLWA 4LBJA 1V6LA 1RY7A 4QBCA 1LOAA 1C57A 5T52A 2P2KA 3O5WB 1IS4A 3BAHA 2K43A 1TEIA 1KJLA 1DLLA 3WCRA 3NV4A 3Q7WA 4I4UA 2UWAA 1E0OA 3CA3A 4DCKC 2E7QA 4WV8A 5HCBA 1UKGA 3UD8A 3BIWE 4XOGA 3B01A 4LBOA 3UJOA 3O0VA 1WLDA 2DU0A 3FJCA 4HA2A 2DV9A 5IK7A 3KQRA 1O4ZA 1FN0A 3VKLA 5DUXA 1KJRA 4P6AA 4AGRA 1BXHA 3PVNA 1JTCA 5GLWA 3W58A 4YFZA 3LTQA 5DG1A 1IKPA 1SBEA 5FZZA 4DRVA 1Q8OA 2X2SA 5CBLA 5E88A 2WT2A 4I6IA 4R9CA 4K1YA 1LCLA 1W0PA 1SLLA 1JY0A 4GP3A 1LENA 1GLHA 3POWA 4WBCA 4ISRA 1ABRB 1HQLA 1NUNA 1LU1A 4PQ9A 1AFCA 1SLAA 3BB2A 1W6QB 4FPKA 3GNEA 4EFQA 3AXEA 5CNAA 4ZBVB 3T8SA 2YUGA 2JKBA 4D0TA 4EFRA 3OGGA 3SH4A 4WVVA 4BMBA 2ES3A 2ZHMA 3IM7A 3H6RB 3LLPA 2Z42A 4AYUA 1EPWA 2AUYA 2CY6A 1QOOA 3WMVA 1S0FA 3QLQA 3O4DA 1AXKA 2IWTB 2SLIA 1UMZA 3O5SA 2F8XC 5CA6A 3NV2A 4YW4A 4OUJA 3CU1B 3VUOA 4AN6A 4HR6C 5IT6A 3VT2A 1BFBA 4DFSA 3VKNA 3WINC 5JOZA 3ASIA 2CWMA 4QKRA 1ISXA 4D0ZA 3O3QA 2DUQA 5I1BA 3I4IA 4Q91A 1F31A 4P14A 3AKIA 2D44A 1G82A 2KI6B 1V6JA 4KBBA 1S1AA 1S0GA 3GALA 1KRIA 1SZ6B 5GZGA 2WRYA 1RITA 4FPJA 1LGNA 4XTPA 1P63A 1W0OA 2BEAA 4BLIA 2VLCA 4OWKA 3CA1A 1D0HA 7I1BA 2FDBM 4DQAA 3AP9A 3IIRA 2NN8A 3POYA 3FJFA 1SBDA 4NO4A 1YF8B 5FREA 1EYLA 3M2MA 1ISYA 4HJJA 3CA5A 4FVVA 2ZQOA 2ZGSA 2AAIB 4YGEA 5KXBA 3NWKA 5JOWA 4I8MA 1WBCA 4USPA 4JQ0A 3ATGA 3A23A 4M01A 4Q9GA 4A7YA 4ZLBB 4JCKA 1DZCA 3N7LA 1AVXB 4QO3A 2B7YA 2EXKA 2Q3NB 2ZMNA 4I2SA 2A3WA 1RMLA 1Q8PA 5HCAA 3AFKA 2Q9XA 3O4BA 3FJIA 3POKA 3WV6A 1WLCA 1IRAX 1CVSA 1HKDA 2PELA 2HW9A 2HWMA 3D7WB 3SNVA 2JD4A 3AZWA 4GKYA 1IRPA 4XFSA 4D69A 4PBOA 3M3OA 5DZEA 3RSJA 2X2TA 1WD3A 1MC9A 2R49A 3HMYA 1LHNA 3Q7XA 3AH1A 1BFCA 4JPZA 1HWMB 3WLUA 4R9AA 1MS9A 4UW6A 3NBEA 2ZGNA
chains in the Genus database with same CATH superfamily
1LHOA 3RMXA 1FAYA 2HWE1 2IZWA 3NKTA 2A6XA 4OHWA 1NQDA 4Y20A 3TYJA 4AGVA 4RL7A 1MS5A 3UL2A 3BI3A 4M3CB 4W4ZA 1QQLA 5B2HA 4QPGA 1JLXA 5EJ3A 5IATA 1US3A 5CKQA 4IY8A 3AH4A 5KXCA 2R0HA 2WKKA 3S5QA 3ZN6B 1POQA 5DDJ1 2IVJA 3CJIA 5LWBA 3P1IA 1RUD1 1NA1B 4LBQB 1LJ7A 3LGRA 1WCKA 3DCQA 5HV0A 3VBRA 5FLJA 4XKIA 1LOCA 4ZXEA 4K1ZA 3ZXLA 4YOLA 2W1WA 4RHV1 4EQVA 4Q8LA 1HCEA 2Q4SA 2V09A 2WQZC 3KD4A 2KA3A 5H9SA 2BJSA 1GZTA 3E8LC 2HYKA 3VEQA 2ZEZA 2JB8A 3O7OA 5FZLA 3ABZA 4NIIA 1UX6A 2WNUC 2B46X 4HOOA 2CDPA 3HT2A 3VBUA 3HSMA 2AEZA 4NJ4A 3VSFA 2C4XA 2RHPA 1EUTA 2ZTNA 4ZU5A 3RZJA 4AWDA 2KR2A 3LEGA 4JZRA 2HKXA 4O9EA 2OPKA 1V9U1 5FMOS 2BV4A 1D4VB 1R081 1WLTA 5FZKA 3RI8A 5KWRA 3POBA 4COZA 5JXGA 1NCQB 1ZRFA 2YPDA 4O9GA 1VBD1 4K8FA 1ULDA 3VBHA 4DEQA 3VDBA 4I4OA 5BXSA 4GOYA 3LWCA 1L2HA 5IYYA 4DNYA 5EG6C 3NNLA 2YYOA 4MXWB 2EALA 3NL1A 1KS5A 2JG9B 3C7HA 1IPJA 1H6YA 2Y8KA 3MIDA 2Y26A 1OVPA 4UYBA 2VNRA 2GN3A 2PXJA 4OZXA 4P5HA 5FO7B 4XFCA 3N3HA 2ZGMA 2LM3A 3OBAA 5FYSA 3WW2A 4BCUA 5J3UA 2W1SA 1V6KA 2Y0IA 4UW4A 3AZVA 3RRDA 5EIYB 2BEBA 1RC6A 5GLUA 3WNXA 5E8AA 3VKFC 3ZN4A 1DGWA 4I4QA 1GZWA 4Z92B 1W3FA 2E9QA 4LK6A 4R52A 5B4NA 5JOXA 3IIIA 2R16A 2DWRA 3ON7A 5FK8A 4CDUC 5L73A 5H9RA 1XOYA 1W06A 4H2AA 2RE9A 2W91A 5C33A 4XFGA 4AEKA 1FMZA 2VXRA 4ZPIA 4Y1VA 1VP6A 1XYFA 2VD7A 3MICA 5A7SA 3W20A 1Z7S1 1V6UA 3FC0A 1PZ8A 2K0GA 1ND3A 1SR4A 4QB2A 5JAXA 2FFVA 4Y5TA 2WO2A 1X8EA 5KC5A 3U0ZA 1YRZA 1RYYA 4XF0A 1H8TA 2DUPA 1FOD2 1S0DA 2OVUA 4IGQA 4GXLA 4D94A 4JGYB 4OQ9A 4LT5A 3OEBA 4G9SB 4QT6A 5CB7A 3PVEA 4QWNA 3FHQA 1W39A 3AFGA 3FHAA 4XEZA 1S0CA 3JB8A 3V0AA 3KHCA 2VZUA 1MVQA 3RZLA 2ZQNA 1UNBA 4I3GA 2X05A 3T08A 5FAXA 4TXWA 1HV0A 3ALQA 3BTZA 3AJ6A 2VZQA 1J1TA 2XONA 4DINB 1RZOB 1COV2 1AR71 1NCRC 4FPYA 2XHNA 5D8AC 1F9KA 3BTAA 1C28A 2ZPXA 4LQRA 5F3GA 1WBFA 3KHBA 1MQTC 3AKSA 3VHNA 5DUYA 4JGZA 3HPNA 1QXJA 4EFPA 4GD4A 4ZU7A 5BNPA 5IK5A 4DMIA 5C8CC 3LSEA 1S0LA 2EAAA 3DL3A 4IV3C 4Y1XA 4BIFA 4E27A 2VZVA 1V6OA 4DS0A 4XF4A 4A2UA 3NMBA 1KFXL 31BIA 4CUGA 4FAGA 2WL1A 3KQ4B 1D4M1 3H42B 4HK8A 1AJOA 2R061 1NYWA 5K0UA 2ILMA 4DUVA 5F3CA 4YM2A 2R043 3VT1A 1ONAA 2DF7A 3ACFA 3O1OA 3BA4A 1S4CA 4G4FA 4QQ2A 4RR3B 3UKVA 1XZZA 1REDA 5DUVA 4I96A 3ZXDA 3AH2A 4LO3A 1AVAC 2OT7A 2BU9A 5IVYA 4XQWA 4CDQC 3QBQA 2Z49A 3HOMA 1SLBA 2GNBA 3VBFC 2YDEA 4N7UA 3NJVA 4IW3A 4LK7A 1GGPB 4BDVB 4KG8A 4I4XA 3O0WA 4D8MA 1RUJ1 2LTNA 4E2GA 3DKWA 2K4AB 2IC1A 4PDWA 2EXHA 4IEUA 1AL23 4L4HA 4X8PA 4Y22B 3FWEA 3GBWA 3FJKA 3LOIA 3ZFGA 4XABA 1LHWA 3ZX7A 2I2SA 1GOHA 2V4VA 4QX0A 1CPNA 3OYWB 5C3PA 5CFCC 5CKNA 2A6ZA 5FY0A 5A7PA 2Y6LA 2D6KA 2WS92 4FPCA 2PQQA 4P9YA 5I0SA 5L36A 4J2XA 3WDVA 3CAHA 2BVVA 2D7RA 2G4IA 1CONA 4IQPA 1K5VA 1QQKA 4ZHNA 4W65A 3TN91 4Q0UA 1YTOA 3TBDA 5IK4A 1BVVA 1AVUA 4OCTA 4P9LA 5HPZA 3ZSEA 4I0AA 4YRDA 3ZC9A 3O4OA 3POGA 1PGW1 4QGNA 3KV9A 5FLIA 2FDHA 4JX0A 4LO0A 4HG6B 4GH4A 5A3OA 2BW8A 4D6RA 1POV0 5L19A 1OLMA 4I4SA 4H7MA 4QQHA 4AFBA 4AVAA 1BBT1 1LR5A 3WDTA 3WOGA 3PUQA 2VW1A 4YW3A 3O1MA 5C9AB 1TMF1 2P4EA 1XNCA 2BQPA 4GALA 2F17A 2AR6A 4BK4A 3JXSA 3W9TA 2FCTA 5LRRA 4AVTA 1FV3A 3NNGA 4TLPA 2PHUA 2R6QA 3IM5A 3B9UA 4AHZA 2G1MA 4ASKA 1OPOA 2QQVA 2W5FA 3APBA 1WW7A 4EN9B 2Q30A 1ENXA 3UESA 4CEYC 1ILR1 2D6MA 3TB0A 3AKHA 1VBE2 4EN8B 4PLNA 5IJRA 1R092 2RMU1 4BM8A 4RQPC 3ZFEA 2VXJA 1OQDA 2WA3A 2OS2A 2Y9WC 3LF7A 1MS3A 1XJAA 4XJAA 3IDAA 4K6BA 4JV4A 4JDMA 3NO8A 1REEA 5FPXA 1UCXA 1JU3A 4LO8B 3N9OA 1UYXA 4YW1A 3RJRA 4Q1PA 2WBCA 1W8NA 1HB2A 2DS0A 3AP7A 4L4IA 5AC91 2CTVA 4UFJA 3N4MA 3GBFA 1N1YA 3ZXGA 2ORZA 3FUOA 2YMZA 2RS53 4AK3A 4CUAA 4DUXA 4TTGA 2ZXQA 4DEPA 4AAXA 3IPVA 3IKWA 5T55A 1DQGA 3KT1A 2GNDA 3TAYA 3B69A 4G6MA 5FDBA 5CISA 1G8WA 2EXJA 5HCHA 4A7ZA 2GMMA 1W6OB 3GZAA 2ZCWA 2WSVA 1VCLA 4GWJA 3I7DA 4NHXA 2AYHA 2OKXA 2NZ9A 3T4HB 1ST8A 2A1XA 4S2GA 2ETEA 4RS5C 1UO9A 3WQ7A 4FPFA 4XQDA 1EV11 1ULPA 2Q8DA 5T50A 5BOWA 5FPBA 1DJSB 2WNUB 4C1XA 2LW8A 5BNNC 4MHRA 1O91A 4CUBA 4XF3A 3V79C 3ACGA 1WKYA 4R9BA 3LEKA 1SPPB 3H9AA 2F2FA 3BAGA 3H3UA 5BP5C 1LULA 4N43C 5F5IA 2ZGUA 2P5BA 1MZ5A 1MD6A 3BODA 2P39A 2WQ8A 5IVEA 3NNMA 3AL6A 4FFFA 1LNSA 1A78A 2VMDA 4RGKA 4AVSA 5JUVA 4MGTA 1JQZA 3H8OA 1KXGA 5DVHA 4QHZA 3U37A 3P6JA 3D82A 4F8AA 2B9VA 5A7QA 3PIGA 5FR3A 1FQ9A 3MV11 1CX1A 4IESA 4YVWA 3KV6A 1PO12 3RG0A 1J58A 3LPFA 4LBMA 2O8QA 2YC4A 4ET7A 1COV3 1HB3A 1UZYA 2EICA 2PLV2 4FSJA 3C7GA 3THTA 1VBB3 2E53A 5GZFA 1H2NA 1AL0G 1AR92 2P34A 3I2FA 5F3EA 5C4WA 3CA4A 2RS33 2WQ4A 3VLBB 4I7IA 5DZUA 4XMAA 3WQ0A 1WWYA 5F9TA 3OJBA 5KC6A 2DUOA 1JT7A 1I3HA 2GP5A 5FQ0A 4X3AA 1UYPA 4B4RA 3NJYA 4QPIC 3MLLA 3HQRA 1R64A 2VOWA 1UY2A 3VBOA 1VBA1 3I54A 4C8DA 4CDUB 1JYIA 2HWE2 2VW2A 3PL0A 2GU9A 5A7NA 5E89A 1APNA 1XPWA 4HANA 5FRAA 5FBZA 4RGAA 3B94A 4M4PA 4YZ5A 2VVFA 3KGZA 4KBZA 2XVKA 5JZGC 4NIDA 4GAZA 1ODNA 2JECA 1UF2C 1TNFA 2ZMLA 4CEWB 2D6NA 1K5MB 4CVUA 41BIA 1G9BA 4G3YC 1IKQA 1JOBA 1XSRA 3CEWA 5LA2A 3E97A 1N4KA 4K3UA 3FJ8A 1W8TA 1RUD2 2RS12 3CZJA 4IE4A 4FXGB 2A3XA 1RIRA 4U36A 2R30A 2B4KA 1O3TA 3KLSA 1JUIA 2HEWF 1CVSA 4QDQA 3UD9A 5DXDA 3OJ2A 2HWAA 4RHV2 1K45A 4LIUA 2HBTA 2Z69A 4OYUA 3M3IA 4AF9A 1FNZA 1HRV3 2WINB 5F90A 1JH5A 3TEWA 4EN6B 3NAPB 2XOMA 3SCHA 2J1VA 2GAUA 3U78A 3NVCA 1OKOA 1MQTA 1W8FA 4UBHA 3F62B 5FPZA 2P3YA 4LHKA 4Q8KA 5FYVA 3A07A 2BWAA 4IV3A 2HYXA 1R082 2F4LA 1UMHA 4HONA 5C8CB 4W8JA 5JSOA 3N0KA 2MEV1 5IW0A 2D1ZA 1VBD2 5JMOA 1VJ2A 1FATA 4WM7C 5FTTC 3HBWA 4QU2A 2XJPA 2X5IC 4I02A 2G9FA 5C8WA 4ZY9A 3AKGA 4EEEB 1R8OA 4G1RA 4FFGA 3G7DA 5HXMA 3PHZA 3H7YA 4JKQA 4NIAA 5LA0A 3BRDA 1X36A 1XU2A 4YW5A 2C6SA 4Y24A 3DUIA 4EWAA 1IHKA 5BQUA 3T2TA 4LNVA 4OHZA 1DQ4A 2J1RA 4PLOA 2ARXA 3TOJA 3VBFA 1EPZA 4J23B 3HJRA 1N1TA 3Q8EA 2J22A 5FO9B 4INDA 2BNNA 3MDPA 3KVBA 1F5JA 3PTRB 3ILRA 3V56A 1RJ8A 2PQSA 1ZZ8A 1AR83 1ASJ1 2A7AA 3I3BA 3MV01 4OUEA 4AI8A 5KR7A 2IXKA 3PUSA 1GP6A 4HVOA 3WZ1A 3ZYIB 3ZYPA 1CPMA 1AVWB 2C0ZA 1AX2A 4NVPA 4AFDA 5FUPA 1QF3A 2BVBA 2RM23 1VBE3 4IEOA 4Q26A 5FZ4A 1R093 3S30A 1AXMA 1TIEA 2J42A 5HI0A 1YNAA 1Z7S2 3UDAA 1R1A1 3ZYJB 2JD9A 3M4FA 4PHZA 5ACA1 1OUXA 1Y3TA 5LBCA 5JMCA 2D23A 1YI9A 3OPTA 2D6PA 4E9KA 1L7RA 3BOPA 4PIZA 4XJZA 1HB1A 2W52A 3B00A 1W9FA 1YQ5A 1OFNA 1HQWA 4ZXKA 3I2GA 3AJYA 4XYXA 1CVNA 1N47A 1MS8A 1OA3A 1X9PA 4HPKB 5FZ1A 5K4LA 4AI9A 5FOJB 4CPBD 1CGPA 2XLAA 3CA6A 2VQTA 5L9VA 4X8NA 2AH2A 1Q1UA 5FZ0A 1U5YA 2WC2A 4V1PA 1M16A 5FY4A 2C9KA 1E57A 1XNKA 2DVFA 2GMEA 1WZXA 4XFIA 1L3JA 1OFSA 3A0NA 3ZOIA 5LBFA 4A6OA 5KHJA 1QOTA 2BGOA 2ZGLA 1HIBA 3Q7YA 2XUMA 4UI9L 4GQ7A 1OQ1A 1TVGA 3CJIC 1POV3 1R1ZA 3I2XA 1W6QA 2XR4A 3WNPA 4TZDA 4QALA 3HN3A 3WG3A 3CQAA 4W6YA 5FYIA 5IK8A 1MZ6A 4IETA 2XQRA 3N7JA 3RYPA 1W3XA 1XXNA 1GZ9A 2DTYA 4QQOA 1V70A 2RG4A 2XXZA 4LO5B 4Q0QA 4QX7A 4H14A 1VAVA 4ARYA 5FZHA 5E6HA 1SDDB 1D4M2 2WT1A 1UY0A 3Q8AA 1JLYA 3DPRB 2ZX4A 4YSFA 2WFF1 3MIFA 3VBUC 1QY4A 5FP4A 4CEYB 5F37A 1EAH3 5FXZA 1IQAA 2NQYA 3E5QA 2R071 1QNWA 4FQ4A 4RQPA 1O5LA 4W50A 4AI3A 4I4VA 4MZGB 4G9MA 1W8ZA 4IZXA 1O8PA 4JHTA 4LOTA 4NWWA 3LFMA 1BA7A 1SEFA 2JDYA 3VBHC 3MW4A 3B93A 4XJ8A 4BYYA 1T4QA 3RDIA 1HWOB 1AR61 1UOGA 4QPWA 3WG4A 1RUJ2 3FJHA 1C4RA 1GNZA 4BJ0A 3VKOA 1IT0A 1TWMA 2Y9GA 2P3IA 1YJKA 4QXCA 3WA1A 4AVBA 2Q8CA 2D93A 5FXWA 1PO13 1OD5A 3WP3A 5C70A 4IYBA 5F5CA 4YW2A 2G19A 2PLV3 3VD3A 3VBSB 3K46A 2VY0A 5FZDA 2AENA 1AR93 2OA2A 2JX9A 2WIIB 3AZXA 1H2LA 1OURA 2HWF1 2UYBA 4PBPA 1A6CA 2HWC1 1MS1A 3W21A 2CL2A 1FMD1 2D3RA 1UYZA 1JXNA 2X10A 4CZSA 1X50A 3K4AA 4CPBA 3TN92 3OGRA 1QQP1 2ZHKA 3MGUA 2WFPA 4HZFA 4D7YA 1AVBA 2GH8A 3J4UH 1I1EA 1OC1A 4QD2C 3OGFA 3AJZA 4ZFUB 1DDLA 3S8KA 2WZR1 4RS5A 1PGW2 1HIXA 2R32A 2EIEA 1O6UA 1OUSA 3NSTA 4Q5OA 4FAHA 4WM8C 1DZQA 1V6NA 3RNSA 2YFZA 5J37A 3RZGA 4Q4X3 4CDXC 2A5ZA 5JSPA 5JVVA 3ZLIA 1HWPB 5BNNB 4P9JA 1BBT2 4IXLA 1SR4C 1ND3C 2WT0A 3ILNA 3FBYA 3V64A 4EYUA 1PGSA 1PO21 4N43B 1QWRA 1TMF2 2VCMA 4BQXA 4EZHA 1RUD3 1D7PM 4KQ7A 2FDJA 4Q4W1 3BRGC 1NXD1 4LA2A 4XBNA 4GOVA 3THDA 3WUDA 4GAFA 1ODMA 1R8NA 3ZYFA 4X39A 3N9QA 4RHV3 3ZSKA 4JKMA 1LEDA 1IS6A 2BTVC 4YM3A 2R0FA 5F3IA 2VZ3A 4TYSA 4A3XA 4KG0A 2J1AA 2VZ1A 4ZGRB 3QH7A 4FPGA 3ZXFA 5CZKA 1VR3A 1YO8A 2BEOA 4ZKTB 2RMU2 2ZOEB 5A3MA 3ZXKA 1FPN3 5DZFA 4AFCA 5C3RA 3P5BA 2BYVE 3THCA 5BNPC 1RUI2 3H1WA 4QD2A 1V9U3 4YFWA 5EWSA 1GV9A 2QTWB 3PHMA 3PMEA 2WAAA 4OI1A 3H3LA 1VBD3 4XBQA 1DZRA 2XLGA 4CEYA 2VSEA 3I3QA 5FZMA 3LD8A 3PTYA 3CBNA 4WVMA 3AX4A 4KH9A 3OG2A 5HPOA 3MALA 5AC92 4FT8A 1ALYA 4LMFA 2YFUA 5F5AA 2IUWA 2QUOA 3AP5A 3OGJA 1LU2A 1KNMA 5T54A 2YGMA 3AM2A 2VTFA 2RDNA 4IEVA 4LO3C 1JZ2A 2WWSA 3WO2A 2ZGTA 4QHOA 3HWJA 5FZ7A 1BFFA 4EJRA 1DF0A 3WR0A 3VD4A 2CHHA 4M3CF 2BP6A 5D63A 4LBLA 3ST7A 4A41A 2LRPA 1UU4A 2W08A 3LSDA 2K8RA 2LUWA 1PK6C 1WCQA 1ZBA1 2D22A 4FGFA 4AN7B 2B9UA 1RUG1 2MIBA 4DZGA 4JRAA 3PVOA 4KU8A 3RZZA 5J1XA 3GZTB 3BX1C 3N9MA 5IVCA 4B4QA 3KT7A 3H7JA 3VGIA 2CYFA 4R6UB 4XAAA 2VQAA 1YLLA 1DQOA 1C8M1 3TNQA 3U1XA 4H75A 3ZFGC 4BK5A 3SCGA 1EV12 4MLOA 1HXS1 4E4DX 3MIBA 4JKKA 4KEJA 1Z7S3 1ITBA 4LO1A 5FP9A 1UKRA 3RS6A 4I0BA 4CCKA 5IFPA 3AKQA 3KV4A 5DUWA 1CIWA 3ZFFB 1ZRDA 3BAOA 4YM0A 4UF0B 5BNOB 3HBZA 1VLNA 4ZZ5A 1BEV1 5CADA 1CAXA 1CR7A 5AVPA 4WM7A 5IHRA 5KXEA 1BLDA 5FUIA 4EB2B 3BB6A 2X5IA 5FZGA 2FDIA 2BFUL 2NPIA 1DFQA 4XILA 4LO0C 4OUSA 1CESA 3DF0A 2Q1ZB 4FPLA 1HQNA 4LLFA 4RFT0 1KDKA 3GCWA 4X6QB 3ZVXA 1IG3A 5ISLA 4NR1A 1SG3A 5AFBA 5BVPI 3ECQA 4D0QA 1HV1A 1AR73 3HR9A 3N35A 4CJMA 2BPA2 5DMYA 3GJBA 3ZR6A 1H2MA 1VBC2 5FJHA 1BZWA 2TEPA 3I2HA 1ONKB 1T6BX 2X09A 4QKNA 3AP4A 5JXIA 3ACIA 1XBFA 4PF1A 3N7KA 1HKNA 1UD1A 2Y38A 3BU7A 4I2OA 1D4M3 1OLME 1VBA2 4UFHA 4CA9A 1RXFA 2GP3A 2R063 4Y26A 1W8WA 3ZKUA 4U2AA 2Y9XE 3O4AA 5FP7A 4IHZA 2JIJA 2J1UA 1HN1A 4XFHA 4GZ9A 4NWVA 3MEPA 4XJUA 4YW7A 3WT3A 3HN1A 4XHBA 1NY71 4BQWA 2BWCA 4Z2AA 2NYYA 5JSRA 3K3NA 1QIQA 2J7MA 3B5LB 4HK9A 1BYHA 2ENRA 2C24A 1F4AA 5LZ6A 2RV9A 1J3PA 2H0VA 1LESA 1ZZCA 2LIEA 1J83A 1URXA 2K9ZA 2VVEA 1STMA 3AMHA 2PHLA 3DYMA 3M70A 2DBIA 4HSJA 5ABJC 3I49A 1RUJ3 3EJKA 1W8UA 1XE0A 3MPPG 4NE9A 1O5UA 4Y20B 5A1FA 3ILFA 1Q8VA 1OQLB 4YPJA 1YC61 3WVJA 2IFRA 4P0LA 5AVAA 5FOBB 2YUEA 4HLTA 4QPGB 1NG0A 1S2EA 2PAMA 4IE5A 4A45A 3MIEA 3ZXJA 5F8YA 4RYDA 3RZKA 3K1XA 4QX1A 2GZWA 2GNMA 4NOTA 3CJIB 3J7LA 3OD4A 2DRYA 1JTZX 2RS11 4ASLA 4B4PA 3JCIA 2E7TA 5BXTA 3TN93 1IQDC 5ERLA 3VBRB 2RG9B 3HAGA 2ZMKA 2MEV2 3UV9A 3FJDA 1T9FA 4ES8A 2VBPA 2ZEYA 1FYUA 2L9LA 3RJ2X 4ZOTA 4JQTA 5HCFA 1PZ7A 2LALA 1NUKA 3H3ZA 4L0PA 5KHHA 4Q4Y3 4RD7A 4W6WA 3VBUB 3ZDSA 3CQOA 4BH9A 2OQ6A 2HH9A 3ZN6A 1BBT3 1UZVA 1PGL1 3HNYM 2IXIA 1PX4A 1NA1A 4MSVA 5FMBA 3DGTA 3USUB 4BXFA 2GDFA 4L2NA 2JXAA 5LEKA 1XYPA 1NE4A 4TSVA 1UAIA 4PF5A 5DAXA 3S57A 2XL7A 3BU0A 5FYTA 1BQPA 3D6EA 5FV3A 1JOPA 1V00A 2DURA 4PT6A 3PNAA 5LBBA 5JXJA 2HWD1 1UX7A 2XKOA 1ASJ2 3JU9A 1S0JA 2P3JA 1JN2P 4YVWC 4IGPA 4LLOA 1QJX1 4D7SA 3T1LA 2WNVB 3EF2A 4JP0A 3NJZA 2WR9A 3MZHA 5C4WC 1MVEA 2QQWA 2P6HA 3GM8A 4BB3A 4LEJA 2G9GA 1R1A2 5BPXA 1L7LA 3CJXA 5ACA2 1H2KA 5DAVA 3K2OA 4LXLA 4XACA 1IGOA 1LEMA 2RQ9A 1Q8SA 2OXBA 3SKVA 3VBOC 4MXWA 1RG8A 2C5DA 3Q8BA 1P8JA 4QMAA 3P3PA 2VZPA 3UGFA 5EC5A 2GALA 4EWDA 4TN7A 1HW5A 3IAPA 4WM8A 4XTMA 1OA4A 4CDXA 1KEXA 1XQNA 2NMNA 2Z5WA 3IDEA 1IPSA 4LO7C 2ZA9A 2MC2A 3L2YA 3U75A 1NLRA 1H6XA 1ND3B 4DXSA 3JBG1 1NE6A 1ZX5A 1K42A 1ZRRA 4IUGA 3I3EA 3N7MA 4UFLA 4DOUA 2JDNA 3CDZB 1YCIA 1H8TB 3SCFA 3BALA 4Y1UA 5CG9A 2DCJA 1G9CA 4FTEA 4QX8A 4XJ9A 5BXPA 4QD2B 2BGCA 5FYMA 1XNBA 4OI2A 4AVVA 5C5UA 2PMWB 2E51A 2IWGB 5D1IA 4K40A 1LOFA 5FY5A 1OD3A 1W9YA 2A75A 3OY8A 4YG3A 5FY1A 3V0AB 1A8MA 4LHLA 4XUQA 1KFUL 1LOBA 1C1FA 1OF3A 2A6WA 4BISA 1EV13 2WFF2 3FLPA 1Y43B 3KZ4C 3D5OA 3SEPA 2YU2A 3GHNA 4GP0A 4PC4A 3BA5A 4RFRB 4PIXA 4RN5A 4PCRA 4FCAA 2R072 1KITA 4PJYA 5F2SA 4QKFA 1BLAA 4QXKA 4JGZB 1T2XA 1LAJA 1JODA 1QHDA 4JGYA 5E24E 2EVXA 1XRUA 4QHBA 2BNOA 3VN4A 3L2HA 3C9ZA 4LIVA 4SLIA 1Z4SA 4BU2A 1EVTA 3VZLA 1SLTA 5A32B 2TUNA 1ULOA 2DCTA 4AOCA 1Q43A 4URTA 1AR62 4IY9A 3Q8FA 2DVBA 5K0UB 3J8F1 3NQHA 5A33A 5DAQA 3ZPYA 5CFDC 1FGAA 1O59A 2A71A 2Z4FA 5FMDA 5CVRA 3AJ5A 5FFOC 1RGSA 3AP6A 2WSUA 4C1WA 4Q0SA 3LE0A 1OXCA 3CNAA 3KMVA 1ENQA 3PVBB 2HWB1 5BQUC 2L5XA 1W05A 1J84A 2WN3A 2WBKA 4UBGA 4HXCA 3I2AA 1C8NA 2HWF2 4Q9PA 1OVSA 3GYDA 1PK6A 1UXXX 1WCUA 1N3PA 1Z0HA 4Q29A 3U10A 2NTDA 2HWC2 2ZAHA 1FMD2 3AMMA 2JENA 1SBFA 2WO3A 4KNCA 2ZR1B 5CAZA 1QQP2 1RUC1 4H55A 2BOJA 1UL9A 1W3VA 1VBA3 4PDWB 1SMVA 4CE8A 4MO3M 1QJU1 4RR3A 4URAA 3BRFA 2IXJA 1W3AA 1RINA 1WA4A 2WZR2 3J7HA 1V6MA 3W5MA 2R9KB 4HL0A 4AVCA 4OUMA 3ZFGB 1I5ZA 3DN7A 5GALA 1HRI1 5JCTA 5SV8A 4W6XA 4GB31 2GC1A 4QB6A 2HEVF 5D2AA 3GDBA 5BNQA 1HB4A 1AX0A 3WNMA 1HCDA 3QYDA 3C7FA 4X6RB 1PO22 1TQ5A 2X29A 2QE3A 3LIGA 5EJZB 3R6SA 2NLRA 1GOGA 4Q4W2 3J9SA 4KWUA 4Y22A 5F32A 1Y7BA 2YC0A 3BGAA 5LA1A 1OMIA 1Q04A 2WYSA 5GJ6A 3EBRA 4COYA 4GH4B 4CXWA 4FP3A 2DRZA 4J2YA 3VV1A 3SITA 1FWVA 4XFTA 5DN2A 4EN7B 2AXMA 1WUVA 3AVSA 4YGBA 4H9WA 4QGLA 1IZ3A 2WO7A 3VD9A 9ILBA 2A6VA 1BLZA 4UT5A 2B42B 3R4SA 4UFIA 1DQ1A 4LKFA 2XBO1 4OULA 3IAQA 4JDOA 1BASA 2BFHA 4CP9B 1GQHA 4Q27A 2FBEA 2MEV3 4P0KA 4BMEA 2J1EA 1ENRA 5G05L 2JE9A 5FIXA 1DQ2A 4QM8A 3RI9A 3DXUA 1UZ0A 2A3YA 2JIGA 1QGLA 1KD7A 2VUCA 4YZ3A 5JR7B 1C3HA 3BVCA 3LDBA 2YB7A 2RSTA 5EQUA 2VGDA 3E6BA 3LKJA 3ZO0B 3GGLA 3H50A 4FPEA 5FNXA 2B5HA 3ES1A 1RUI1 1VB4A 5GM0A 3ZFEB 2FDGA 4WZFA 2VR4A 1W6PB 5DPNA 3UETA 1WMDA 4Y3OA 5FZEA 3WG1A 1OT5A 3ETPA 3F1RA 3VDDC 1ZBE2 1VE0A 1SACA 2IXLA 2QVSB 1QEXA 3SH5A 5ABJA 4IZEA 1ZBA2 4UXAA 4Y1ZA 5JLVA 1W6NB 3VSZA 1MEC1 1RUG2 3GJAA 5I0DA 1IOBA 1B35C 2ADDA 2QJVA 4FOVA 2JG8C 4YZ2A 1II4A 2HZ9A 2EIBA 4CRQA 1ASJ3 4MYEA 5A3NA 5A6YA 4BE3A 1GNHA 1AXZA 1C8M2 3HIFA 5FZBA 2RR12 1F5FA 1PIV1 1HXS2 1NAEA 1PVC1 2ZGQA 3IPVB 4OZOA 3SNMA 1NLSA 3RYRA 1R1A3 1ZA4A 1M4WA 3E1F1 4FP2A 2BBVA 4BQ3A 5ACA3 3LA7A 4LO8A 2Q8EA 1F35A 4OLLA 4XCBA 2ZHLA 2UWCA 2VOVA 5FZOB 3VWCA 4IEPA 3UJQA 5EYYA 4CTEA 1BEV2 1O7FA 3FMGA 1Y4WA 1MS0A 4Z8SB 2XJTA 2V72A 2VMIA 5JIUA 1TNRA 5T5PA 4ATEA 2VNVA 3U14A 2ZKNA 1NQJA 4YWAA 3FJJA 1H9WA 3FFZA 3P3NA 4FO9A 3WG2A 1B09A 3EXUA 4NAOA 4LUMA 4QGMA 1NT0A 5BY5A 3VD7A 4DENA 2ERFA 5IAXA 4OW4A 2QQUA 3FE5A 1FOD3 1YIFA 3ETQA 4K20A 4S2FA 5APAA 1BFGA 3FL7A 1YBIA 3H6QA 3AK0A 4HN0A 4BLJA 1AYM1 1UN1A 2WZEA 1CQ9A 2O14A 5FZUA 1RUNA 5GAQA 4LOSA 2MLLB 4PQQA 3ZXAC 5EHDA 2XOAA 3MUZ1 4B3NA 2WUHA 5KHIA 1OSGA 2WFF3 1JYNA 4D8HA 3I3MA 3IDCB 1EYBA 1N1VA 1NY72 2BUKA 5T3NA 2R073 3OUJA 3VZMA 5I0TA 1VBC1 3WW3A 5C4WB 3LZZA 3UJ0A 3O1PA 1S55A 1LGCA 1AUYA 1K12A 1PMIA 1TE1B 2F4PA 4ITCA 4IV1A 3WDYA 4B29A 1W6MB 3R05A 3VDDA 5FQ0B 2KXLA 1J3RA 2W9XA 4OMDA 4CCEA 1RUOA 1AR63 3HQXA 2B8MA 3SLIA 3VBOB 4AG4A 2CSGA 4L92A 1SHWB 2ZJCA 4E2QA 2RJKA 2D3PA 3IMNA 4I4YA 2QDRA 3IWZA 1EP0A 5F2WA 3W9AA 3CKHA 2WAOA 2XJUA 1JBCA 1QJEA 3OBRA 4JAAA 4LE4A 4XE9A 1JU4A 4LO7A 3OJMA 2I07B 3V0BA 1QDOA 4AQ6A 3WP5A 2VUAA 2WLPA 3NKGA 1RVF1 1DCSA 4ASMB 1E5IA 4ENDA 4AEMA 2HWC3 3Q8CA 4AW7A 5FZ6A 3EQEA 3VT0A 1FMD3 2GZBA 4K21A 4GMP1 1AYN2 1GU3A 1AL21 1RTVA 1QQP3 1VAMA 1Q3EA 2XJSA 3N9NA 3JUUA 5CEHA 2FQPA 3O1UA 2FGFA 1XU1A 3BADA 3WO4A 2WZR3 2R1DA 3BCWA 4XFUA 3HD8B 5B2GB 2YY1A 3A21A 2JDAA 5L7OC 2ZGRA 3NJ5A 1ENSA 2VMFA 1E5SA 1NCRB 1ULFA 5D8AB 5IAVA 2WS93 3O14A 3VKMA 2E4MC 4LO1C 2RDRA 3NV1A 1MQTB 1PGL2 2QZ3A 1BVP1 1AXYA 4YGCA 1H8VA 3ACHA 4FOYA 3OBTA 2VNGA 1XG6A 4EWEA 1W2NA 1CD3G 1PO23 4IV3B 4MUVA 1JT3A 5I8YA 4OWJA 1DYOA 5FP3A 3SKJE 3ILAA 4MV2A 2VC9A 4Q4W3 1JZ8A 3TC2A 3WXPA 1RUE1 4LULA 5GZDA 4B7EA 1U5ZA 2HBUA 2JE7A 1SLCA 1JZ4A 5CFDA 1PZZA 2VXTI 1HJFA 2N7GA 2HWD2 3NAPA 5DZGA 1FWUA 2PA7A 1UY4A 2ZZQA 3M8LA 1BHGA 5LASA 1QJX2 1QMJA 4SBVA 3BKZA 1QJY2 4GWNA 3I8TA 1GUIA 2OIIA 3FLTA 1TG7A 1OI6A 2QQIA 3GHMA 4CDQB 3ZIWA 3VBFB 2PHRA 3IMMA 4JTNA 4Y4RA 1JZ3A 3H6SE 3H1MA 4GAIA 4J2SA 8I1BA 5A7WA 1DGLA 5D21A 2ZABA 1GICA 2VOKA 4OEEA 3MW2A 4AEDC 2VO5A 4XC9A 1GOFA 2W94A 3R4UA 1G9AA 4XIKA 5TSWA 2XGXA 4X38A 3KF5A 3LA2A 1DP0A 3IM0A 3T4VA 4R9DA 2DFCA 1RHI1 4RSUA 1PMHX 3EO6A 3MO4A 4ZFWB 2EXIA 3IT8A 4AQSA 3AZZA 4EZ4A 5CFCB 1CAWB 4MX3A 3WHUA 3KF3A 1ISVA 2O8OA 3B02A 2AGSA 3E5UA 3T1MA 3ORJA 2QFEA 2P23A 3JBG2 1TOOA 2QN4A 3P6IA 1RUH2 1HDKA 2DVGA 4J25A 1AZDA 5FYCA 3AH1A 2DU1A 3UK9A 1S0BA 1ZRIA 1RUG3 3B9CA 2RDQA 1K5UA 4OFGA 1XHBA 2BFUS 1M2TB 4N53C 2Q1FA 4L99A 1TZOA 1D2QA 5DUUA 2LIQA 1D2SA 2X53S 2ARBA 1C8M3 1QU0A 1DG6A 1HX6A 1XC6A 2E6VA 1TFMB 3BAVA 1JYXA 5T5LA 3MW3A 4YG6A 1CX4A 3ZPOA 1W04A 2GO2A 1LHVA 1UMIA 1DGRA 4OQ8A 4CP1A 3AZYA 3PJQA 2KM2A 1FV2A 1ND2C 4OEGA 1WBLA 2J3PA 3WDXA 2R7EB 2TNFA 4A44A 5GLZA 1O3RA 1BEV3 1G7YA 1G9DA 3SISA 1PX3A 3AKFA 1V6IA 4IEWA 3WX5A 3UNPA 3H0OA 1RUF1 3J8F2 4AQ2A 3GBGA 2CWSA 3CMGA 4XFAA 3THPA 1A8DA 2Y9FA 3LQCA 4RQPB 3LAGA 3H6RA 3UJ4A 4WVWA 2HWB2 2FMYA 1NA1C 1LRHA 3D0SA 1YQCA 5GKAC 4HFSA 3T3YA 5E16A 4IGOA 2VULA 3UKTA 1CAVB 1JW6A 2PHTA 2IHOA 4M3CE 4LKDA 1UXZA 2FMDA 2P3KA 4I09A 1B35A 3PUAA 2BBAA 4QKDA 2JG8A 2ZGKA 4USOA 5BXRA 3DPRA 1RUC2 1SZBA 4Y33A 2W2IA 5A3LA 1XE7A 3WUCA 4OHVA 1QDCA 1QJU2 1UPIA 1Z78A 3AKTA 4CYDA 2DCYA 1VBB1 2VZOA 3U4XA 3CO2A 4XJWA 2J1TA 3F2ZA 2J1SA 3KVAA 4NRQA 5A6ZA 1HRI2 2WN2A 2VQ0A 3ZR5A 1YFWA 1MS4A 4GB32 4XF1A 1O3QA 1V0AA 1H0BA 3HVDA 1NCQC 5EXOA 1F4HA 1KQRA 4RGGA 3LCPA 3ZYRA 2VMHA 1GWMA 2QCSB 1PNGA 4AR2A 2HWE3 4F83A 1O4YA 1XNAA 5FCCA 3SMHA 4LO2C 2VSAA 3VL8A 3O1RA 3RFRA 3OPZA 3AMQA 4RS5B 2JDHA 4DUWA 3D4KA 2QQOA 3FJAA 5JR2A 3I97A 3VBSA 4AGGA 3B3QE 1JT4A 3OCPA 2DTWA 2RJ2A 1IS3A 1IS5A 4WZCA 1OPMA 4M00A 4P9XA 2XWJB 2M49A 1U0AA 1WW4A 3KB5A 4FFHA 4S2HA 3CF6E 2A70A 1ZZ7A 4OEFA 4A42A 2ARAA 2JDMA 3H8UA 1W8OA 2W39A 1H30A 1WMXA 3QCWA 4EROA 2FO1A 1H4HA 3RZHA 4QC4A 4R4XA 2RS13 4EE2A 3I2KA 2B39A 3K48A 2XBO2 2KLLA 1AF9A 1RJ7A 1S0EA 3QH6A 4PLMA 4I1EA 4AHXA 2PFWA 1LOFC 2VECA 2D43A 3I29B 1HRV1 4EN0A 1V6VA 3NRUA 1UZZA 3KCCA 4Y1YA 4I4PA 1JUHA 3WP4A 4LE3A 4X37A 3RPQA 1BMV1 1YQ2A 2W68A 2IFWA 5J98B 4B1MA 4XHXA 3CLPA 1PMJX 4N9IA 1F2NA 1R083 2W47A 4JGYC 3WF4A 4BIOA 3D0JA 3A4UA 2DVDA 2C9AA 2ESUA 4Q0VA 5F7UA 1Y9GA 2KH2A 1XB9A 4QPIB 1SCSA 3AMNA 5T5OA 1ULGA 3MHZA 5FWEA 4L8QA 4IEQA 4LA3A 3VHRA 2VUJA 2Y33A 1MEC2 3ZN5A 5CKMA 1NZKA 4AXOA 2LS6A 5FKCA 3N9LA 2HWD3 4HKOA 1QJFA 4AI1A 5JZGB 4UY4A 4Z1VA 1VIWB 1QJX3 2QNKA 4K7JA 3ZYBA 4GA9A 2QYIB 3NNJA 1ZM1A 1DGWX 2PN5A 2Y0OA 3UYJA 3VZOA 3MFCA 4YZ1A 3CHXA 4L11A 1PIV2 1PVC2 5LY1A 3PUBA 4A7KA 1YUDA 1WCSA 5FZYA 1PWAA 1ZBE1 5AFEA 3V65A 3BPSA 4BA6A 4BZ4A 3ACLA 5DAPA 1NOVA 2CDOA 2PAKA 4O65A 4YVSA 1DFCA 1JHNA 1O4TA 1IPKA 3QR5A 5B4XA 4HVRA 5JDBA 4I01A 4COWA 2VZTA 5EZWA 2YZ4A 5EP9A 1EV2A 4I1BA 1NKGA 3ENRA 4RR3C 5IVJA 2CNAA 1XYNA 3LIHA 5FYHA 2RR11 4KMQA 5L7OA 4ISQA 1Y9MA 2XMLA 1VRH1 1T6GC 1W2TA 3HT1A 4I0WB 5FBJA 5J7MA 2E4MA 2ET2A 3NBNA 1XE8A 3EB7A 1CE7B 1U12A 2FHRA 3RMYA 5GZCA 1V6WA 3SC7X 4GMP0 3JRRA 4IONA 3PU8A 2BRTA 3WD5A 4JHZA 1DHKB 2ZAAA 4LTAA 4CSWA 2Q5TA 2BERA 3N9PA 3CIHA 1FX5A 4MGYE 1CAXB 2YROA 3ZM8A 1HLCA 4WM7B 1DU3D 5FK7A 2UY9A 5FZIA 1SFPA 2XUEA 5LATA 3WF0A 2D7FA 3ZSJA 1AYM2 1PUUB 2X5IB 1GANA 2OPWA 2QKDA 1LODA 3ELNA 4I0YA 1ZVFA 2XH6A 3WO3A 2PHWA 5C71A 2BGPA 4I30A 3FJSA 1WW6A 4LKSA 2BZDA 1X8MA 3Q9OA 4MXVA 1LHUA 4GKXA 4XMIA 4IEZA 1F8VA 3E5XA 3CRHA 4PI0A 1I1BA 3I59A 4XBLA 1OF4A 1WMFA 2YV8A 3LEMA 3AC0A 3WDWA 4AEDA 3JQWA 4FOQA 4FTSA 2PYTA 2EIGA 3LOBA 2VW0A 4E4HA 4YLZA 5JOYA 1FMMS 3POFA 2DCKA 2WZPP 1OOPA 1JZ7A 2PTMA 1REFA 2OW4A 3UKNA 1N3QA 1UW8A 2Y34A 4B7KA 1NXMA 2CU5A 4NN0A 3BN6A 4BQ1A 4KC3A 4KEIA 2HWB3 5IFTA 3PIJA 4MZUA 1DQ6A 1SFYA 1RVF2 1TME1 1YYNA 3VB9A 1CAUA 3CRIA 4DO0A 3E6CC 2OZJA 1UOJA 3WNNA 4FQZA 3I2DA 2X8KA 1DLCA 2ZX3A 3EMRA 2ZGOA 1PNFA 4AL9A 2CGPA 1AL22 4O7XA 1RUC3 5A3WA 4N53A 3MIHA 3NBCA 1G86A 3JZVA 3M3QA 3J7MA 4JKLA 1SLIA 5FXVA 3KS7A 1W3GA 1YIPA 4UW3A 1ZZ6A 1WD4A 4BOWA 3FUQA 1Z2VA 2FZ2A 3QD6A 4II0A 1CN1A 4GB33 1N3OA 2Z79A 4QDSA 1BARA 2ZEXA 2ADEA 3I2JA 3O49A 1ND2A 4Y5Z0 5FZFA 1ULCA 1FXZA 2NM1A 5DSSB 4XUNA 3JUTA 5H9PA 2ATFA 1AYN1 2ET7A 3AMPA 4IEYA 3RWKX 4QXHA 3UD7A 1C5HA 4P9GA 4UWDA 4XZUG 3VD5A 4FI9A 3QOPA 4CCMA 4JAWA 3OGVA 4I3NA 3W59A 2XJRA 4LJHA 1JYCA 1QJZA 4M3CA 2Z48A 3O4CA 2ZHNA 1RUE2 4IE7A 4G6JA 3DKQA 1JOJA 3H8RA 4Q4X1 3FJ9A 4HBNA 2XHKA 5A80A 2NVHA 1J3QA 2A6YA 1W8HA 5GLVA 1CZVA 4BQYA 1ISWA 2BDRA 5FPUA 4J2KA 5KHGA 2FFUA 4YYOA 4CU7A 1G6NA 4XQ4A 21BIA 2D5HA 5CYYA 4CU6A 3HALA 4LBQA 4FBFA 1Q5OA 2TBVA 5GZEA 1I5PA 1TMF3 3PURA 3KM5A 4CCJA 3O44A 2B45X 2AFGA 1GBGA 1TTUA 5KHKA 2NP0A 3VBHB 2XBO3 5GLTA 4LITA 4UW5A 4META 2F6BA 2ZBJA 2MPFA 3WDUA 3WF2A 4UAPA 1QXMA 4LO6B 4D3WA 2XG3A 3K51A 2VUDA 1X7NA 2OX0A 2ZS6B 2AREA 3IZOA 2Z2SB 4P00B 4A3ZA 4HMZA 5FYYA 1QJY1 4MGKE 2XB6C 1LECA 1RHI2 1FPN1 3T2OA 3POSA 2RMU3 4LORA 4GJYA 5F6KA 1IILA 1RXGA 3USUA 3RTIB 1XYOA 1IJTA 4Q2FA 1Q8QA 4CCLA 1VAKA 1NCQA 1MR5A 1RUI3 1SDWA 1HWNB 5C3QA 2D20A 4NHYA 4IV1C 3D3AA 1YFYA 2JDZA 5F5QA 4FPHA 4ZONA 2GMPA 2RDSA 3MIGA 1QNYA 1GZWB 3POJA 3POIA 2VNOA 2EA7A 2OUHA 1UIJA 3AXDA 5LK5A 3BTYA 4P9IA 1OBNA 4GULA 5M0TA 2NS2A 4LO2A 1MEC3 1LOEA 5L9BA 2JG9A 4K9SA 5AC93 1XNTA 3WINA 1GWKA 1OKQA 4UFKA 1ZREA 3WCSA 4FPOB 2WNVA 2QQNA 4WM8B 2RS52 2VVDA 5IUQA 4CDXB 1ZA7A 4P0JA 2JJ6A 2QQKA 3K4ZA 3PU3A 4BPZA 1GFF2 4XDOA 5I0UA 3ZYGA 1PIV3 1PVC3 3CA5A 1SQ4A 2VMEA 4DRRA 4QAWA 3FGMA 1RUH1 3GZUC 3OSDA 1NX9A 3HBKA 5CIRA 4ZS3A 4COVA 3LDKA 4YM1A 1EY2A 4ES9A 4P9WA 1QXRA 4JC1A 1OHFA 5LCWL 3FJBA 2DBNA 1DQ5A 4Q1RA 4E2SA 2VQUA 1W90A 3T2QA 1I9RA 4BWOA 1PM7A 3LA3A 4P02B 4G9NA 5G00A 3AYAA 1OLRA 5FXXA 4S2DA 4ZA3B 4GWMA 4NRMA 4RA0A 4KGQA 1W9TA 3OY8B 3S6PA 1JT5A 1N1SA 2DVAA 1IG0A 5J96B 4CEWC 1RUF2 4ZZ8A 1DYKA 4XXAA 1K5MC 1UU5A 3GXUA 2SBAA 2GH2A 2W1UA 2V5YA 1GYKA 3A0KA 1BK1A 1WGPA 2VU9A 2EF6A 4BQ2A 3ZC8A 4XFFA 3UGHA 2D6LX 4ONUA 5LA9A 3OEAA 4QKBA 1DYPA 3ZMOA 5BNPB 5BUVA 2E7AA 1WBAA 1OH3A 2D3SA 4QDRA 1A3KA 5FZ3A 5H9QA 5K9YA 1PUMB 5I93A 3P53A 4MZFB 1ACCA 3LB9A 2D97A 3BAUA 3HQUA 2AQZA 1DZDA 2UY8A 1AYM3 2UURA 1AX1A 1FNYA 3JD71 3L9JT 4I4RA 5D61A 2ZGPA 4JQRA 4NHKA 2CGNA 1PHMA 1YQ6A 3WNOA 5A33B 3NAPC 3T0BA 3S0MA 1YHFA 1ZYBA 5E1RA 3M1HA 3MLKA 2BOIA 3CZUA 2JKXA 5FZAA 1VBB2 3VZKA 3ZSLA 4Q4V1 1V6XA 1HJGA 5JPNB 3CRGA 1OLQA 3S8JA 2RS32 1SCRA 2XVLA 3ZYHA 3T09A 4FXKB 3TEZA 3FLRA 1VBC3 3KV5A 4ZS2A 4MZHA 1J1LA 2ID4A 2WWJA 2D6OX 3BYWA 4YGDA 3N36A 1PK6B 3WHTA 4YARA 5A32A 2I1BA 3BPZA 3AKRA 3NNFA 2H6CA 1CJPA 2DCZA 4LR4A 1YI7A 4M0NA 2W95A 2ET1A 2JEMA 2VE1A 3C8XA 4GWIA 2ZX0A 1GZCA 4LBQD 1LGBA 4COUA 3KGLA 4ATFA 5A3TA 3TWIA 1Q56A 1LB2A 1G9FA 4Y4YA 3JQXA 1VMJA 1RMU1 3I2OA 3SHRA 5DG2A 3NBDA 3OD0A 3NW4A 1YXWA 4OWLA 1W9SA 4QBVA 4P08A 3GF6A 1YEWA 3RZMA 1UPSA 5HBAA 5IWFA 3RQ0A 2XJQA 1RVF3 2H0BA 4DY3A 2MHFA 1VALA 2E63A 5JWPA 1CZSA 2VL4A 4CCCA 3C7OA 4B1LA 4JDNA 2PHXA 2V73A 2XJVA 3M3CA 5SV5A 4GMP3 1W99A 5F8SA 2YPJA 5L9RA 3MYXA 5A6QA 1PZ9A 2I45A 2EAKA 3WSOA 1IOAA 2GNTA 3AVRA 5FWJA 1HRV2 3OYWA 1Q03A 5FNWA 1US2A 4E8DA 5BYNA 1GQPA 3EYPA 3I2IA 3MUY1 1MACA 1WMEA 3O1SA 3VDAA 1BMV2 1GQGA 6I1BA 1KDMA 4LBKA 3F95A 3HNBM 4XIOA 1JS9A 4QM9A 5FY7A 2ZX2A 4I37A 1DQ0A 3BAQA 4XDQA 3AYDA 1W2OA 4ORFA 3IN9A 2DREA 2OQ7A 3O0XA 3FFQA 3CU7A 2VBDA 2D7IA 1J0SA 4JVAA 1X9TA 1RUE3 4MGIE 2FZ1A 1X82A 4YG0A 4Q4Y1 3T0DA 1UY3A 1MPXA 2D24A 1QKQA 1DIWA 5T5JA 2VAUA 4YW6A 1JMUB 1ISZA 3B9IA 5C9AA 1JZ6A 3INAA 2DYCA 4C0BA 1AJKA 1LTEA 5JI9A 3VHOA 1BCXA 2ZACA 4NPLA 3IDBB 4XW3A 2WWUA 3UT0A 3RVHA 5LRSA 1VRBA 2WYFA 3USSA 4CP9A 5A1LA 1GSLA 3AYCA 4N9HA 3RTJB 5ANQA 3SEEA 5FUNA 2UWBA 2WJSA 5ABJB 3M7AA 4AI0A 1ZZ9A 1AR82 1M06G 3ROUA 5HV4A 3DPRC 4H3WA 4XXPA 5EFUA 1H9PA 2NMOA 1DGRN 2QQJA 3PLQA 2I74A 4DY5A 3BA7A 1PC8B 1ULEA 4LBNA 4Z82A 4D6SA 2RM22 1PVXA 4ZU4A 2WLQA 3VZNA 1RHI3 4NPMA 2P37A 1VRH2 2ZZJA 2IVIB 1ZZBA 2D40A 2WNOA 4HSLA 3OOXA 5FMOL 1W6PA 2A73B 4EV0A 4XZPA 4OHXA 5J48A 1QH7A 3ZSMA 1LOGA 2WNEA 4DPNA 2PHFA 4CXYA 1WA6X 2Y6GA 4D7TA 1W6NA 2GN7A 4GJZA 2UU8A 2C1FA 4DIQA 5FPLA 1S2BA 3WEZA 2VCAA 3OGSA 4IERA 5HXVA 1CZTA 1QOSA 2HEYF 4N7IA 1C1LA 4KWJA 4L9BA 2Y6FA 4QKSA 3LFIA 3VBSC 3SH3A 1BKZA 3IAGC 4KEKA 3IM6A 3ES4A 4ZFYB 5FY9A 3A22A 4Z2WA 4XFBA 3FJEA 4L97A 4XDPA 3FN9A 3WQ1A 2DFBA 2YXSA 2ZX1A 2UUSA 2V5DA 1W6OA 2G9ZA 4FOWA 4HT1T 1RB8G 5I0RA 5FZOA 1VMFA 3KCYA 4TLGA 1WW5A 3C2UA 4XAEA 5FZCA 2E32A 5A3UA 1O3SA 4KL1A 4R8HA 4EKXB 2OUJA 1TWEA 2BNMA 3M3EA 2R1BA 4CDWB 2WNUA 3MFAA 2E33A 2VH9A 3B7MA 4YVWB 3O1TA 3PG0A 1RUF3 3K77A 4C0HA 1EAH2 3HEIA 3I3DA 5BP5A 1SPPA 2WRAA 4JKXB 2ERMA 3E6DA 3OUHA 1GMMA 4MADA 5F8WA 3H1YA 4K8RB 2VM9A 4QX2A 2CAUA 3ZXEA 4QX3A 2E26A 3AYEA 1GKBA 4IV1B 3U11A 4ARXA 3EHKA 1TME2 4AI2A 5A1AA 3VDDB 2XL9A 4NHLA 3CA0A 4QU1A 4TLFA 5C3SA 1WCDJ 2R041 2VTXJ 4QXBA 4H04A 5EHAA 4F34A 1W0NA 5LB6A 4CXXA 3U07A 1BJQA 5KXDA 4PI2A 3K4DA 1H1AA 4KU7A 4NPRA 3DECA 2YG0A 1JYTA 5EYXA 4Z8BA 4Z9WB 1FT9A 2FD8A 1GWLA 3OJVA 4LO7B 3JB4C 5D62A 1S2KA 3O12A 4AZZA 3V0BB 2AEYA 2GC2A 2QQLA 1S0IA 2HWF3 1DBNA 3NV3A 1W6MA 1WLWA 2YBPA 4LBJA 4YZ4A 1KGYA 1V6LA 3IBMA 5F1RA 5J36A 2KD7A 4BXSV 1RY7A 4WBBA 4QBCA 4YVSC 1LOAA 1C57A 4CDUA 2Y6HA 1UZWA 2C26A 3BTXA 1GP4A 3POEA 5T52A 2P2KA 3O5WB 1IS4A 3BAHA 2K43A 4DXRA 1TEIA 1KJLA 2Q0AA 4NRPA 3X29B 1QXPA 1NZIA 1DLLA 4YNIA 3WCRA 4Q4X2 4AAPA 3NV4A 4CEWA 4AQTA 1K5MA 1PM4A 2VBBA 5BXXA 1VMHA 3Q7WA 3AKPA 2JWPA 2UWAA 4LUKA 4I4UA 5EJ1B 1E0OA 4NAMA 3CA3A 5EV7A 1EUUA 3HNMA 3ZMNA 1CWPA 4DCKC 2E7QA 3PMSA 1JHJA 2XWBB 5FMCA 4WVZA 3FHIB 4WV8A 5HCBA 1UKGA 4XUTA 2VTXA 3WQBA 3ME2A 3GZEA 2P6CA 3BIWE 5FZ9A 2Q8OA 3VDCA 1XSQA 4XOGA 3UD8A 3B01A 4QB1A 1D0GA 4LBOA 3UJOA 5CFDB 4CU8A 3O0VA 1WLDA 2DU0A 3S7EA 1NCRA 1W9WA 5D8AA 5C3OA 2KI4A 3FJCA 5FO8B 1OQEA 4HA2A 4NROA 2DV9A 5DAWA 5FZ8A 3R0RA 3TRSB 1FPN2 3D8CA 5IK7A 3KQRA 2AZ5A 3WF3A 5C8CA 3ZFFC 1O4ZA 1V9U2 2ZKLA 2W3JA 1FN0A 3VKLA 4MG2A 5BNOC 3MI8A 5DUXA 4HKWA 1UQXA 3DYPA 5A7WB 1KJRA 3DEMA 1XNDA 4OI4A 4XPVA 2CAVA 4XUOA 3RWNA 4AGRA 5DDJ2 1BXHA 2Y64A 4FTBA 3PVNA 1JTCA 5G04L 3OUIA 5GLWA 1OOPC 4J1WA 3W58A 4O61A 4BQ4A 5FLHA 2YGLA 4IDZA 5ANNA 3TEXA 4CDQA 4YFZA 3LTQA 5DG1A 1IKPA 3WW4A 1YWKA 5A70A 2QZ2A 1SBEA 2VZRA 4OMCA 4AE2A 5FZZA 1RL3A 2D5FA 3T2PA 4DRVA 1Q8OA 4AFAA 5C5TA 1H1IA 5CBLA 1ZBE3 3WF1A 2X2SA 1GR3A 1KS4A 4CUCA 5FYUA 1ZBA3 5E88A 3ZKYA 1ZRCA 2WT2A 4Q0PA 4R9CA 4I6IA 4C90A 4K1YA 3TEYA 3PDQA 4DXTA 4IL7A 1LCLA 1W0PA 1YFUA 4MGZE 1SLLA 1W28A 3BUCA 2RS51 3C3VA 4MGSA 4CDWC 3MLJA 1JY0A 4GP3A 1LENA 5CFCA 1CAWA 1L7QA 1OA2A 2RR13 3BOWA 4IE6A 1GLHA 1VRH3 3POWA 4V2VA 2FDFA 1HXS3 4WBCA 1YQ8A 5FYBA 3SXWA 5LY2A 4ISRA 2W46A 2PAEA 1ABRB 2JICA 1HQLA 1NUNA 2P17A 1LU1A 2W0XA 4PQ9A 1AFCA 2XKPA 2VCBA 1I6XA 1SLAA 3BB2A 5IVFA 1JYWA 1W6QB 4FPKA 1W2UA 4HKLA 2ARCA 4E4ZA 3OTFA 4HPKA 3GNEA 4EFQA 1E5HA 2ORXA 3AXEA 3KCXA 5CNAA 1FI2A 3MF9A 4ZBVB 2YUGA 3T8SA 3JD72 2JKBA 4D0TA 4EFRA 3OGGA 4QPGC 4CP2A 1DZTA 1AHSA 1NLQA 4XCAA 2Y6KA 3SH4A 4WVVA 4BMBA 1AR72 3HOBA 3GCXA 5DABA 2ES3A 3FX3A 2ZHMA 4Q4V2 1FOD1 4UFMA 3H6RB 2Z42A 4AYUA 1GNYA 1EPWA 1YJLA 2AUYA 3IM7A 3LLPA 2CY6A 2EIDA 2OZ6A 3DYOA 1J59A 4AEJA 3VBRC 1QOOA 3T0AA 3J26N 2XPJA 3WMVA 3MBWA 4JRLA 2V4AA 1QH6A 1S0FA 2VMCA 3QLQA 1B35B 3O4DA 2JG8B 1AXKA 1K5JA 2R062 4F3JA 5J09A 2SLIA 2IWTB 1UMZA 1COV1 1H4GA 2VMGA 3O5SA 3R4DB 4HETA 3J7NA 2YU1A 3NV2A 4YW4A 5CA6A 2F8XC 3WNLA 4OUJA 1UIKA 2RS31 3CU1B 1RMU2 4V2WA 2Y60A 3VUOA 4AN6A 4CU9A 1H1MA 4HR6C 4DXZA 5C6CA 4CCDA 1UYYA 3UGGA 1CAVA 5IT6A 3RYKA 3BIEA 1NZCA 3VT2A 2FCVA 5JPMB 1BFBA 1TME3 5EPAA 2PHDA 4IE0A 2K46A 3TNPB 4DFSA 1CJDA 3VKNA 2LROA 4NUBA 4TWTA 2MNGA 3WINC 2JG9C 5JOZA 3SQOA 3ASIA 2CWMA 4J6GA 3LDRA 3DV8A 3OBZA 1ISXA 5F8PA 4QKRA 2WNVC 4M0HA 4XUPA 3WMUA 4D0ZA 1JI6A 5FP8A 3O3QA 2VOTA 2DUQA 1JZ5A 5I1BA 4N90A 1IHMA 3KMHA 5BV6A 5JIAA 3OPWA 2Q1MA 4KI5M 1E5RA 2FDKA 5I91A 3P6BA 3I4IA 4Q91A 3OF1A 4OHYA 3G6JB 1F31A 4P14A 2UYAA 2W1QA 2WABA 3WINE 1AYN3 1MZFA 3DXTA 2D44A 4CCOA 1G82A 3AKIA 2Y6JA 2KI6B 2QBXA 4Z07A 1V6JA 2CV6A 3ZIXA 2GC3A 4PIYA 2RVAA 2JDKA 2OYZA 2JDPA 4KBBA 1S1AA 1UY1A 4Q4Y2 5BNNA 4LHSA 2WS91 1C5IA 1S0GA 3GALA 5KBFA 4UOJA 5LBEA 4XVHA 4NHMA 1KRIA 5LEJA 4N43A 1SZ6B 5GZGA 2WRYA 1RITA 5LK7B 1H8TC 1MZEA 3ITQA 3FZ3A 4FPJA 1LGNA 4XTPA 3K3OA 1P63A 2VG9A 3WP6A 1W0OA 2BEAA 2VOXA 4BLIA 2O0OA 2RJLA 2JE8A 2VLCA 4OWKA 3KSCA 3CA1A 1D0HA 7I1BA 1U5XA 2QDNA 4WVMB 5FKBA 2FDBM 5LW9A 3AL5A 1Y9QA 4DQAA 2QQPA 3VHPA 5FY8A 3AP9A 3IIRA 2NN8A 4QX5A 3POYA 5I8TA 3FJFA 1SBDA 1QJY3 2AC1A 4NO4A 1UU6A 1YF8B 5FREA 1GP5A 2IXCA 2HLEA 4JGZC 4QQLA 2IXHA 3KWVA 5A7OA 1EYLA 3VL9A 1LKNA 4J1XA 5F6LB 1X33A 3M2MA 2VJXA 2W92A 3C7EA 4JTOA 4QPIA 1YFXA 4LO4B 1ISYA 4HJJA 5A6XA 1AR81 4FVVA 5JI7A 2ZQOA 2ZGSA 5DDJ3 3MPBA 4YVSB 4NIHA 2AAIB 4YGEA 3A7QA 5K0UC 5KXBA 3NWKA 4QQPA 5JOWA 4I3PA 4IEXA 2RM21 1VBE1 4CCNA 2CGOA 1R091 5JZGA 1WBCA 4I8MA 1JYVA 4USPA 2WO1A 2XVGA 4MOAA 4XURA 5L7OB 4LKEA 4DB5A 3ATGA 4JQ0A 1K3IA 1VPHA 4D6QA 3A23A 4OVEA 1UWWA 3PUIA 4M01A 3KT4A 2XQXA 4XF9A 2K2SA 4A7YA 2YBSA 1VB2A 4JCKA 4Q9GA 4ZLBB 3W5NA 1DZCA 3JBG3 1CIYA 1RUH3 2JDUA 3N7LA 4DEVA 2HJIA 5K8SA 3NJXA 2XDVA 4HN1A 1AVXB 4MHUA 2WZ8A 1F15A 4P6AA 2DDUA 1O8SA 4PDWC 4QO3A 1ZNPA 2B7YA 1W03A 2EXKA 5JXHA 3H8XA 2Q3NB 1OH4A 2VZSA 4OI0A 4C91A 4FFIA 5I8SA 2AACA 3IIAA 2ZMNA 5FJKA 4AHWA 4F7ZA 4MGQA 4KGGA 3LEIA 4LPLA 4I2SA 2A3WA 2W87A 3IB3A 3U4SA 4AHYA 4B8EA 2QQMA 1POV1 2P1BA 5CG8A 1RMLA 4KWLA 3MF6A 2GC0A 4R4ZA 3OB8A 3ZFFA 4BQ5A 2KKIA 1Q8PA 2YHJA 3FBMA 3S5AA 4NMIA 2WDBA 2XLFA 3I59B 4UF0A 3WY6A 5BNOA 5HCAA 3AFKA 1U5IA 5F39A 4HVQA 5IVVA 2Q9XA 3O4BA 3FJIA 3POKA 4AEDB 4GIQA 1A34A 3PJYA 3S7IA 3LPGA 3WV6A 4MH0E 2R042 4GH4C 4XETA 1WLCA 3WNKA 1IRAX 2YC2A 2O1QA 3JD73 3J8F3 1OOPB 1HKDA 1EAH1 4MVTA 4Y5SA 5IVBA 2PELA 4M4RA 2HW9A 4NIGA 2HWMA 3D7WB 3SNVA 5C9AC 3PUHA 4P5YA 5FYZA 2VCCA 3ZDVA 3O1VA 4A6SA 4Q4V3 1BK0A 1SFNA 2JD4A 2YBKA 3AZWA 4BHPA 4GKYA 3RGBA 2VPVA 1TP0A 1IRPA 1CAUB 2H6BA 4CP0A 4E4SA 4D69A 4XFSA 2FCUA 3K75B 3QACA 5CU1A 5FPAA 3URFA 4PBOA 3M3OA 5DZEA 3RSJA 2JB4A 1W2AX 2GSYA 1PO11 2E31A 1WD3A 4H7LA 4A4AA 2F2FC 2X2TA 4CDWA 1QJU3 1UOFA 4N53B 2PLV1 2D98A 1HN0A 5C7GA 1MC9A 2R49A 1AR91 3HMYA 3T30A 1LHNA 3AB0A 3WW1A 3Q7XA 3CL1A 3VZJA 1HRI3 3ZFEC 4N8MA 1RMU3 4LHNA 5DQ0A 1BFCA 5A3PA 1UOBA 4KWKA 2WA4A 5FPVA 1HWMB 4JPZA 4E8CA 5K7PA 2ZEWA 3WLUA 4R9AA 1MS9A 4UW6A 3NBEA 1ND2B 4QPYA 2ZGNA 4AFMA
chains in the Genus database with same CATH topology
1LHOA 3RMXA 1FAYA 2HWE1 2IZWA 3NKTA 2A6XA 4OHWA 1NQDA 4Y20A 3TYJA 4AGVA 4RL7A 1MS5A 3UL2A 4M3CB 1QQLA 5B2HA 4QPGA 1JLXA 5EJ3A 3AH4A 5KXCA 2R0HA 2WKKA 3ZN6B 3CJIA 1RUD1 1NA1B 4LBQB 1LJ7A 3LGRA 1WCKA 3VBRA 5FLJA 4XKIA 1LOCA 4K1ZA 3ZXLA 4YOLA 4RHV1 1HCEA 4Q8LA 2Q4SA 2V09A 2WQZC 3KD4A 2KA3A 5H9SA 3E8LC 2HYKA 3VEQA 3O7OA 1UX6A 2WNUC 2B46X 3VBUA 3VSFA 3HT2A 3HSMA 2RHPA 2ZTNA 4ZU5A 4AWDA 1TP0A 2HKXA 4O9EA 2OPKA 1V9U1 5FMOS 3RI8A 1D4VB 1R081 1WLTA 5KWRA 2F2FC 4COZA 1NCQB 1ZRFA 4O9GA 1VBD1 4K8FA 1ULDA 3VBHA 4I4OA 5BXSA 4GOYA 3LWCA 1L2HA 4DNYA 5EG6C 2YYOA 4MXWB 2EALA 3NL1A 1KS5A 2JG9B 1IPJA 3MIDA 2Y26A 2VNRA 2GN3A 4OZXA 4P5HA 5FO7B 4XFCA 3N3HA 2ZGMA 2LM3A 4BCUA 3WW2A 5J3UA 1V6KA 2Y0IA 4UW4A 3AZVA 3RRDA 2BEBA