1UPSA

Glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
404
structure length
402
Chain Sequence
AKDFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKESLNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA-GALACTOSIDASE
publication title Three-dimensional structure of GlcNAcalpha1-4Gal releasing endo-beta-galactosidase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Glycosyl hydrolase
total genus 111
structure length 402
sequence length 404
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1upsA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1upsA02
4XJWA 3C9ZA 1LOFC 2A3YA 2LIQA 3OJBA 3PJQA 1CPMA 3UJ0A 4FVVA 1HWOB 3A23A 2GMMA 1JYCA 2JKBA 3N7LA 1CIWA 1JBCA 1M2TB 3BOPA 5JOXA 3SNMA 4FQ4A 1SLTA 3POKA 2DURA 3AP5A 2ZGRA 1JT4A 2M49A 3FLRA 3UD9A 4K1ZA 3T8SA 1G86A 4YZ2A 1AXYA 4KEIA 1MS1A 1VIWB 3PMEA 4ATFA 1GLHA 3CU1B 5JDBA 1AX0A 1ILR1 4HR6C 1WW7A 4LO7C 1RMLA 2PHFA 2OW4A 3B01A 2ZGQA 2GZBA 2H0BA 2D7RA 3OBRA 1PUMB 5DZGA 1V6XA 4FOQA 4AGVA 3OY8A 2KLLA 2D23A 3CA3A 3PVOA 5T5LA 5GZFA 4OEFA 4I37A 1S0CA 2VW0A 4ZA3B 2AGSA 1FWUA 4ZXKA 3BAOA 4QBCA 3ATGA 4I4VA 1UAIA 4AWDA 4GWNA 3V0BA 1XQNA 1CR7A 2HWMA 2ZKNA 1XHBA 5DZUA 1ULDA 2WRYA 1IOAA 2DV9A 1DZDA 3PVEA 3WG4A 4W65A 3E8LC 3EF2A 2NTDA 1DLLA 4OZXA 2PHXA 1AVXB 4UW5A 1ENQA 4Q1RA 4GKYA 4YGDA 1K5UA 2D43A 9ILBA 1ENSA 1V6VA 4FPEA 2UURA 5EYXA 4EFQA 3CNAA 2ENRA 4GKXA 4H9WA 4F34A 1S0DA 2A3XA 3WDWA 4ENDA 4YFZA 3D7WB 2DWRA 2RG9B 1QQLA 4ISRA 3T1LA 1DQ2A 1V6OA 2DVDA 1KITA 2VH9A 3Q9OA 4YG3A 1AVAC 4PF5A 4DRRA 5H9QA 4A7YA 3F1RA 1LHWA 2R9KB 4IQPA 2E7TA 1H9WA 1TP0A 1IJTA 4ITCA 5F8SA 3O0VA 2BEBA 4YM3A 3VKLA 2DYCA 4K21A 1R8OA 1V6IA 4K1YA 2DTYA 4EFPA 4YZ5A 3VSZA 3JU9A 4RL7A 4FPOB 1MS8A 3ILNA 4GWMA 2CL2A 4Z8SB 3H6RA 1A78A 1Y7BA 4P9XA 1QDOA 3CQAA 2QN4A 3WINC 4C1WA 1N47A 2OUHA 3V64A 4LO8B 3KQRA 3UD8A 4KC3A 5DG1A 2I2SA 4GXLA 2WT1A 4YM0A 1VALA 4J2SA 3IN9A 1RINA 3FGMA 5BYNA 1FNYA 1VCLA 3O5SA 3O4DA 3WV6A 2J3PA 1WW4A 2VSAA 2WQZC 1GZ9A 1DBNA 5BP5A 2OVUA 2YROA 4FGFA 1LHOA 4JCKA 3WZ1A 1MZ5A 1UN1A 3SNVA 1AJKA 2A6XA 1N3OA 1W3GA 1BFCA 2RSTA 5CAZA 3M3QA 1BQPA 1PZ8A 3BODA 1AXKA 3ZYPA 5BVPI 1J1TA 3N7JA 3BB2A 4LO1C 5BQUC 2JE7A 5CA6A 1FATA 4XMAA 3MALA 5T5JA 3AZXA 1SBDA 2DUOA 2ES3A 2D6LX 1GNHA 1AVUA 1W6QB 4XTPA 1HQWA 2JDZA 1SCRA 3ZSMA 4YW5A 3WA1A 3GNEA 2GN7A 2UWAA 3O5WB 1W0OA 1IRAX 3N7MA 3MW2A 5FZYA 5IT6A 1NUNA 1BA7A 2GNBA 3WCSA 2R0HA 1MACA 2ZGLA 2P23A 4ISQA 1TIEA 3DUIA 1HWMB 3WO3A 3BRFA 3BIWE 1VAMA 3QYDA 1KQRA 2Q9XA 4XFTA 1MZ6A 4G6MA 4ASMB 4XTMA 2NMNA 3CA6A 1LOFA 5IK4A 2HW9A 2Y9WC 4XHBA 3ILAA 3FJKA 4R9BA 2C9AA 4A7ZA 3VT1A 2ZGKA 3ASIA 3PHZA 4DRVA 1ULCA 1DQ6A 2VY0A 5GLWA 1QU0A 2ZMNA 1SLBA 2A71A 1Q8PA 2VXTI 4X3AA 4DPNA 4M3CE 4JAWA 3AJ5A 4XJ9A 4GAFA 3FJ8A 3POYA 1W6MA 2GN3A 2ET2A 8I1BA 1C4RA 1FQ9A 1N1VA 3ZX7A 4YW3A 4D0ZA 5D63A 1BJQA 1N3QA 3IM5A 2ZHMA 3GALA 4TLPA 2BQPA 3HMYA 1VAVA 1LJ7A 2DUPA 1Q04A 3A22A 3OYWA 4Y20B 1N4KA 3FLPA 4JKXB 1MS4A 1SLCA 3OJMA 2GNTA 1MC9A 2P34A 1MS9A 3UD7A 1OKQA 4AVTA 3LTQA 2EXHA 1LGCA 5GLVA 4QKRA 3W9TA 3BRDA 2NN8A 4XJZA 2P3JA 5JVVA 3O4AA 2R0FA 1L2HA 5H9PA 3U4XA 1RIRA 3USUB 4AGGA 3LCPA 1BLAA 5CBLA 3RRDA 5E24E 1LENA 1DQ5A 4BLIA 2BFHA 3FJIA 2AENA 5DZEA 3I2XA 3AJYA 3MW4A 1W6NA 5H9RA 2D22A 2D3SA 1JT7A 3ZXLA 3AFKA 4AGRA 4I1BA 3WDVA 2IWTB 4ZOTA 4XXAA 2A70A 1IHKA 3VWCA 3ZSLA 2YMZA 1ULFA 1G8WA 2DRYA 2ARXA 3B9CA 1R8NA 1W3FA 31BIA 2GMEA 3SH5A 1K5VA 2LIEA 1SLIA 2CYFA 4XFSA 2NYYA 3IIRA 2D6NA 3ZC9A 4EEEB 1JT3A 3NV3A 2NM1A 3VKNA 3VKMA 4NO4A 3FJFA 4M01A 1IKPA 1SBFA 3B9UA 4TYSA 2GMPA 3WDXA 4FPJA 1JHNA 3M3OA 4YM2A 3WDUA 4OWLA 2PHWA 1YBIA 1DHKB 5BXRA 1MR5A 3VSFA 5EWSA 1CQ9A 4LO2C 4FP2A 3AKHA 1EYLA 1LOCA 3ZSKA 2AYHA 1FMMS 1MS5A 4LBQD 2EIGA 3FJ9A 4XDQA 5D61A 4Y22A 3OPZA 1Z78A 4U36A 3TB0A 1F5FA 3AZVA 4LBMA 1SR4A 1WW5A 4IYBA 4I4QA 2AREA 1RITA 3NJ5A 3WHTA 1W6OA 2K43A 1V6UA 2YY1A 1LODA 1Q8QA 2AUYA 1YYNA 1C57A 3V79C 1UMZA 5BXSA 1WBLA 4XBQA 2JD4A 3ILRA 4YM1A 1SFYA 1AVBA 4USOA 1CJPA 1DQ1A 6I1BA 1GZWA 3NV4A 5GM0A 3AYEA 2ERFA 3IKWA 2D44A 3FJBA 2W39A 5DZFA 4I4SA 1T9FA 1ULEA 2CNAA 3OJVA 3N7KA 1P63A 3P6IA 2VLCA 3HR9A 3N35A 4D69A 1AJOA 2A6YA 3V0AB 3JRRA 1ISWA 2JE9A 3MPPG 2GNDA 4LBKA 2W08A 3ZXJA 2ZAAA 5HCAA 5HCBA 3A0KA 2FFUA 3KMVA 5FZZA 4CZSA 4HA2A 1DZCA 3O3QA 1S0JA 1GANA 3Q7YA 3NV2A 5EYYA 1BFFA 5KXCA 1GICA 3A4UA 4YLZA 1TTUA 5HCFA 3WG1A 4USPA 1W6PB 2YXSA 3UJOA 1LOBA 3BAHA 4WV8A 4Y24A 1RY7A 3WDYA 1LHNA 2VUAA 4I96A 2LTNA 4ZFUB 2FHRA 3BX1C 1BYHA 3RMYA 5E88A 5BXTA 4JP0A 1AXMA 2A6WA 1S1AA 2RHPA 1GKBA 5DUYA 4PBOA 3R05A 1ZM1A 4H55A 4JC1A 2F2FC 2KI6B 4YZ3A 5IK5A 5CNAA 4Q8KA 3WG3A 1W0PA 1Z4SA 2WLQA 1NLSA 4XJ8A 2PELA 3IPVA 2WBCA 4I4OA 1E0OA 1DGLA 2A75A 5DUUA 3WO4A 1LHVA 3QR5A 4YZ4A 5T52A 4QALA 5FREA 3W59A 1ISVA 5G00A 3F62B 3H6SE 1FGAA 1T4QA 5T5PA 4M00A 4BOWA 1UZYA 1LEDA 2Y9GA 1UKGA 1LOAA 3CRHA 1HKDA 1KDKA 2CTVA 1G9CA 5F8WA 1OQLB 3ZXDA 4Y1XA 3AKGA 3CA4A 1DQ4A 2D7FA 2ZGNA 1GBGA 4OEGA 3OY8B 4Z9WB 1EVTA 5D62A 1WUVA 5FRAA 4OEEA 1WW6A 3RTJB 3WLUA 2DUQA 1LU2A 4YG6A 2E4MC 3AP4A 3MEPA 2DRZA 3WNXA 3O0WA 21BIA 1S0LA 3C2UA 4XJUA 3VT0A 2R16A 3V0BB 4Y1UA 1LOEA 1S0EA 3H6QA 3AK0A 1JLYA 3FJAA 1LULA 1PC8B 3AYCA 1ENRA 5B2HA 2E53A 5KXDA 1ULGA 2HWAA 1DYKA 2FMDA 1IS3A 3D4KA 2ZGOA 1J0SA 2UU8A 5SV8A 3MW3A 2A5ZA 4Q9GA 1WBCA 2BEAA 2K4AB 3AXEA 4M3CA 1FWVA 1LU1A 4FOWA 1RZOB 1G82A 3CRGA 3QCWA 1YRZA 3VT2A 3OJ2A 1EPWA 1G9DA 2I1BA 2D7IA 3ZXKA 2TEPA 1D2SA 4AN7B 2WKKA 4XBNA 5GZCA 1HWNB 1N1YA 4ZBVB 2WSUA 4HJJA 4Y1YA 3BA4A 2DTWA 3WUDA 3TC2A 3H0OA 2ZBJA 4LBQA 3AKIA 2C5DA 4X38A 2KH2A 3B3QE 3AZYA 3M3EA 3UL2A 5EHAA 1A3KA 4U2AA 4LO0A 4ATEA 3P6JA 4LO3A 2ZGSA 2EAKA 4P9YA 4IONA 3LLPA 4X39A 3WCRA 1HLCA 3PG0A 4CRQA 1TWEA 4P0JA 1UPSA 4I8MA 1Z2VA 3O49A 3APBA 3W58A 4Q9PA 4DQAA 3WDTA 3O0XA 3H6RB 2AR6A 3JUUA 4G9NA 4XBLA 2E7QA 4FPYA 4GOYA 2D3PA 4ZKTB 4BM8A 4K20A 3OGFA 1JYIA 4OWKA 2UWBA 2ZHLA 4XKIA 1PUUB 4XXPA 3FJHA 3T1MA 4OUJA 2LALA 4KEKA 5IUQA 1DZQA 2JJ6A 1LEMA 1ITBA 2HZ9A 4QC4A 1SBEA 4G1RA 4HANA 5JOZA 1TEIA 3NBNA 4XE9A 3LSDA 1ABRB 4BLJA 3FJDA 4DEPA 4IZXA 1S0IA 4D0TA 1I1EA 4LBQB 1SLAA 4R6UB 4Y1VA 1UZZA 3IM7A 2W52A 2WJSA 3IM6A 2Z49A 4M3CF 2VU9A 3AP6A 1DQ0A 2X2TA 1QDCA 1SLLA 1LGNA 2EALA 1JOJA 2D6PA 1GSLA 1LOGA 5BOWA 4I4PA 2ZHKA 5DSSB 1JT5A 1QMJA 3VKOA 3RTIB 3BAVA 3RG0A 2DU1A 2Q5TA 4FPFA 3AZWA 4MYEA 4I0YA 2ESUA 5FNWA 4DS0A 2D6MA 1IS6A 4L8QA 2D6OX 3N0KA 3T2TA 5IK8A 5EG6C 2FFVA 2F8XC 1GNZA 2ZABA 3UJ4A 3WMVA 3AXDA 2PHRA 4L4HA 5IK7A 5DUVA 1HCEA 3M2MA 1LCLA 1EV2A 2YZ4A 2FO1A 2XOAA 1G9AA 3NBCA 1GGPB 1DQOA 3FBYA 3I29B 4QBVA 2A6ZA 4I4YA 1PWAA 2SLIA 3WVJA 5T54A 3S8JA 1QOSA 4H04A 1ISZA 4Q91A 2ZZJA 3Q7WA 1S0FA 2EXIA 2F2FA 1QQKA 2KM2A 3I8TA 3FLTA 2R49A 5BP5C 1LHUA 2Q3NB 1Z0HA 4FPHA 4R9DA 4J2YA 3CA5A 4DENA 3BTAA 2P39A 3JUTA 1Q8OA 4GOVA 1MS3A 1W6MB 3K1XA 1WD4A 1BARA 4NOTA 1A8DA 2ZACA 1AXZA 4PCRA 4PC4A 1FV3A 4JRAA 2EF6A 1QKQA 3IMNA 2VSEA 2IHOA 1IT0A 2UUSA 41BIA 5DUWA 1YF8B 1QF3A 3AKFA 5GZEA 2FGFA 5BXPA 3OYWB 4Y1ZA 3FJEA 1O4YA 4Y26A 5T50A 2P2KA 1QXMA 1APNA 1IILA 4FQZA 1SZ6B 2X2SA 3VEQA 3NBEA 1B09A 4L4IA 4AVVA 1WLDA 1IS4A 2Z42A 1JUIA 3ZXGA 3ZXFA 4CTEA 1W6NB 3FUOA 1JTCA 4R9AA 2EXJA 4Q26A 1IRPA 1YI7A 5LK5A 4XMIA 5JOWA 3WINA 2E6VA 2DREA 2XG3A 3Q7XA 3ZC8A 2D1ZA 2ZMLA 2WSVA 5T55A 1WBFA 1FAYA 2VXRA 1BXHA 4I4XA 4R9CA 1V6KA 1S0BA 1FN0A 1ISXA 3UJQA 3QLQA 3S8KA 1G7YA 2GALA 1C1LA 4ZFWB 3WUCA 1JQZA 3R4SA 7I1BA 3O4CA 2A7AA 5JLVA 3SISA 4YFWA 2WT2A 1V6MA 1I1BA 4LO1A 5BQUA 2L5XA 1QGLA 3IAGC 5L73A 2P3IA 2ZMKA 1V6LA 1N3PA 1FMZA 3POSA 1QNYA 2DU0A 1N1SA 3D5OA 4Y22B 1BFBA 1TFMB 3O12A 3R4UA 4EB2B 3A21A 1KJLA 2ERMA 2ARBA 1DIWA 3IM0A 2D6KA 4FPKA 1W6OB 4UW4A 4XIOA 2NP0A 4P6AA 4GAIA 4OW4A 1I3HA 3V65A 3L2YA 3SITA 4ZFYB 3FJJA 3UDAA 2WNEA 5DXDA 3HN1A 1PZ9A 4Q27A 2ZGPA 2AH2A 4I30A 4IY8A 4I4RA 1GZWB 1JXNA 5GZGA 1PZ7A 4F83A 2YUGA 3CRIA 4A7KA 2GNMA 1AZDA 3I4IA 5F90A 1LTEA 1W3AA 2YV8A 1KNMA 3SLIA 4G6JA 4AVSA 5E89A 4YGEA 1G9BA 1VLNA 1QOOA 4YG0A 2Z48A 1AX2A 1AVWB 2KKIA 2D3RA 1DJSB 5F5QA 3HALA 4UW3A 4IY9A 4I7IA 1OFSA 2RQ9A 2HYKA 4EFRA 3OBTA 1G9FA 4XIKA 1CVSA 3FUQA 1ISYA 2DVGA 1V6NA 2E51A 1FNZA 1FYUA 1F9KA 1D0HA 5DG2A 4JPZA 4IHZA 4BQ1A 1RG8A 2UWCA 2Y9FA 1HDKA 3WHUA 5F8YA 4FP3A 1H9PA 5KXBA 1II4A 1W6QA 1IOBA 4I4UA 2DVBA 1YTOA 1SR4C 1V6JA 4I2SA 5DUXA 5I1BA 3ZVXA 4LBOA 5CB7A 4AN6A 3IPVB 3HOMA 1IS5A 3A07A 4ZGRB 4TZDA 3AYAA 5KXEA 1ONKB 1DQGA 3BADA 1ONAA 4P9WA 3BRGC 3N3HA 4BMBA 3RQ0A 1Q56A 1TOOA 5JMCA 4XYXA 4P0LA 3BAGA 1GZCA 1HWPB 4SLIA 4P14A 1YO8A 1TWMA 1O4ZA 2A3WA 1IKQA 2WT0A 4QO3A 3NBDA 2ZGUA 1DFCA 1LECA 4QKSA 5DVHA 4FOYA 1CPNA 4I1EA 4II0A 1LGBA 4P0KA 2D24A 3AP9A 5JOYA 1WD3A 2MIBA 4I3NA 1XG6A 1UL9A 1NXD1 2NVHA 1DFQA 3PUBA 5F9TA 4EKXB 2ZQNA 1X50A 4DCKC 3AYDA 1JN2P 2MLLB 1DYPA 3UK9A 5E8AA 5EC5A 4QD2B 4J2XA 1M16A 5FNXA 1PZZA 2QYIB 4XZPA 1CN1A 3AH2A 3HBWA 4YW1A 4WVWA 2W68A 1F31A 1QOTA 2PHTA 4WVVA 4LO2A 1S0GA 1Q8SA 2VW2A 5FZUA 4LBJA 3SH3A 4M3CB 1CE7B 4CJMA 3NV1A 4HL0A 4Y20A 2ZHNA 3RSJA 4YZ1A 4IZEA 2ZA9A 4RA0A 1BZWA 1GYKA 5GALA 3VUOA 4I6IA 3M3CA 4YW2A 1R1ZA 4FOVA 4Q2FA 3BAUA 4UW6A 3HSMA 3BA7A 1V6WA 2ZQOA 3WO2A 3AP7A 2XB6C 3USUA 2FDBM 1BKZA 2A6VA 3POWA 4GA9A 4KEJA 4FPLA 2KI4A 1BLDA 4XOGA 3FFZA 2K8RA 1FV2A 3AJZA 3VV1A 4KBBA 3WG2A 2Y9XE 3WMUA 4Q1PA 1WLWA 3M1HA 4LBLA 3PVNA 3RS6A 2DVAA 3D6EA 1Q03A 3O44A 1WBAA 4AYUA 3ENRA 3KM5A 2AXMA 3AZZA 4JKQA 4OWJA 4PQ9A 1NZKA 3ZSJA 3P53A 3OGGA 3CA1A 3AH4A 4WZFA 4J2KA 4ZLBB 1YIFA 2G4IA 1LESA 4YW4A 4XILA 3O4OA 1BFGA 1Q8VA 4YGCA 3INAA 4XJAA 1JY0A 2D20A 4C1XA 3BAQA 3ILFA 4LBNA 3AJ6A 4QD2C 2AAIB 5EXOA 1UX6A 1OQ1A 2R1DA 4PBPA 3ZXEA 1WLCA 3LSEA 5GLUA 5GZDA 2B7YA 1HQLA 3SH4A 1XZZA 4BMEA 3ZPYA 1MD6A 4YOLA 2GO2A 4XFUA 3AH1A 5AVAA 1KRIA 3CAHA 1JW6A 4G9MA 3DGTA 3CA0A 4X37A 2CY6A 1MS0A 2MC2A 2VW1A 1CONA 2P3KA 3FJCA 2CWSA 3N36A 4GP3A 1MVEA 1HIBA 1AF9A 1QNWA 4YGBA 1JLXA 1AFCA 3TAYA 1CESA 3AX4A 2V73A 3B00A 2NMOA 4WBCA 2ZR1B 4LO0C 1KDMA 2OUJA 1H30A 2CWMA 1URXA 4FPCA 1CVNA 1HKNA 4LO3C 1SCSA 2P37A 4LO7B 1V00A 2ZGMA 1SACA 2V5YA 5GJ6A 2ZGTA 4GP0A 3VKFC 3V0AA 3BA5A 5GAQA 3RMXA 3O4BA 4DFSA 3A0NA 4Z8BA 1XYFA 4XHXA 1AX1A 4BPZA 2AFGA 1KJRA 1C1FA 1ZA4A 2EXKA 2R1BA 2DS0A 3WOGA 2E4MA 3I2AA 2JECA 1U0AA 1FX5A 5GLZA 4FPGA 1BASA 4Q8LA 2SBAA 1N1TA 5H9SA 4JQ0A 2PHUA 1W6PA 1YXWA 3B69A 1MVQA 2DVFA 5T5OA 1Q1UA 3NWKA 1GV9A 1WCSA 4J23B 5GLTA 4GALA 1HCDA 2NZ9A 4D8HA 2GDFA 3ZYRA 5HPZA 2AQZA
chains in the Genus database with same CATH superfamily
2BWAA 2WAOA 2CSGA 4AVCA 2YGLA 1ACCA 1XYPA 4IY8A 1W90A 4XJWA 4CDWC 3C9ZA 4TLGA 1LOFC 4Y5TA 4XFGA 2JIGA 3VBRA 5L36A 4RD7A 2QZ2A 2A3YA 4UBHA 5EZWA 1RUG1 4LKEA 4AI2A 5I0RA 3O1SA 3H8RA 2LIQA 4QM9A 2XR4A 3OJBA 5A7PA 1NQJA 3PJQA 1CPMA 1W04A 5FMOL 4FVVA 3UJ0A 1FPN3 4BDVB 5FZ1A 1HWOB 4YSFA 1AR91 2ADEA 4P9GA 1OVPA 2XLFA 3A23A 2E9QA 2GMMA 3JQWA 1ZBA2 4HK9A 4J1WA 5F3CA 1KFXL 3MLKA 3PU3A 4K40A 3RWKX 1PM7A 1RHI3 1US2A 1TMF2 2ZAHA 4IGPA 4OMCA 3O1PA 1JYCA 2JKBA 3N7LA 3CO2A 4ORFA 3VBUB 2X2TA 1QJU2 4QM8A 1TME2 3GM8A 4XDOA 1CIWA 5FPXA 3WQ1A 1BVVA 2OS2A 1JBCA 1VMJA 3JCIA 3J9SA 1W03A 2VECA 4JGZC 1M2TB 3BOPA 2WINB 5JOXA 3H8OA 3SNMA 3MI8A 4QGNA 5E1RA 4FQ4A 1DCSA 4RQPA 4BQWA 1SLTA 2VE1A 3POKA 4FFIA 2J22A 2DURA 1RYYA 1T2XA 2ZGRA 3AP5A 3CL1A 1JT4A 2MNGA 1ZBA1 1PK6B 1EAH3 2PHLA 3BB6A 4WM7C 2M49A 2VOVA 3OUIA 5LBBA 3FLRA 2W9XA 4RHV2 3UD9A 4K1ZA 1I5PA 3T8SA 2V72A 1G86A 1OD3A 5C3RA 1ZRDA 4YZ2A 1AXYA 1QJU1 4IEWA 4KEIA 1TME1 1MS1A 1VIWB 5FY5A 3RJ2X 3I2IA 3PMEA 1OD5A 2ZOEB 5FY1A 5HCHA 1ULOA 2F17A 5D8AB 3LEGA 3LIHA 4X8PA 3WQBA 1VBE3 3FWEA 4ATFA 3VHRA 4ZONA 2HBTA 1NA1B 1GLHA 1SG3A 3MFCA 2VBPA 3MUY1 4QHOA 1NCRC 4TN7A 1GU3A 3LEIA 2ZJCA 3CU1B 5JDBA 5A3TA 1PGL2 4LUMA 1AX0A 1ILR1 2V4VA 4HR6C 1LNSA 1WW7A 3WNKA 3KV5A 4ES9A 4RHV1 4LO7C 1RMLA 2B4KA 3HQUA 3H3UA 4GB33 3I97A 2WQ8A 2PHFA 2VPVA 1UYYA 2OW4A 4V1PA 5K9YA 3B01A 2E33A 2ZGQA 4UFMA 2GZBA 1HRV2 1MQTB 2BNOA 2H0BA 3VBOB 2D7RA 1NCQB 3OBRA 3W5NA 4M4PA 3ZIWA 1W8WA 3JD73 3LPFA 1PUMB 2BTVC 5DZGA 1OPOA 1V6XA 1ND2B 4GWJA 5JPNB 1YFXA 5DAPA 4N9IA 2RMU2 2YPJA 4EN0A 2I74A 4FOQA 4AGVA 2RVAA 3ZIXA 3OY8A 1PGL1 2BERA 2KLLA 2FBEA 2D23A 3CA3A 4KL1A 4LA3A 3GZEA 3PVOA 3GDBA 2RM21 3LAGA 5T5LA 5GZFA 3GHMA 4OUEA 3GBFA 1FPN2 4OEFA 4BQXA 4I37A 4CDXB 2VOKA 1S0CA 5FZ8A 2VW0A 5IWFA 2AGSA 3LDKA 1FWUA 4ZA3B 1WKYA 4ZXKA 3BAOA 3E1F1 1RC6A 4UXAA 1IQAA 1UU5A 4QBCA 3ATGA 4I4VA 1UAIA 4JAAA 1XNAA 4YW7A 3HT2A 3I59A 4AWDA 3ZN6B 4XCAA 2RMU1 4JV4A 1LB2A 4LO6B 2LUWA 4GWNA 1KS4A 4HPKA 1VBC1 5A6XA 3V0BA 1XQNA 1CR7A 2HWMA 2ZKNA 5CVRA 4Z92B 1XHBA 2VZ1A 5DZUA 5BNNA 1ULDA 4JHZA 3ZYBA 2WRYA 3IDBB 1IOAA 2DV9A 2GC3A 1FI2A 4HLTA 1DZDA 2Y8KA 4NHXA 2EVXA 1W9WA 3PVEA 1BEV3 3WG4A 5KHIA 2O8QA 3FN9A 4W65A 2WFPA 4D0QA 3CJIA 5J96B 3DCQA 3E8LC 3WY6A 3EF2A 2DCKA 1JHJA 3PUQA 3AVRA 2XVGA 4FFFA 5F5IA 2NTDA 2WNUC 4B4RA 5FYUA 1DLLA 3P5BA 4DNYA 3QH7A 4OZXA 1UW8A 3VD4A 4RN5A 2PHXA 3PHMA 3AKRA 1O7FA 4UW5A 1XNTA 3DN7A 1AVXB 4DUVA 1ENQA 5HV0A 3ACGA 2AZ5A 2C26A 2ORXA 4GKYA 4Q1RA 4YGDA 1K5UA 5FZ0A 2D43A 2D40A 9ILBA 4RQPB 1OLRA 3BU7A 1OH4A 2LRPA 4K8FA 3I2KA 4I09A 1ENSA 4QPIB 1W28A 3VHOA 4DUXA 5EJ3A 5A1AA 4DMIA 3PTYA 1V6VA 4FPEA 1OURA 2UURA 2QBXA 5EYXA 4YW6A 1GP4A 4Z82A 2ZX0A 4EFQA 4COZA 1C5HA 1XXNA 2ENRA 1OT5A 3CNAA 4GKXA 4IGOA 3VBUC 2DBNA 1UU4A 2JEMA 4CPBD 4H9WA 4F34A 2B45X 2H6CA 1JU4A 3IBMA 4MOAA 3IT8A 4BQ2A 2YYOA 3HQXA 3J7MA 2X05A 1VRBA 4B3NA 2A3XA 1S0DA 5A1FA 1AHSA 5DAVA 3WDWA 1OI6A 3BN6A 4UY4A 2ZEZA 1UPIA 2GSYA 2J1TA 4KG0A 4ENDA 1OUXA 4YFZA 2IVJA 5B2GB 1HW5A 4BU2A 2R7EB 3D7WB 2DWRA 4B1LA 3I3MA 1ZRCA 1ULPA 3T2PA 2RG9B 2Y6FA 3POEA 1QQLA 2JB4A 4ISRA 4MV2A 2XDVA 3JB4C 3T1LA 1DQ2A 5LBFA 4CXYA 4GH4A 4KU7A 5ISLA 1V6OA 2DVDA 5FBZA 5FZKA 1KITA 2WO2A 2J1EA 3JZVA 2VH9A 3M8LA 3Q9OA 5FO9B 4YG3A 1AVAC 2QQIA 1AYN2 2WUHA 4PF5A 4JTOA 5FDBA 5D8AC 4Q4Y3 4DRRA 4YVWB 5H9QA 2XONA 2W91A 5JUVA 5IAXA 1REFA 4A7YA 3RZLA 3Q8CA 1X82A 1H4HA 3DV8A 4OVEA 1LHWA 2J1UA 2JICA 4QPGA 3RDIA 2R9KB 3F1RA 3NJYA 4IQPA 3RNSA 3IB3A 4BWOA 5FZCA 5CFCA 2WNVB 5FYHA 4GD4A 2F6BA 1U5ZA 4XUTA 4DXTA 2B5HA 2E7TA 5A3PA 1Y4WA 1H9WA 4QPWA 1TP0A 2JG9A 1BEV2 3AKPA 3ZOIA 4IEPA 1IJTA 4ITCA 5F8SA 3O0VA 2B9UA 2ARCA 5C3QA 2ZZQA 4LHSA 1AYN1 1ZZ9A 5FY0A 1ZZBA 1MQTC 2X09A 3VBOC 2BEBA 4YM3A 3VKLA 4QT6A 2DYCA 4K21A 3K4AA 3RPQA 5A7WA 2FDKA 1R8OA 3WQ7A 1V6IA 1ND2C 2Z69A 4QXCA 4URTA 4P08A 2RS12 3NKGA 3H8UA 1T6BX 2VZVA 4K1YA 5I8YA 2JXAA 2DTYA 1EUUA 4AHYA 4KH9A 5A3NA 3ZSEA 4EFPA 4YZ5A 3VSZA 4IE0A 3R0RA 4KMQA 3JU9A 4D7SA 4RL7A 4FPOB 1MS8A 3LIGA 1W8NA 4ZU7A 4CDXC 5IVCA 2VD7A 3ILNA 4GWMA 2CL2A 1ZBE3 3BIEA 3H6RA 4Z8SB 4ARXA 1A78A 1H0BA 1HXS2 2VNGA 1Y7BA 4P9XA 5JZGB 1QDOA 2BNNA 3CQAA 2QN4A 4BA6A 2WL1A 3AKTA 4CU7A 3W5MA 4NPLA 3WINC 2RS11 4YPJA 1DYOA 1U12A 4C1WA 5BUVA 3B5LB 4IEVA 3AKQA 1YQ2A 3TN93 1N47A 1MPXA 2OUHA 4LQRA 3V64A 4LO8B 3KQRA 4CEYA 5LW9A 1QH6A 5DG1A 4KC3A 3UD8A 2I2SA 1UXZA 4FXGB 3VBHB 5HXMA 4GXLA 4N7UA 2WT1A 4YM0A 1VALA 1UKRA 1HXS1 2RV9A 4IGQA 2ID4A 4J2SA 3IN9A 3J8F3 3PUHA 3ES1A 5FXVA 5A32A 1RINA 2BGPA 3FGMA 3SXWA 5BYNA 1FNYA 4A6SA 1VCLA 2JDMA 3O5SA 3WV6A 3O4DA 2WS92 3CF6E 4PT6A 2J3PA 5F3GA 1WW4A 1PGW2 1BK0A 5FZOA 4D6QA 2VSAA 2WQZC 2YU1A 4Q4Y2 3KCXA 1GZ9A 4N43A 1DBNA 5BP5A 4YVSA 2WA4A 2OVUA 4O61A 2VXJA 1TNFA 2YROA 4LITA 3ETPA 4K9SA 4FGFA 2CGOA 4CDWA 4I2OA 4LEJA 2ILMA 3LQCA 4KU8A 1NG0A 1LHOA 1YCIA 2VVFA 4JCKA 3WZ1A 4LJHA 1MZ5A 5A3WA 4JGYA 4QPIC 1UN1A 3E6DA 1ASJ1 3VZLA 2C9KA 4D7TA 3SNVA 1MEC3 1CZSA 4XF1A 1AJKA 2FDFA 2A6XA 1N3OA 3L9JT 4IXLA 4XPVA 5J37A 2QQVA 2WS91 1RUC3 1W3GA 5FMBA 1BFCA 2R043 1PGW1 3W21A 4LMFA 2XL7A 3M3QA 5CAZA 1K45A 4MH0E 4KG8A 2VL4A 3H9AA 1BQPA 1PZ8A 3BODA 3Q8EA 5FPZA 4DO0A 5BV6A 4AI9A 1AXKA 4DXSA 3ZYPA 1CJDA 3FJSA 1J1TA 4AFMA 3N7JA 3BB2A 1GFF2 4LO1C 5BQUC 5BVPI 2JE7A 4BH9A 5CA6A 1O3QA 3ELNA 5EHDA 1FATA 4XMAA 2QKDA 3MALA 3W20A 5T5JA 5CFCB 1VPHA 3AZXA 4UYBA 4LTAA 4AG4A 1SBDA 2DUOA 2ES3A 3U4SA 3ORJA 2O1QA 1CAVA 2D6LX 3MIDA 2JENA 5JPMB 2JX9A 1GNHA 2B9VA 2QVSB 5FZHA 1AVUA 3VBFB 1W6QB 3VLBB 2Y0IA 4XTPA 3VDBA 4BIFA 4E4DX 1HQWA 4CEWA 4IEXA 5FBJA 1NY72 5A70A 4LO4B 4YVWC 2W0XA 2JDZA 4AI3A 1O3RA 1SCRA 2VGDA 4NAMA 4QDQA 4YNIA 3ZSMA 4YW5A 2WYSA 1YQ8A 3WA1A 3GNEA 4XDPA 2GN7A 2VNRA 5C7GA 2UWAA 3FFQA 3MLLA 3EYPA 3O5WB 1W0OA 1RUNA 2PQQA 3T0BA 4CDQA 1IRAX 3J8F2 3N7MA 3MW2A 3VZOA 3TOJA 4AI1A 3I2FA 5FZYA 3PUSA 3RWNA 5IT6A 1NUNA 1BA7A 1NY71 1Y3TA 2GNBA 2H6BA 3MDPA 5FUNA 4R4XA 2RR12 2Q30A 5C9AB 1PO23 2WN3A 3WCSA 2HWD2 2R0HA 1MACA 1O5LA 2ZGLA 4MG2A 2VNOA 5JI9A 2P23A 2ZS6B 4CEYB 5DABA 2YC0A 4ISQA 1TIEA 3DUIA 1HWMB 3WO3A 1XB9A 2PYTA 2XBO1 3VL9A 2QZ3A 1MEC2 5JIAA 3BRFA 3BIWE 1VAMA 5JZGC 4FBFA 1U5IA 2RR11 1KQRA 3QYDA 2Q9XA 2WZR1 2BYVE 1MZ6A 2R042 2HWD1 4G6MA 4P5HA 5TSWA 4ASMB 2VAUA 3PMSA 3ZYGA 4CCCA 4XTMA 2XKPA 2NLRA 2VBDA 2NMNA 3CA6A 1YUDA 1L2HA 4NAOA 4QWNA 3IDEA 2HWC3 1LOFA 3C7FA 5IK4A 3VBHC 5HPZA 4MO3M 2HW9A 3WF2A 4XHBA 2OYZA 1QIQA 1K3IA 1QJY1 3ZDSA 1JYXA 2Y9WC 1XJAA 3FJKA 3ILAA 5JCTA 5FLJA 4R9BA 2C9AA 1O5UA 1XNDA 2XUEA 4ZU5A 3K51A 4Q5OA 4MZHA 4A7ZA 3VT1A 3P3PA 2PN5A 2Y38A 2ZGKA 3ASIA 3GXUA 3KGLA 3PHZA 5L7OB 3WP4A 1JZ6A 1GZTA 2BFUS 5B4NA 4OHYA 4RGAA 4DRVA 2DCTA 5DAQA 1VE0A 4XFHA 1ULCA 1DQ6A 2VY0A 3FHQA 2VC9A 3D3AA 5FP8A 5FYVA 1QU0A 5GLWA 2ZMNA 3ABZA 1SLBA 2A71A 3HJRA 3N9NA 1Q8PA 1FMD1 4XFIA 5IVBA 2JDUA 2VXTI 4X3AA 3KHCA 1JMUB 4DPNA 1RUD2 4M3CE 3QACA 4JAWA 3C7GA 4IW3A 4XJ9A 3AJ5A 4GAFA 3DEMA 5FOBB 3WF4A 4N53C 3OG2A 3SCGA 3FJ8A 1JOBA 1K5JA 2PLV1 1RUE2 2IZWA 3POYA 4I02A 5A80A 1W6MA 2GN3A 3LKJA 3DPRA 2XKOA 3SEPA 5C6CA 4XCBA 1H6XA 4H14A 2ET2A 8I1BA 5I0DA 5JSRA 1C4RA 3BYWA 1R64A 3VDAA 3VD5A 1FQ9A 1N1VA 3KGZA 2E7AA 4QKFA 3ZX7A 2W5FA 4QHZA 4UF0B 4YW3A 4DXRA 4D0ZA 5D63A 3NAPB 1BJQA 4K3UA 4QDSA 4ZHNA 1N3QA 4GMP3 3USSA 1RUD1 1HJFA 1K5MC 3IM5A 2ZHMA 4IDZA 3GALA 4TLPA 1R082 2BQPA 2Y6GA 3HMYA 1VAVA 3WX5A 5FZBA 4CUCA 1O8SA 1RUE1 5FWJA 1LJ7A 1JYNA 3VBFC 2DUPA 1OQEA 1JU3A 1UZ0A 2QE3A 1Q04A 1F35A 3A22A 4E4ZA 4CP2A 3OYWA 3ZN5A 4Y20B 2WWSA 4FO9A 1CAXB 5F8PA 4DUWA 1OPMA 2KD7A 1VBB3 5LK7B 4XQDA 1N4KA 1J84A 5LASA 4LLOA 4CPBA 3FLPA 4JKXB 5FPBA 1MS4A 1XU2A 1FT9A 1OOPA 1SLCA 2GNTA 2HWF3 2HJIA 2CU5A 1ZX5A 4GAZA 3OJMA 1MC9A 3LA3A 2P34A 1VBA2 1MS9A 5FCCA 4C91A 3UD7A 1OKQA 3POFA 1R081 4AVTA 3LTQA 4DEVA 2EXHA 1AR72 1LGCA 5GLVA 2UYBA 4YARA 4QKRA 4QX3A 3W9TA 5AC92 1R092 4A42A 3LGRA 3BRDA 2NN8A 2W47A 4XJZA 1GWLA 2P3JA 5JVVA 4EWDA 4ASKA 3N9PA 3O4AA 1AYM2 1RUJ3 1TZOA 1QWRA 2LROA 1ZZCA 2R0FA 5D1IA 1RIRA 2XJVA 5H9PA 2XGXA 2HKXA 2E31A 3USUB 4AGGA 4AK3A 3LCPA 1ALYA 1BLAA 5CBLA 3RRDA 2QQOA 5E24E 1LENA 1DQ5A 1VBA1 3POJA 4I3PA 3PUAA 1X8MA 5DDJ3 4BLIA 2BFHA 3VDDA 4IUGA 1A34A 3FJIA 3ZFFB 1AR71 5FPVA 2AENA 3UV9A 5DZEA 2P3YA 4OQ8A 3I2XA 3AJYA 3MW4A 1W6NA 5CKQA 5H9RA 2D22A 2D3SA 1CZVA 1R091 2QQWA 3LZZA 5AC91 2WN2A 1XSQA 1JT7A 3ZXLA 3AFKA 4AGRA 4KWJA 3IWZA 1AYM1 5KBFA 4I1BA 5FPAA 3WDVA 3VZKA 2IWTB 4ZOTA 4XXAA 3KCYA 1XOYA 2A70A 1IHKA 3VWCA 3ZSLA 2WZ8A 5JI7A 4R8HA 4WM8B 2YMZA 1DU3D 1AR83 1ULFA 3K4ZA 1G8WA 1MZEA 4PDWB 2DRYA 1H1AA 2BZDA 4KGQA 1Y9QA 3WD5A 2ARXA 2IC1A 2VUCA 3B9CA 5CFDB 2AEYA 5IAVA 1R8NA 5FYMA 1POV3 1W3FA 4LXLA 4B4PA 31BIA 2GMEA 1NXMA 2V09A 2VJXA 3N9LA 3SH5A 2TUNA 4ZZ5A 1K5VA 1SLIA 4NE9A 4XURA 2CGNA 5LBEA 4AHZA 2CYFA 2PXJA 4AI8A 1NQDA 4I0BA 5FK7A 4XFSA 3A7QA 2NYYA 2Y33A 3L2HA 5C4WB 3IIRA 2W3JA 2D6NA 4PI0A 1NUKA 4ZS2A 3ZC9A 2YBSA 1UY4A 4V2WA 1JT3A 4EEEB 3NV3A 5FTTC 1US3A 4M0HA 1Q3EA 4MUVA 5D21A 5BNPB 4IE7A 2NM1A 1BBT2 1VBB2 3VKNA 1VB2A 5KWRA 3MYXA 2X5IC 2CAUA 3VKMA 4NO4A 3FJFA 2JDKA 2XH6A 1DP0A 2WLPA 2Q1MA 5LEJA 2J7MA 4I01A 1IKPA 4G3YC 4M01A 1SBFA 4MVTA 3B9UA 3H1MA 1QQP2 4Y5Z0 1NZCA 4TYSA 2GMPA 2HEVF 3WDXA 2D98A 5FWEA 3U37A 4JKKA 3HBKA 4JKMA 4RSUA 3ME2A 4FPJA 4EROA 1JHNA 5F2WA 2VTXA 4B8EA 1K42A 3RYRA 3M3OA 1GWKA 3FJDA 1SQ4A 3I2GA 4YM2A 3WDUA 4DEPA 1HB2A 1BBT1 4OWLA 1RUI1 2PHWA 1YBIA 1DHKB 2WWUA 3KT4A 5BXRA 1UYZA 4E4SA 1MR5A 3POIA 3VSFA 1UF2C 2VQUA 1CIYA 5EWSA 4BE3A 1QQP1 1NZIA 1CQ9A 2HWB3 4LO2C 3NAPC 4FP2A 4DIQA 4CVUA 3MF6A 3AKSA 3AKHA 1EYLA 1LOCA 2VBBA 1VB4A 2PTMA 5K0UA 3C7HA 4Q4W3 2RDSA 3TEZA 2VMCA 3CJXA 3ZSKA 2VCMA 3NMBA 2AYHA 1FMMS 1MS5A 4UFKA 4LBQD 5FYBA 2EIGA 2FQPA 1ODMA 3FJ9A 4Q4X1 1OXCA 4XDQA 5D61A 4Y22A 3OPZA 1Z78A 4Q4V1 4U36A 3TB0A 1RUF3 4IV1A 5HXVA 1F5FA 1EV13 3AZVA 1BVP1 4LBMA 2J1AA 1VRH1 4UFJA 4C0HA 5ABJB 1WW5A 5I0SA 1SR4A 4IYBA 1VMFA 2QDRA 4IE4A 4IV3A 4RR3B 5I8SA 4I4QA 4L97A 1C8M1 2AREA 4LPLA 3GYDA 3SCFA 4UOJA 3E6CC 1RITA 3NJ5A 1POQA 4Y4RA 3HPNA 3HT1A 1UZWA 3WHTA 1W6OA 3WSOA 2K43A 3N9QA 4UWDA 1RL3A 1PVXA 2IXIA 4MGYE 1V6UA 3KHBA 1A8MA 1KEXA 1O91A 1LODA 2YY1A 1Q8QA 1W8ZA 1HRI3 5JXJA 2AUYA 4QX1A 4JQRA 2QJVA 5E6HA 1YYNA 1C57A 3VZJA 4PLMA 4DOUA 3V79C 4CUAA 4CCOA 1UMZA 1H2LA 2MPFA 1WBLA 4XBQA 5BNOA 5FUPA 2JD4A 2R6QA 5BXSA 1IGOA 2D5HA 3ACFA 3ILRA 4J6GA 4YM1A 1SFYA 3T4HB 1OBNA 1QJX3 4QKDA 5LEKA 4NHMA 1WMXA 3C8XA 1AVBA 4LR4A 1CJPA 1DQ1A 2TBVA 3MIEA 4USOA 6I1BA 1GZWA 1I9RA 1ODNA 1UWWA 3AYEA 3I3EA 3NV4A 5GM0A 3JBG3 1F8VA 2QQUA 4LULA 2ERFA 1H8TA 4E9KA 3AL6A 3IKWA 3S5QA 3BKZA 2D44A 1SPPA 3GCXA 1SZBA 1B35A 2Q8CA 3FJBA 2C1FA 2W39A 5DZFA 4I4SA 3NO8A 1ENXA 1ST8A 2HYXA 1TMF1 4UBGA 4WM8C 1ULEA 3PVBB 1J3QA 2CNAA 2OKXA 3N7KA 1T9FA 4B29A 1PNGA 1NX9A 4PDWC 3WP5A 3OJVA 3ZFEC 4AFCA 1Z7S2 5IATA 5J48A 3S30A 1AL22 1P63A 5CFDC 3NJVA 3GZUC 4AQ6A 2VLCA 3HR9A 3P6IA 3N35A 4D69A 4NHLA 1AJOA 2WQ4A 3ZKUA 1W2TA 2A6YA 3V0AB 3JQXA 4BZ4A 3OEBA 3JRRA 1ISWA 2JE9A 4HVRA 3MPPG 2GNDA 4Q4W2 2JDNA 2W08A 4LBKA 4OUMA 3ZXJA 5C3OA 2ZAAA 2JDHA 5C4WC 1HV1A 5HCAA 1UQXA 4IL7A 4NPRA 5HCBA 4B7KA 5I8TA 3U11A 1F4HA 4GWIA 4EN6B 2IFRA 2BUKA 4OHZA 3A0KA 2FFUA 4MADA 3LEMA 3KMVA 4SBVA 5FZZA 5LA2A 4CZSA 5BNPC 4HA2A 1Z7S1 1DZCA 3FHAA 4NIAA 3O3QA 1AL21 1S0JA 1DF0A 5FJHA 3I2JA 1GANA 1RJ7A 1W8HA 3I3QA 3SEEA 3WNLA 5A3LA 3NV2A 2JDAA 3Q7YA 1XBFA 1QJEA 5EYYA 1BFFA 3PURA 5C33A 5CISA 5KXCA 1A6CA 1GICA 3A4UA 1UU6A 4YLZA 4R52A 5HCFA 5C8CB 1TTUA 4FAHA 1YIPA 2VO5A 3WG1A 4OI0A 3BALA 1WCDJ 1UY3A 4LHNA 2LS6A 4E2GA 4QQ2A 2G1MA 1W6PB 4AEDB 5J3UA 4USPA 1W05A 2YXSA 5BNQA 1ND3A 1AR63 3UJOA 2CDOA 3CZUA 1LOBA 3BAHA 1IPJA 4WV8A 4Y24A 3GJBA 1YJLA 3VL8A 5HBAA 1RY7A 1HRV1 3FC0A 3WDYA 1MZFA 1LHNA 2KR2A 1RHI2 2VUAA 1YI9A 4NHYA 2VZTA 4E8CA 4EV0A 4I96A 2LTNA 2W1WA 4JVAA 2FHRA 3OCPA 4XF0A 4ZFUB 1QJX2 3BX1C 5ANNA 3NQHA 1BYHA 5FO7B 2N7GA 5E88A 3RMYA 3THPA 1FOD3 3BPSA 3E97A 3VBRB 4NN0A 5FOJB 5BXTA 4LK6A 4JP0A 1AXMA 1D4VB 1FPN1 3FMGA 4KI5M 3OBAA 2A6WA 3OUHA 1YQ5A 3OD0A 3BTZA 1EAH2 1S1AA 1GKBA 2RHPA 4IETA 4PBOA 1NLRA 1RHI1 3RZZA 3R05A 4FSJA 5DUYA 1FXZA 1ZM1A 5ABJC 3MLJA 4RFRB 4H55A 1UIKA 4JC1A 4RR3C 2K0GA 2F2FC 1WCKA 2KI6B 1WCQA 4YZ3A 2WNOA 3E5XA 5CNAA 2IXKA 2JD9A 2XJSA 4QQOA 3UKVA 3WG3A 1W0PA 4Q8KA 2HEWF 2R30A 4XFCA 4BISA 1Z4SA 2WLQA 3KCCA 4RGGA 4MXWA 5J1XA 5IVVA 1VBE2 5FUIA 4LA2A 3RYPA 4H75A 1NLSA 4XJ8A 1V9U3 2QQPA 2PELA 3IPVA 2WBCA 2ZPXA 4I4OA 1LKNA 4WBBA 3P1IA 5C3PA 1E0OA 1DGLA 2A75A 1B35B 5DUUA 2X29A 3WO4A 1EAH1 2W95A 2XJTA 1LHVA 5I91A 3QR5A 2HBUA 2XQRA 5ANQA 4LORA 4YZ4A 2JG8A 4LO5B 5T52A 4QALA 4O7XA 5FREA 4GB32 3W59A 1R1A3 4MSVA 4UT5A 3EXUA 1ISVA 5G00A 4HFSA 4AEKA 3RFRA 3HN3A 5CZKA 3F62B 1S4CA 4A44A 1QY4A 2Y6HA 3NNJA 4B7EA 1JYWA 1VBE1 4HT1T 3JD72 2VVDA 3H6SE 1W9FA 4S2GA 5IHRA 4DZGA 1W2NA 2IVIB 1J59A 1FGAA 3PDQA 4D7YA 1T4QA 5T5PA 4M00A 4BOWA 4WVMA 4COVA 1UZYA 1DGWX 1LEDA 1PK6C 3KB5A 4GB31 2Y9GA 3AC0A 1UKGA 3N9OA 4MHUA 3VB9A 3OGVA 1LOAA 4KGGA 4W8JA 4AEMA 5G04L 5AFEA 1C28A 3CRHA 4LHLA 3WP6A 1HKDA 4QX2A 1KDKA 3VBSA 2CTVA 2XLGA 4MXVA 2BOIA 3JD71 4ZS3A 4JRLA 3WINE 1G9CA 5F8WA 4D6RA 1OQLB 3DKQA 5J7MA 3ZXDA 4Y1XA 3RZJA 1RUH3 3AKGA 1W8UA 3B93A 5CIRA 5EPAA 5LZ6A 1M06G 4I3GA 3CA4A 1NA1C 3NNMA 1DQ4A 2D7FA 2ZGNA 1GBGA 4OEGA 3PIGA 1I6XA 4W6YA 5AVPA 3CLPA 1W3VA 3J7HA 3OY8B 4Z9WB 1VBD3 1EVTA 5D62A 1WUVA 5FRAA 3IZOA 3KT7A 1NKGA 4S2FA 4O65A 2IWGB 4EWEA 4OEEA 1WW6A 1QJZA 3WLUA 4CCEA 1RB8G 3RTJB 5FZAA 2DUQA 3HNYM 1LU2A 1J3RA 2VVEA 4YG6A 2E4MC 1YHFA 3AP4A 4GJYA 3MEPA 4CCLA 2XHKA 3WNXA 2DRZA 3O0WA 5JR2A 4CUGA 5J09A 1NCQC 3I49A 1S0LA 21BIA 5LWBA 1CX4A 3C2UA 3I59B 5C8CC 1CAUA 4IESA 4XJUA 2BGOA 5FZFA 2ET7A 3EQEA 5C71A 2VOTA 4HPKB 1RVF3 3VT0A 2R16A 4WVZA 3V0BB 4QD2A 1V9U2 1T6GC 4AEDC 4Y1UA 5FYIA 2BVVA 1YQ6A 1LOEA 1S0EA 2W1UA 3O1RA 2VMGA 5BNNB 3AK0A 3H6QA 1BEV1 1NT0A 5FO8B 2QQNA 5HPOA 1JLYA 3FJAA 1Q5OA 4XVHA 1DZTA 1LULA 2B39A 5C5TA 1PC8B 3AYCA 3CJIB 1ENRA 1R1A2 5B2HA 2E53A 5FPLA 4AXOA 3VHPA 1D2QA 1IPSA 5KXDA 4Z2WA 1ULGA 1OVSA 1DYKA 1W99A 1IS3A 2FMDA 2JB8A 2ZGOA 3D4KA 3O7OA 2HWAA 2UU8A 1J0SA 2VZ3A 3BCWA 5SV8A 3AM2A 1W8TA 2A5ZA 1J1LA 1V9U1 2DFCA 3MW3A 3OPWA 4QMAA 3VBRC 3S5AA 4Q9GA 1WBCA 3OGRA 5JXGA 1OA3A 4QB2A 1TQ5A 2BEAA 3U75A 1PX3A 4EN8B 2F4PA 5FP3A 3T3YA 3AXEA 3ZXAC 1ZYBA 1PO13 4M3CA 2K4AB 1FWVA 1LU1A 1HQNA 2MEV3 1UMIA 3J7NA 4BQ4A 2Y34A 3J26N 4L9BA 4MZUA 4FOWA 4TTGA 1W0NA 1RZOB 3IIIA 5FMOS 3WF3A 1G82A 3CRGA 3QCWA 1YRZA 1S55A 1PVC3 3KMHA 1E5HA 1EPWA 5JSPA 1G9DA 3ES4A 3P3NA 4OUSA 2D7IA 2I1BA 3ZXKA 4D6SA 2TEPA 2XMLA 3LD8A 2EA7A 4ZY9A 4CCKA 1JYTA 2VUJA 3NJZA 1D2SA 1IG3A 4XETA 2CDPA 4AN7B 1UOBA 2E26A 2XVLA 3KT1A 2WKKA 3H1YA 4HN1A 5EIYB 4PJYA 5LATA 2AEZA 4XBNA 5GZCA 1L3JA 2HLEA 2PAMA 5A6YA 1N1YA 1HWNB 3FE5A 2WSUA 4ZBVB 4RQPC 3F2ZA 4PF1A 4HJJA 1VBD2 4Y1YA 2DTWA 2Q4SA 3WUDA 3BA4A 3TC2A 3H0OA 3H7JA 2W92A 2ZBJA 4LBQA 2GAUA 3FL7A 4CP9A 3ZYHA 2C5DA 3AKIA 3G7DA 5FLHA 5K4LA 4RS5A 5FXWA 4X38A 2KH2A 3B3QE 3AZYA 1W8FA 4KWLA 1HN1A 2BWCA 1JZ3A 4GH4B 4V2VA 4OQ9A 3M3EA 1PIV3 4Q4Y1 3UL2A 4AOCA 2QNKA 4AF9A 5EHAA 1A3KA 2NS2A 4OHVA 1BMV2 4AFAA 2WR9A 4U2AA 3J4UH 3DF0A 4LO0A 1J3PA 3ST7A 1Y9MA 3R6SA 4QPGB 5FKBA 4ATEA 1UMHA 5EJZB 2I45A 5FQ0A 3TEWA 1BCXA 1SMVA 2G19A 4JTNA 3MV11 3T4VA 2O0OA 5M0TA 1SDDB 3P6JA 1PMHX 2ZGSA 2EAKA 3TEXA 2FDGA 4LO3A 1XE8A 4P9YA 2JG9B 4BJ0A 3LOBA 1ZBE2 3EB7A 4IONA 4FXKB 2KA3A 3SKVA 4QQPA 1ZNPA 3LLPA 1D4M3 1Y43B 4AZZA 4X39A 2X5IA 3WCRA 1NAEA 1HLCA 3PG0A 2D5FA 4EE2A 2OQ6A 5A7WB 3S7IA 4CRQA 5FXZA 1TWEA 4P0JA 3WW4A 3ACHA 3AVSA 1UPSA 3CHXA 3EMRA 3TN92 5ACA3 5CG8A 4UFLA 1H6YA 5I0UA 4I8MA 2WNVC 1Z2VA 3O49A 1OUSA 3APBA 3W58A 2XWJB 3OJ2A 4Q9PA 4DQAA 1EYBA 1XYNA 4JZRA 4MX3A 3WDTA 1ZBE1 2MEV2 1QXRA 4MGSA 4LKSA 5J36A 1JZ7A 2GC0A 2ZXQA 4MLOA 4BXSV 3O0XA 3WXPA 1ZVFA 2BBAA 2AR6A 4CDUA 3H6RB 2JDPA 3JUUA 2YBKA 4G9NA 4XBLA 2E7QA 4FPYA 4GOYA 2D3PA 4FT8A 4P9IA 2XUMA 5DAWA 4BK5A 1GP5A 4BM8A 4ZKTB 4L11A 3CIHA 4K20A 3OF1A 4QDRA 3VD3A 2W1QA 5A6QA 1JYIA 3OGFA 4OWKA 3S6PA 2UWBA 1TNRA 2VOWA 2XXZA 2ZHLA 3TN91 4XKIA 4AQTA 2G9ZA 1LR5A 4CCNA 1WGPA 2J42A 1RMU3 2WO1A 5F39A 4XXPA 1PUUB 2ZCWA 4HOOA 1HB3A 3KWVA 2XWBB 4BXFA 3FJHA 5BPXA 2MEV1 3HQRA 1EP0A 5BNNC 3DXTA 3T1MA 3POGA 4OUJA 4XEZA 1UOJA 3J8F1 2K46A 2LALA 5F32A 4KEKA 1PGSA 5IUQA 4MGZE 2HWE3 1DZQA 2JJ6A 2P6CA 3CJIC 5C3SA 1LEMA 4TLFA 1ITBA 5A32B 5FR3A 3MZHA 1RUC2 3DKWA 2Y64A 5LBCA 3WNMA 1CX1A 1UY2A 4QX5A 1SBEA 3ZFGA 2HZ9A 4QC4A 1PIV2 4G1RA 4HANA 5JOZA 1TEIA 4A3XA 2C6SA 3NBNA 1E5RA 2IXCA 3MICA 5FZOB 4XE9A 3ZLIA 1CAWA 3LSDA 5E16A 1UY1A 4N43B 4BLJA 4KWUA 3HOBA 1G6NA 3HVDA 4FFGA 4NWWA 4X6RB 3IMMA 4YVSB 5FP9A 3UETA 2FD8A 4IZXA 4J23B 3SKJE 1S0IA 3Q8AA 2V5DA 5FJKA 4BCUA 5FY7A 4RFT0 5JIUA 1YJKA 4ZPIA 1WZXA 3K2OA 1MEC1 4D0TA 4JGYB 1I1EA 2ETEA 4LBQB 1RUC1 1VMHA 1SLAA 2VTFA 3T08A 2R041 4QU1A 4R6UB 4Y1VA 1UZZA 1PIV1 3IM7A 2W52A 1UXXX 2OZ6A 2WJSA 5FMCA 1D4M2 2TNFA 3KZ4C 2VZQA 3KS7A 3KV6A 5A33A 3IM6A 2Z49A 4M3CF 2GP5A 1K12A 2RS53 2FDIA 2VU9A 3AP6A 5FK8A 5IVEA 3EHKA 1DQ0A 5FZEA 4EJRA 2VG9A 4JGZA 1DG6A 1QDCA 2VOXA 1SLLA 3QD6A 5ERLA 1LGNA 1OLME 3T30A 2EALA 5A7NA 1W06A 4Q0VA 4ZXEA 3UNPA 1JOJA 2D6PA 2V4AA 4LIVA 1GSLA 4QB1A 1KFUL 1WLTA 1CAVB 3WW1A 1LOGA 4LT5A 5BOWA 4LOSA 4WM7A 4I4PA 1OFNA 1W2AX 2PAKA 3GGLA 4GH4C 4LE4A 1OKOA 4TSVA 2ZHKA 4NWVA 3KF5A 4CEWB 4DEQA 1JT5A 5DSSB 5LA9A 1NE6A 5DQ0A 3VZMA 3ZFEA 2VNVA 1W3XA 2ZX4A 4BQYA 1PO22 3UYJA 1QMJA 2P17A 4Q0UA 3K77A 3VKOA 2VMFA 4NJ4A 1RMU2 4XUQA 4QPGC 3RTIB 3BAVA 4MGTA 3RG0A 2DU1A 2Q5TA 5CFCC 4FPFA 3ZMOA 1NCRA 4M4RA 3AZWA 3H3LA 4MYEA 4I0YA 3D0SA 1HX6A 2ESUA 1PMJX 4OMDA 5FNWA 2DFBA 2L9LA 4DS0A 1HV0A 4LO7A 2D6MA 2HWE2 4CDQB 3RZGA 1IS6A 1SDWA 4L8QA 4P02B 2D6OX 3N0KA 3T2TA 5IK8A 1DGWA 2R073 1GQHA 2FFVA 5EG6C 1PO21 4IE6A 1UOGA 3MFAA 4N8MA 2Q0AA 2VQAA 2F8XC 1GNZA 3SC7X 1OQDA 2ET1A 2R063 2ZABA 4XFBA 1UD1A 4XZUG 3UJ4A 3WMVA 4H7LA 3AXDA 2EIEA 2W2IA 3BUCA 1HN0A 2PHRA 4L4HA 1OF3A 5FPUA 2VQTA 2HWC2 4QX8A 4CP1A 5IK7A 4META 5DUVA 5FYZA 5HI0A 3M2MA 1LCLA 1HCEA 5B4XA 1EV2A 2YZ4A 5C5UA 4JDNA 3GJAA 2YDEA 3LOIA 5JSOA 5FXXA 3TNQA 1X7NA 2FO1A 2XOAA 1J58A 3MBWA 1G9AA 2RS33 1F15A 1TE1B 1X36A 3AMPA 4F8AA 5BY5A 3T09A 3O1MA 3NBCA 3U1XA 4BQ3A 4B1MA 1GGPB 1DQOA 1O59A 4EN7B 4D8MA 3AL5A 3FBYA 3I29B 3BTXA 3AB0A 4QBVA 2HWC1 4CCMA 4BHPA 3H7YA 2QTWB 4CEYC 2PMWB 5KR7A 3WNOA 3CQOA 1RUOA 3EJKA 5F3EA 3KVAA 2A6ZA 2WRAA 4I4YA 4XUPA 2FMYA 1PWAA 2SLIA 3KV9A 4NUBA 2G9GA 3WVJA 5IVJA 4MHRA 5T54A 4E8DA 3FX3A 2E63A 4URAA 5KC5A 1HIXA 3S8JA 1QOSA 4H04A 3HEIA 1ISZA 2YB7A 4P9JA 3HNMA 4Q91A 2ZZJA 2Q8OA 1COV3 2WNUA 1S0FA 3Q7WA 2EXIA 1XE0A 2IXJA 2F2FA 4YWAA 1QQKA 2KM2A 4DB5A 1GQGA 3I8TA 1IPKA 3FLTA 2R49A 3ZR5A 5BP5C 1OF4A 4YVSC 3U78A 1LHUA 3TNPB 2Q3NB 1Z0HA 5FYCA 2A1XA 1QXPA 4FPHA 5SV5A 4R9DA 3VN4A 1YFWA 4J2YA 1UYPA 3SCHA 3CA5A 1RUG3 2WZPP 4MZGB 4FFHA 2DCYA 3OPTA 4DENA 4P5YA 3BTAA 5DMYA 2W1SA 2P39A 1EPZA 3JUTA 1UZVA 1AR93 1Q8OA 4XQWA 5L7OC 3HBZA 4GOVA 1MS3A 1H2MA 2GC2A 1W6MB 2R072 2YHJA 3DPRB 1JZ2A 2A73B 5F1RA 2RDQA 4HVQA 3K1XA 1WD4A 3VBUA 3BTYA 1BARA 3NJXA 4NOTA 5JR7B 5FZ6A 2BDRA 4F3JA 1A8DA 3DYPA 2ZACA 1AXZA 4GMP1 4FCAA 1XNBA 4PCRA 2HWF2 1FV3A 3KQ4B 2EF6A 4JRAA 1QKQA 4PC4A 3IMNA 3NNLA 4OFGA 1IG0A 1QXJA 5A1LA 2WYFA 5IW0A 2VSEA 5IFTA 2CV6A 2NPIA 2XOMA 3GBGA 2ATFA 5G05L 2IHOA 5EP9A 4J1XA 1IT0A 2UUSA 1PK6A 3OGJA 2YU2A 5DUWA 1YF8B 41BIA 1QF3A 4GIQA 1ZBA3 4UFIA 3AKFA 5GZEA 2VCAA 5JMOA 1STMA 5KHHA 4A45A 3VT2A 2FGFA 4CEWC 5BXPA 1VBB1 3OYWB 1RUJ2 2VZPA 5EV7A 4Y1ZA 4AFDA 2VCBA 1GOGA 4PIXA 3FJEA 1O4YA 1QJU3 1TME3 2HWF1 3MF9A 4UI9L 2P2KA 4Y26A 5D8AA 5T50A 4NIDA 1QXMA 2QCSB 3KD4A 1OOPB 5CKMA 4NIGA 5DDJ2 1APNA 1NA1A 3BPZA 4HN0A 5F7UA 5JAXA 2FCUA 4FQZA 5EJ1B 1IILA 1YLLA 1GNYA 4XUOA 1SZ6B 3OBZA 1UO9A 2C0ZA 4N9HA 5EFUA 4DY3A 2X2SA 3VEQA 2BP6A 3NBEA 4K8RB 4AQ2A 4QQLA 3WR0A 3OB8A 4CDQC 4QKBA 1VP6A 3O14A 2YBPA 1B09A 1RUJ1 3FZ3A 4AVVA 4L4IA 4RHV3 2K2SA 5KHJA 3S57A 1XSRA 2B8MA 2FCTA 4Q0PA 1MQTA 2ORZA 2RG4A 3NSTA 4JQTA 3VBOA 3T0DA 1NCQA 4PLNA 1WLDA 2GU9A 3WF1A 3ZYIB 1AR82 2VMIA 5DDJ1 1ND2A 1IS4A 3CBNA 3ZPOA 2Z42A 1JUIA 1OA4A 2FDJA 3ZXGA 3VDDB 1PM4A 4ONUA 3ZXFA 4CTEA 3PU8A 3UKNA 1JZ5A 2Q1ZB 4NHKA 3H50A 1W6NB 4AR2A 3FUOA 4R9AA 5JWPA 5K7PA 1RUG2 4F7ZA 1JTCA 2EXJA 3ZDVA 4Q26A 2YGMA 4XFFA 4CDXA 2RM23 2Y26A 1YI7A 1IRPA 2W87A 5LK5A 1O3SA 3MV01 4XMIA 1AR92 1XRUA 5I0TA 4BIOA 2XJUA 3DL3A 1AR81 4WZCA 5JOWA 1AUYA 2XLAA 1JZ8A 3LA7A 3WINA 1DGRN 2E6VA 2Z2SB 2DREA 4YYOA 2XG3A 2FZ1A 2RMU3 3ROUA 4FTEA 1POV1 3Q7XA 3ZFFC 1ZZ6A 5CEHA 1L7RA 2Q8DA 3K48A 2VZRA 3ZC8A 1VBC3 5FZGA 1L7QA 3RI9A 2BBVA 2VZOA 2D1ZA 4GZ9A 4C0BA 2ZMLA 3MIFA 3LFIA 2WSVA 5T55A 2RJKA 1KGYA 3BU0A 4EYUA 1WBFA 1YNAA 4W50A 1FAYA 2VMHA 2VXRA 1BXHA 4H2AA 4I4XA 2H0VA 3TYJA 2KXLA 3C7EA 4R9CA 1V6KA 1S0BA 5IVYA 4FTBA 3LE0A 1PMIA 3ZMNA 2YG0A 1WCUA 3ZN4A 1VAKA 4BB3A 1FN0A 1ISXA 4IEYA 3UJQA 4COWA 4CU9A 1O8PA 1BHGA 1YC61 2P6HA 3QLQA 2HWB2 2QFEA 3S8KA 1G7YA 5EQUA 4AAPA 1DLCA 2GALA 2Z5WA 1C1LA 1JOPA 1XU1A 4XQ4A 5CU1A 4ZFWB 3M4FA 2O14A 3WUCA 1JQZA 3R4SA 2JDYA 1UOFA 2DCZA 3O4CA 2A7AA 3OD4A 5JLVA 7I1BA 5FZDA 3M7AA 4QPIA 3SISA 3GF6A 3LPGA 4DXZA 1W2OA 4INDA 4YFWA 2YFZA 5LCWL 4PIYA 3DPRC 3NVCA 5FMDA 4AE2A 4AQSA 1RUF2 2D93A 1EV12 4KQ7A 2HWB1 1PHMA 1GQPA 2RDNA 2W94A 2WT2A 4L0PA 3T0AA 1X9PA 1F5JA 1V6MA 1I1BA 5CG9A 4LO1A 1PX4A 3CDZB 3HD8B 3ZR6A 2L5XA 5BQUA 1QGLA 4Q4W1 3IAGC 5L73A 2P3IA 3U10A 4E2SA 3F95A 1UIJA 1YWKA 2K9ZA 3PL0A 5K0UB 2JWPA 4KBZA 3AFGA 2ZMKA 1V6LA 1N3PA 4D94A 1FMZA 5FP7A 1JH5A 3TEYA 2RM22 1QNYA 2DU0A 1N1SA 3D5OA 3POSA 4AI0A 1RUF1 2Q1FA 3B02A 1JODA 1HRI2 1EV11 2IXLA 4Y22B 3U4XA 1BFBA 1TFMB 3O12A 1W9TA 4O9GA 2YPDA 3R4UA 4IV1B 5IVFA 4EB2B 4ET7A 3A21A 1KJLA 4YVWA 4IV3B 2ERMA 2ARBA 3D82A 1OOPC 4Z07A 4YRDA 3VHNA 4NMIA 1DIWA 3IM0A 2D6KA 4FPKA 4N90A 2WNVA 4G4FA 1W6OB 3JBG2 1VBC2 2WIIB 5FZIA 5APAA 2VMDA 4QXKA 4UW4A 3K3NA 5HV4A 2ZX2A 5C8WA 1UYXA 4XIOA 1HRI1 4QKNA 2NP0A 4GAIA 4P6AA 2IUWA 4OW4A 1ZZ7A 1I3HA 1NLQA 1WA6X 3ZM8A 2NQYA 3V65A 3L2YA 4AL9A 1W9YA 1AYN3 3I7DA 3SITA 4EZHA 4ZFYB 3FJJA 4LKDA 1QJX1 3UDAA 2WNEA 3U07A 4CUBA 5BNOB 2CAVA 1W39A 5DXDA 3HN1A 5CADA 1PZ9A 2WABA 2XL9A 4Q27A 2ZGPA 2AH2A 4G9SB 4I30A 3JBG1 3DECA 3VDDC 3WQ0A 1ZZ8A 3POBA 4RYDA 2XPJA 4I4RA 1GZWB 5F6LB 5A3OA 4EWAA 1JXNA 3K75B 5GZGA 1SEFA 4A3ZA 1H8TB 1PZ7A 4TWTA 5GKAC 1SPPB 2XJQA 3FHIB 3E5UA 5IYYA 2FZ2A 4GQ7A 4JDMA 3U14A 4F83A 2YUGA 4A7KA 3CRIA 2GNMA 4LOTA 4CCDA 5JZGA 3T2QA 1AZDA 2BOJA 5FZ4A 5T3NA 2PQSA 2ZEXA 3I4IA 4XC9A 2VULA 5I93A 2BPA2 5F90A 3KV4A 4QX0A 1LTEA 4QGMA 2X53S 1JTZX 3PUIA 1OC1A 3B94A 5IK5A 1W3AA 2YV8A 1KNMA 1H2NA 3SLIA 2RS13 4G6JA 4AVSA 3MUZ1 4COYA 1VR3A 5LY2A 1GUIA 1LAJA 4XW3A 4LLFA 5E89A 4LO8A 4NPMA 4YGEA 1G9BA 3VBHA 1VLNA 1SFPA 4KWKA 1QOOA 5FZ7A 1U5XA 3S7EA 4YG0A 2Z48A 3RJRA 5FFOC 4B4QA 1AX2A 1AVWB 4X8NA 1AR62 1F4AA 1HXS3 4CYDA 1D7PM 4IEZA 2BFUL 2KKIA 2D3RA 3K4DA 3AMHA 5F5QA 3WEZA 1DJSB 2YFUA 4UW3A 3HALA 4IY9A 2W46A 4I7IA 1OFSA 2BRTA 2RQ9A 3OGSA 1J83A 3VDCA 2OA2A 3G6JB 1W2UA 2HYKA 5CKNA 3OBTA 4EFRA 3MGUA 5J98B 3W9AA 1G9FA 3VD9A 2BU9A 4XIKA 1CVSA 4JDOA 3FUQA 1ISYA 1RGSA 2GH2A 5LRRA 3O1VA 2DVGA 3UKTA 2E51A 1V6NA 1FOD2 1FNZA 1FYUA 1F9KA 1RJ8A 3CZJA 3PLQA 1D0HA 1AR61 5A3UA 4CSWA 5DG2A 4JPZA 4FTSA 5A7QA 1ND3B 1ASJ3 4N53A 4IHZA 4W6XA 5DPNA 3WT3A 4BQ1A 5C70A 1RG8A 4I0WB 2WS93 3LWCA 4HVOA 2C4XA 2UWCA 2Y9FA 1HDKA 3WHUA 4FAGA 5F8YA 1OMIA 3M70A 1YEWA 1EUTA 1FOD1 3GZTB 5C9AC 4CU6A 5K0UC 4PI2A 1K5MA 4FP3A 2ZEWA 1H9PA 1L7LA 3H8XA 4I0AA 1REDA 1VJ2A 1OA2A 4HKOA 4OHWA 1NE4A 4DY5A 5KXBA 4GMP0 4TXWA 4PLOA 3VBFA 1W6QA 1II4A 2BVBA 5FZLA 1IOBA 4HBNA 5KHGA 3MPBA 4IV1C 4I4UA 2DVBA 1YTOA 2VZSA 3UT0A 1SR4C 5IJRA 1V6JA 4IV3C 4AHWA 4NIHA 4I2SA 2OXBA 3ZKYA 4PHZA 3E5QA 1DZRA 4AAXA 3ACIA 2DDUA 2OT7A 3E6BA 3TBDA 5FYTA 1C5IA 5DUXA 2YC2A 4XF4A 5I1BA 4OI1A 3ZVXA 2Y6JA 2DCJA 2VMEA 4LBOA 4MXWB 1QHDA 5CB7A 1OLMA 5L9BA 4Y5SA 5FAXA 4AN6A 3LEKA 3IPVB 3UGFA 3HOMA 1YFUA 3IDCB 3SMHA 1IS5A 3LFMA 1CWPA 3J7LA 4JKLA 3MIHA 1R1A1 3A07A 2JG8B 3BRGC 1W8OA 4ZGRB 4PQQA 2P1BA 4ASLA 3AYAA 5C9AA 5KXEA 4TZDA 1DQGA 1ONKB 1EY2A 4IEOA 4HONA 5DAXA 3BADA 3D8CA 5BNOC 1ONAA 4P9WA 1C3HA 1XE7A 4OI2A 3N3HA 2Q8EA 3WW2A 4OULA 3VZNA 3RZHA 4BMBA 4MGQA 4OZOA 3RQ0A 1Q56A 2CHHA 4CA9A 1JS9A 4A2UA 1GMMA 1RUH2 3LA2A 1JI6A 3TWIA 1CD3G 5L9RA 1TOOA 3ZO0B 4XAAA 5JMCA 4XYXA 1H8TC 4P0LA 5JXIA 4A6OA 3BAGA 1O3TA 5FY4A 5L9VA 1B35C 1GZCA 4WVMB 1H8VA 1V70A 1ZA7A 3O1OA 1ASJ2 2XBO3 4P00B 5L19A 4SLIA 2OPWA 1HWPB 3H42B 4P14A 1YO8A 4C8DA 4Q0SA 5AFBA 2RR13 1TWMA 4Z1VA 2WZR3 3DYOA 1O4ZA 2HWD3 2J1RA 3VBSB 2A3WA 2P5BA 3NNFA 4LHKA 1RUH1 1WMEA 1IKQA 2WT0A 3THCA 4C90A 5FIXA 2ZGUA 3NBDA 4QO3A 4GULA 5FY9A 1DFCA 5JXHA 1LECA 3V56A 3TRSB 4QKSA 1AL0G 3KVBA 5DVHA 4FOYA 1CPNA 4NR1A 1RVF2 4E2QA 2FDHA 4I1EA 1VBD1 4II0A 1LGBA 3GZAA 4P0KA 2VCCA 1QJY3 3H3ZA 1GOHA 2D24A 1S2EA 1C8NA 5K8SA 2AACA 3AP9A 4NIIA 1POV0 5JOYA 3WP3A 1WD3A 2OX0A 3R4DB 4QXHA 4N53B 3VGIA 4KNCA 1YFYA 2MIBA 4I3NA 1XG6A 1UL9A 3IAQA 4H7MA 5L7OA 5FLIA 1NXD1 2UY9A 2VUDA 2XJPA 2NVHA 1ZRRA 2WO3A 4Y33A 2BNMA 1DFQA 1BMV1 2IXHA 3PUBA 5F5CA 5F9TA 4EKXB 2ZQNA 1X50A 3ON7A 4DCKC 3AYDA 1JN2P 2MLLB 1F2NA 1CAUB 1RVF1 2BW8A 3NKTA 3NNGA 1DYPA 5FKCA 3UK9A 2WO7A 4LUKA 1K5MB 1FMD3 4Q0QA 3LB9A 5E8AA 5LB6A 3ZN6A 4QD2B 2RJLA 5EC5A 4J2XA 1DGRA 3OOXA 4HETA 2VR4A 1PO12 1O6UA 1ND3C 2BGCA 5BXXA 3BI3A 1M16A 5FNXA 1PZZA 2QYIB 1X9TA 1UY0A 3HIFA 4XZPA 2PLV3 1CN1A 3AH2A 3HBWA 4YW1A 3UESA 1RXGA 4WVWA 5FZ9A 2W68A 1PVC2 2PA7A 1F31A 2VZUA 3CKHA 5LRSA 4HMZA 4S2DA 1QOTA 5F3IA 1IZ3A 2PHTA 4WVVA 4UF0A 3SQOA 4LO2A 3O1UA 3NAPA 4MGKE 1S0GA 2QQMA 1ZREA 3KSCA 4AVBA 5LA1A 3KLSA 3RZKA 1Q8SA 2VW2A 2BEOA 1PO11 1RUD3 5FZUA 4LBJA 2B46X 4NRQA 4DINB 1CGPA 3SH3A 4M3CB 4K7JA 1CE7B 3D0JA 5KHKA 3WNPA 2Y6KA 1RUE3 4CJMA 2DBIA 1X8EA 1TG7A 2XBO2 3NV1A 2R32A 4HL0A 3THTA 4Y20A 2ZHNA 3B7MA 1CAXA 1PVC1 1BLZA 1NYWA 1E57A 1H1IA 3RSJA 4YZ1A 4IZEA 1UCXA 2ZA9A 4RA0A 2B42B 2WZR2 3PIJA 1BZWA 1GYKA 1M4WA 4QAWA 2J1SA 5FY8A 4OYUA 1KS5A 2XVKA 5GALA 3VUOA 1Y9GA 4LIUA 3S0MA 1OHFA 3LDRA 4I6IA 3M3CA 1H1MA 1RTVA 2ARAA 2D97A 3X29B 4YW2A 1R1ZA 1R083 3HWJA 4XUNA 4FOVA 4Q2FA 3BAUA 1QJY2 4FI9A 4NVPA 4UW6A 3HSMA 3BA7A 1V6WA 5FYYA 2EIBA 2ZQOA 3WO2A 2JG8C 2XJRA 3WF0A 5FZ3A 4CP9B 1HB4A 1JZ4A 2Y6LA 3AP7A 4RS5B 3CU7A 2XB6C 3KF3A 5FP4A 1OLQA 3USUA 1GP6A 4E27A 2WBKA 1BKZA 2FDBM 4XF9A 2A6VA 3OEAA 3POWA 4GA9A 4KEJA 5FYSA 4FPLA 4IE5A 4JX0A 4QGLA 5CYYA 4HKWA 1TVGA 4ZZ8A 2YUEA 2KI4A 1BLDA 1VBA3 2QDNA 4XOGA 4AVAA 3ZFFA 3FFZA 2RDRA 2K8RA 1FV2A 3AJZA 4L99A 3VV1A 5ACA2 2ZKLA 4KBBA 4NROA 3WG2A 4BK4A 4W4ZA 1AR73 1FMD2 4A4AA 5FQ0B 1NOVA 2MHFA 1XPWA 3VD7A 2Y9XE 5AC93 1R093 2QQKA 3WMUA 1O4TA 4Q1PA 3QBQA 4UFHA 1WLWA 2G9FA 3M1HA 4HSJA 2VQ0A 1AYM3 4CCJA 4LBLA 3HAGA 3PVNA 2DVAA 3RS6A 1D4M1 2PLV2 3D6EA 1Q03A 3O44A 1WBAA 4LE3A 4WM8A 4AYUA 3VBSC 5A3MA 3ENRA 4PDWA 3PJYA 3KM5A 3CMGA 3AZZA 2AXMA 4L92A 4JKQA 1RXFA 4OWJA 4PIZA 4M0NA 2X5IB 4PQ9A 1NZKA 3RVHA 3ZSJA 3P53A 1WMFA 5ACA1 1KD7A 3OGGA 4HK8A 1GWMA 5CFDA 4HKLA 3CA1A 2Z79A 4BYYA 1LRHA 3ETQA 3NW4A 4WZFA 4AEJA 3AH4A 4J2KA 4ZLBB 2PAEA 3ALQA 3QOPA 2QUOA 3I54A 2IFWA 1YIFA 2G4IA 2OQ7A 5C4WA 1LESA 3FBMA 3OUJA 4YW4A 3LDBA 2JG9C 4XILA 3O4OA 3PTRB 1BFGA 4Q29A 4LKFA 1Q8VA 4YGCA 4E4HA 3EBRA 2ZX3A 3AMMA 1H4GA 4IERA 3GHNA 4CDUB 4Y4YA 3MIBA 5BNPA 1ZRFA 3EO6A 2WWJA 3INAA 4XJAA 1JY0A 1XNCA 3C3VA 4NRMA 2ZX1A 4ARYA 2Z4FA 4Z2AA 4QHBA 2EIDA 1RMU1 4O9EA 1D0GA 4QXBA 4CXXA 2D20A 1E5IA 3NRUA 4C1XA 3BAQA 2WFF3 2CGPA 3ILFA 3HNBM 4LBNA 4XF3A 3JXSA 4Y3OA 3AJ6A 2QQLA 3ZYJB 4QD2C 2AAIB 1I5ZA 1X33A 1OH3A 2ZTNA 5EXOA 4A41A 1DDLA 1UX6A 1OQ1A 2ZEYA 3LF7A 4X6QB 5FZMA 3B9IA 1XYOA 2HWE1 4JHTA 2C24A 4HG6B 2RJ2A 2R1DA 4QX7A 1P8JA 4QPYA 4PBPA 4RGKA 3WW3A 3P6BA 2WC2A 3BVCA 1BBT3 3PNAA 4XFAA 3ZXEA 1RUI3 1WLCA 2UY8A 3LSEA 3UGGA 4XACA 5GLUA 3ZFGB 3I2DA 4MGIE 4XABA 2WA3A 2B7YA 5GZDA 1SHWB 2RS52 4EQVA 1QQP3 1HQLA 4EN9B 1YQCA 1CAWB 4D3WA 1W9SA 2J1VA 4CDWB 3SH4A 3I3BA 1XZZA 2PFWA 5F2SA 2EAAA 4BMEA 3ZPYA 2LW8A 4HXCA 3CEWA 2X8KA 1MD6A 1KXGA 4YOLA 2GO2A 2HH9A 4XFUA 3SHRA 4Q4X3 3AH1A 1CZTA 3MO4A 5AVAA 1JUHA 2EICA 2GP3A 1KRIA 3MIGA 4IEUA 4Q4V3 1JW6A 3CAHA 5ABJA 4G9MA 3DGTA 2LM3A 3Q8FA 3Q8BA 4NRPA 4RR3A 5DN2A 3CA0A 4X37A 2RS51 4QQHA 5FV3A 3U0ZA 1VRH3 5A33B 2CY6A 1MS0A 4AHXA 3OSDA 2MC2A 1QJFA 3WNNA 1C8M3 1GR3A 2ADDA 2VW1A 1CONA 2YC4A 4N43C 4CE8A 2P3KA 2P4EA 3O1TA 3FJCA 2OIIA 3BOWA 2CWSA 3AMQA 3N36A 3RGBA 3I2OA 2AC1A 5A7OA 3OTFA 4JGZB 1WMDA 3RI8A 4MZFB 4GP3A 1MVEA 2UYAA 4W6WA 4JGYC 4EZ4A 1HIBA 4UAPA 1AF9A 4CP0A 2JE8A 1QNWA 4RS5C 4CU8A 4YGBA 2LIEA 2E32A 4WM7B 1JLXA 5F6KA 1AFCA 3RZMA 1H2KA 4XAEA 3TAYA 1CESA 3MHZA 3AX4A 3T2OA 3ZFEB 4LK7A 1SFNA 2V73A 2R062 4J25A 3B00A 4N7IA 4QU2A 5A6ZA 2NMOA 4WBCA 2ZR1B 2JIJA 4LO0C 2BJSA 1KDMA 2OUJA 2WFF2 2GZWA 1H30A 3NL1A 3ACLA 2CWMA 1OSGA 1URXA 4GJZA 4R4ZA 1S2BA 1U5YA 2VM9A 4FPCA 3ECQA 4ES8A 4IEQA 1NCRB 2QQJA 1V0AA 1CVNA 2WDBA 4QB6A 5KC6A 1ABRB 5D2AA 1HKNA 4LO3C 1SCSA 3GBWA 2WAAA 3DXUA 3M3IA 2P37A 4P9LA 4LO7B 3ZYFA 1E5SA 1V00A 2R071 2RS32 3H1WA 5LA0A 2Y0OA 3QH6A 2ZGMA 3K46A 4AW7A 1SACA 2V5YA 1TMF3 1ZRIA 3RYKA 1RUI2 2R061 2O8OA 3ITQA 5GJ6A 5A7SA 2WFF1 2ZGTA 4GP0A 1WWYA 3VKFC 3V0AA 3BA5A 3GCWA 4XFTA 3BGAA 5GAQA 3RMXA 3K3OA 5LY1A 3O4BA 4DFSA 1WA4A 3IIAA 1UNBA 2DF7A 1S2KA 3A0NA 1JYVA 2XQXA 4Z8BA 2VTXJ 3IAPA 1QEXA 1XYFA 3I3DA 4XHXA 4AFBA 1AX1A 4BPZA 2AFGA 1KJRA 2GC1A 1C1FA 1ZA4A 2RS31 2EXKA 1BK1A 2JKXA 4HZFA 4CDUC 4Q4X2 2R1BA 2DS0A 1QH7A 4L2NA 2WZEA 2XHNA 3IDAA 4HSLA 4S2HA 3WOGA 4Q4V2 5IFPA 4BQ5A 2E4MA 2F4LA 3JB8A 2HEYF 5F37A 3I2AA 1Z7S3 2RE9A 1COV2 1IHMA 2JECA 4CXWA 1U0AA 1FX5A 1AL23 5GLZA 4OHXA 1VRH2 4FPGA 1BASA 5F5AA 4Q8LA 3DYMA 4COUA 1XC6A 1C8M2 2SBAA 1N1TA 5H9SA 5C8CA 1REEA 2Y60A 3N4MA 1IQDC 4JQ0A 1XNKA 2PHUA 2FCVA 4OI4A 4LNVA 1Q43A 1PNFA 4ZU4A 1GOFA 1W6PA 3URFA 4AEDA 1YXWA 4OCTA 2OZJA 3B69A 3THDA 1MVQA 2DVFA 4H3WA 5T5OA 1Q1UA 3NWKA 1GV9A 4K6BA 4OLLA 1WCSA 3UGHA 5GLTA 1HJGA 4GALA 1COV1 2GH8A 1HB1A 2I07B 2OPKA 1UX7A 2X10A 2RSTA 2PHDA 2NZ9A 3ZFGC 2BV4A 2GDFA 1HRV3 1HCDA 4D8HA 2WNUB 3ZYRA 3AMNA 2AQZA 3N9MA 3I2HA 3C7OA
chains in the Genus database with same CATH topology
2BWAA 4AVCA 2YGLA 1XYPA 4XJWA 4CDWC 3C9ZA 1LOFC 4XFGA 3VBRA 5L36A 4RD7A 2QZ2A 2A3YA 4UBHA 5EZWA 1RUG1 4AI2A 5I0RA 2LIQA 4QM9A 3OJBA 1NQJA 3PJQA 1CPMA 5FMOL 3UJ0A 4FVVA 1FPN3 1HWOB 4YSFA 1AR91 4P9GA 2XLFA 3JQWA 4J1WA 2E9QA 2GMMA 3A23A 1ZBA2 4HK9A 1KFXL 3MLKA 4K40A 1PM7A 1RHI3 2ZAHA 1TMF2 1JYCA 2JKBA 3N7LA 3CO2A 4ORFA 3VBUB 1QJU2 4QM8A 1TME2 5FPXA 1CIWA 3WQ1A 1BVVA 1JBCA 3JCIA 3J9SA 2VECA 4JGZC 1M2TB 3BOPA 2WINB 5JOXA 3SNMA 3MI8A 4QGNA 5E1RA 4FQ4A 4RQPA 1SLTA 3POKA 2DURA 3AP5A 2ZGRA 3CL1A 1JT4A 2MNGA 1ZBA1 1PK6B 1EAH3 2PHLA 3BB6A 4WM7C 2M49A 2VOVA 3FLRA 4RHV2 3UD9A 4K1ZA 3T8SA 1G86A 1ZRDA 4YZ2A 1AXYA 1QJU1 4IEWA 4KEIA 1TME1 1MS1A 1VIWB 3RJ2X 3PMEA 1OD5A 2ZOEB 5D8AB 4X8PA 1VBE3 3FWEA 4ATFA 3VHRA 1NA1B