1UPSA

Glcnac[alpha]1-4gal releasing endo-[beta]-galactosidase from clostridium perfringens
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
404
structure length
402
Chain Sequence
AKDFPANPIEKAGYKLDFSDEFNGPTLDREKWTDYYLPHWCKDPESAKANYRFENGSLVEYITEDQKPWCPEHDGTVRSSAIMSFDKSWIHNFSGTTDNHERNEWRGYTTKYGYFEIRAKLSNTGGGGHQAWWMVGMQDDTNDWFNSKQTGEIDILETFFSKKDTWRIAAYGWNDPNFQTSWTISEDKVPSGDPTSEYHIYAMEWTPTALKFYYDNELFKVIYGSPDYEMGTILNIYTDAGSGAHNDVWPKEWAIDYMRVWKPVDGYKESLNNYLIRNRQTGKFLYIEENNDKVSYGDITLKNEKNAKWSKEYRDGYTLLKNNETGEYLNIENQTGYIEHGKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGVLQYGNVPNTYWTSQWQLIPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three-dimensional structure of GlcNAcalpha1-4Gal releasing endo-beta-galactosidase from Clostridium perfringens.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Glycosyl hydrolase
molecule keywords GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA-GALACTOSIDASE
total genus 111
structure length 402
sequence length 404
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1upsA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1upsA02
3O4DA 3WZ1A 1BA7A 3IM6A 3AKHA 3SNMA 2GALA 1D2SA 3O3QA 4YG6A 2FFUA 2WJSA 3WMVA 1F31A 4BQ1A 3PG0A 8I1BA 3F62B 1A8DA 4Q8KA 3HBWA 1QDCA 4I30A 3BAVA 4ZOTA 1B09A 2CYFA 4Z8BA 2YUGA 1RIRA 1UPSA 4DENA 5EC5A 3S8KA 3SISA 1ILR1 1HWNB 1GNHA 1GANA 1MVQA 2EXHA 4PCRA 2FHRA 4NO4A 1JYCA 2E4MA 2D6OX 5KXCA 3WG2A 4R9BA 4OZXA 4XYXA 2MLLB 2JE7A 3S8JA 2R0FA 4A7KA 1ITBA 3T2TA 3N35A 2AYHA 4LBLA 3Q7WA 5JOWA 2VH9A 4Q91A 1S0DA 1SLLA 1LGCA 2ZQNA 4WVWA 4TZDA 4FP3A 1W0OA 3KQRA 3FFZA 1RITA 1GNZA 4Y1ZA 1DQ6A 4I4XA 1GBGA 3V0BB 3OJ2A 3AH2A 1QNWA 3WDVA 3OYWB 1FNYA 1T4QA 3Q7YA 3VT2A 4I4OA 1JHNA 3AYAA 4YW1A 1IKPA 2RSTA 5GLZA 3BAUA 1G9FA 1WLDA 1DFCA 4C1XA 2A6VA 1Q8SA 3KMVA 4FPHA 3FJEA 4QKSA 4DPNA 4JP0A 4HANA 3AX4A 4GOYA 3HSMA 1VAMA 4FPFA 1R8NA 3AK0A 2UUSA 5DXDA 5T5LA 4BLJA 1PUUB 3AP7A 2Y9FA 1HWPB 2V5YA 3MALA 1JT4A 5LK5A 2GO2A 1CR7A 3IPVA 1JYIA 3POWA 5AVAA 2WT1A 5KXBA 21BIA 4ZFUB 4K20A 3VKNA 3I2XA 3A0KA 1JUIA 1S0IA 2E4MC 2A6YA 5IK8A 1S1AA 1G9BA 5IT6A 4X3AA 2E7TA 1Z4SA 5JOYA 3VUOA 1GGPB 5DZUA 4Y1YA 3QCWA 3M3EA 3P6IA 4PBOA 2BEAA 3OYWA 4XXAA 2RG9B 2BQPA 1XZZA 1PUMB 5T52A 3AXDA 1MS3A 2AUYA 3A4UA 4RA0A 4ZKTB 1I1BA 1JOJA 3WVJA 1IHKA 4X37A 3JU9A 3RRDA 1DQ4A 4BM8A 4KEJA 4LBKA 3RG0A 4FPJA 2K43A 1EV2A 1DQ0A 3L2YA 3UJ0A 3C2UA 1Q8PA 3AZXA 3AJ5A 3LSDA 3BB2A 1AXMA 2CWMA 4ISRA 2R1DA 1NLSA 1OQLB 1LEDA 1P63A 2Z48A 3NV4A 4ZFWB 3UDAA 2W68A 1PC8B 4I37A 4LO8B 4GWMA 4Y22B 5CAZA 2ZHLA 3N7LA 3AP4A 1Q1UA 4GXLA 1BFCA 3ZXKA 5GZGA 2X2SA 2P2KA 2DURA 2A3XA 2ZGNA 3N7MA 1QMJA 1DQ1A 4I1EA 3MW2A 3MPPG 4AVTA 1V6MA 1ULGA 1ULFA 2SBAA 3OBTA 3MEPA 1G9CA 3BX1C 3NBCA 3RMYA 2GMMA 3M3CA 3IIRA 1S0LA 3AZWA 3OGFA 4GWNA 2PHUA 2R9KB 1CIWA 4J23B 4YZ5A 4C1WA 1UL9A 3IKWA 3LCPA 2GN3A 2F2FA 4JAWA 1AVAC 1ZM1A 4ZGRB 3W59A 4OWJA 2DVAA 3LSEA 3TAYA 2WRYA 1UN1A 1CPNA 3NV2A 4L4HA 1LU2A 3CQAA 3AP9A 5IK4A 1LOFA 3ZXJA 2YMZA 2VW1A 3INAA 3WDUA 1AF9A 2EXKA 4CZSA 1HLCA 2ZHNA 4RL7A 3BOPA 1W3GA 3VKFC 3OGGA 4XMIA 2D23A 3B9UA 4PQ9A 1V6WA 5EWSA 3E8LC 2WT2A 2ZGMA 1QQKA 4M01A 4F83A 1DYKA 4CRQA 3ZXLA 2ZMNA 3BODA 1CONA 3FJBA 1VIWB 2DYCA 1WUVA 3M3QA 2D1ZA 4LO2A 3WOGA 2ZGRA 1WBAA 2YY1A 3UK9A 4I4UA 1Q04A 5GJ6A 1QNYA 1QOOA 3AZYA 2QYIB 5BXPA 3WCRA 1N1SA 2KH2A 2E51A 3FLRA 3MW3A 4WZFA 4J2XA 2A6XA 3WO4A 4R9CA 1G9DA 2C9AA 2D7FA 3RTIB 2HYKA 3ZC8A 4Q27A 2IWTB 3HOMA 3WLUA 1GSLA 1AXZA 5I1BA 5D61A 5DG2A 1UZZA 2WT0A 4W65A 3WUDA 1PZ7A 4AGGA 4I6IA 2Z49A 4ZFYB 4DFSA 1MACA 2PELA 2I1BA 4JKQA 4LO3A 1G8WA 2W39A 4XIKA 1BASA 3A22A 4QBVA 3O12A 1MR5A 5SV8A 1W6OB 2WLQA 3SH5A 2VSEA 1VCLA 3BAQA 1V00A 3AYDA 2ZAAA 2D3PA 3WDYA 4I2SA 2P34A 2NMOA 5T5JA 1V6JA 2JECA 4G9MA 1AX0A 1LHUA 1R8OA 5GZDA 5DUUA 3SH3A 4XJ8A 3IM0A 1JLXA 4SLIA 4Y26A 1QGLA 1K5UA 4OWLA 2Z42A 5HCAA 5DZGA 1FWUA 1F5FA 1GKBA 4YZ4A 2ZGSA 4YG0A 1J1TA 4M3CB 2VUAA 4GKYA 4ZLBB 2A3WA 4QO3A 4JC1A 1JT3A 1S0BA 5JDBA 4YFZA 3OY8A 1BFGA 2DUOA 2A6WA 4XTPA 2NM1A 1QOTA 3AKFA 3UD9A 5FZUA 2ENRA 2BEBA 3O0VA 1O4ZA 4Q26A 3FJFA 2ES3A 4D0TA 5F90A 1TOOA 2NVHA 1V6OA 2GMEA 2CY6A 1GYKA 1AVWB 1V6XA 4YZ3A 5EYYA 4FQZA 3JUUA 2ZZJA 5GZEA 3BTAA 4I0YA 3B9CA 1QF3A 3ENRA 2EXIA 4LO2C 4G9NA 4G6MA 5E88A 4QKRA 1GZWB 1FMMS 1UKGA 5HCBA 4U36A 5GM0A 1FYUA 1A3KA 2NZ9A 2W08A 5IK5A 2K4AB 2ZA9A 2DS0A 1MS5A 3N0KA 3M1HA 1DQ2A 5JMCA 2KM2A 3WA1A 2R49A 3P6JA 4I4SA 1WD4A 2DVGA 4HJJA 5BXRA 2DUPA 2P39A 3PJQA 3FUOA 2FFVA 1V6KA 3B01A 1SCSA 3HMYA 5F8SA 1ABRB 2Q9XA 2E6VA 1PZZA 1MZ5A 3A0NA 2DVDA 5H9PA 1G86A 2ESUA 3N7KA 1LECA 1DBNA 5EYXA 3V64A 3IAGC 3QLQA 1HQWA 2Y9WC 1RMLA 5T5PA 3D6EA 4LBQB 4EFRA 4QALA 2NYYA 2A71A 1KDMA 1Q8VA 2E53A 1ISWA 1AXYA 2D6NA 3FJJA 4H55A 4JKXB 4XZPA 3LTQA 2ZQOA 2D7IA 1RINA 3CA3A 1MZ6A 1JTCA 1NZKA 1YTOA 3CU1B 3BA5A 4NOTA 1IS5A 1W6PA 4DCKC 4Y1UA 3F1RA 1CPMA 4ZXKA 3WNXA 1JLYA 1H9PA 4M00A 4XJAA 4CJMA 1YBIA 1IS6A 1BLAA 2A6ZA 1HWOB 2UWBA 3IM7A 4FPEA 1H30A 4LO0C 4XTMA 3FBYA 4DQAA 5H9SA 2YV8A 3AXEA 1JY0A 3M3OA 2OUJA 4KC3A 4YGDA 2OUHA 1LENA 1ZA4A 1O4YA 1WLWA 1ISXA 1CQ9A 5JOXA 2JD4A 4I4PA 1GLHA 4Z8SB 5GLVA 3U4XA 2VXTI 1W6NB 1VLNA 3AKIA 3ZSLA 1WW5A 4LBJA 2DV9A 1ULCA 3SITA 2D3SA 5GLUA 5D62A 1XYFA 3CNAA 1NUNA 3VKMA 4FPCA 2MIBA 2CTVA 3H6QA 4ZA3B 2ARXA 2EF6A 3ZC9A 1BYHA 2E7QA 1YIFA 5T50A 2FO1A 2GNTA 4DEPA 1R1ZA 2DUQA 4IHZA 2D6PA 1TEIA 1JW6A 2F8XC 2YZ4A 2XB6C 4GA9A 3D5OA 4GALA 2D7RA 3O5SA 1LJ7A 2KI6B 2ZGPA 1DFQA 2HW9A 2DREA 4EFPA 1LEMA 1APNA 1SCRA 3POKA 1NXD1 4KEKA 3ZYPA 4FP2A 4BOWA 4MYEA 3WUCA 4XFTA 1TWMA 4XBLA 1UAIA 4FOVA 4YGEA 5DUVA 1HKNA 1UMZA 4FPOB 4YG3A 4JRAA 4DRVA 1KNMA 3FJKA 3AP6A 1YI7A 2D44A 2ZGQA 3ZSJA 2AENA 5IK7A 1MD6A 4YW4A 4BMEA 1DZQA 2AGSA 1CN1A 4XFUA 1D0HA 4Q8LA 1HCEA 7I1BA 4IZXA 3ILRA 3RSJA 4I8MA 2MC2A 2A3YA 3UJ4A 4BLIA 2YROA 4F34A 3BRDA 1ISVA 3SNVA 1LGNA 3WG1A 2ZABA 1W6QB 1HQLA 3A21A 2WSUA 1AZDA 2ZMKA 4Q9PA 4GKXA 4UW5A 3DUIA 2ZHKA 1S0CA 1W6MB 3CA6A 1IRPA 1G9AA 4HR6C 3RMXA 4R9AA 3ZXGA 5GAQA 2ERFA 2PHFA 5CNAA 3AJ6A 3R4SA 2ZKNA 1SBDA 2DWRA 4LBQA 4ATFA 5CB7A 2X2TA 3FLTA 2R1BA 4WV8A 2GNMA 4ZBVB 3OJBA 2XOAA 4A7ZA 4AN6A 4P0LA 4AGVA 4OEGA 5BYNA 2RHPA 5GLWA 4H9WA 3PVOA 4YW3A 1V6IA 2G4IA 3V65A 3PVNA 2ZHMA 3H6SE 3AH1A 3FLPA 5H9RA 5JVVA 2GDFA 3IPVB 1LOEA 3VKOA 1XQNA 2QN4A 4I4QA 3OPZA 5T54A 3PHZA 2WNEA 3GNEA 1SLAA 1QXMA 4PBPA 1OFSA 1EPWA 4JCKA 1W3FA 1TTUA 1FMZA 5G00A 1LCLA 3WV6A 2VLCA 4M3CE 1N4KA 5F8WA 2DU1A 2HZ9A 3C9ZA 1II4A 2BFHA 5HPZA 1W6NA 2AR6A 1LOCA 1AVUA 4I4YA 4LO0A 2HWAA 4LO7B 5GZFA 3O49A 4LO7C 2IHOA 4R6UB 3ZYRA 5GZCA 3VSFA 1GZ9A 3H6RA 1I1EA 1UZYA 3N36A 4XHBA 1G82A 1N3PA 1J0SA 3ZPYA 3B69A 1SFYA 1ULEA 2DTWA 3UD8A 1Q56A 3W9TA 4YM1A 1DLLA 3VSZA 41BIA 1Q8OA 4XILA 1EVTA 5GALA 1DHKB 4J2YA 4D8HA 5T5OA 2CL2A 1WD3A 4XDQA 3JUTA 3VT1A 1SLCA 2ZGTA 5HCFA 4Y22A 2UU8A 1DQOA 1JN2P 5F5QA 4JQ0A 3AYCA 5BQUC 4Y1VA 2GZBA 4LO1C 3WDTA 4LO1A 1H9WA 5IUQA 4XJWA 3UJQA 3D4KA 2WKKA 5EXOA 4H04A 4L4IA 5E8AA 3IM5A 1C4RA 1A78A 2R16A 1AX2A 2HWMA 1N47A 2F2FC 1QKQA 3PVEA 3PMEA 2Y9GA 1GV9A 4G6JA 1YO8A 1BQPA 2A5ZA 3V0BA 4JPZA 1PZ8A 4A7YA 4P9XA 5BP5C 3RS6A 4P9YA 3BAOA 3GALA 3AH4A 1KJRA 1DQGA 4FOYA 4EEEB 5GLTA 5BQUA 1EYLA 3OJMA 3SH4A 1V6LA 2VXRA 3O4BA 3SLIA 3WHUA 1WBCA 4FPLA 4P9WA 1JT7A 1XHBA 2GN7A 3AYEA 2OW4A 1E0OA 4YM0A 2AH2A 1G7YA 1VAVA 1SLIA 1LESA 3BRFA 4J2SA 3NJ5A 2VY0A 2C5DA 3AJZA 2SLIA 3ZXFA 1VALA 4USPA 5FREA 3QYDA 2ZBJA 4YGBA 1AXKA 3NBDA 3O0XA 3VV1A 1MS0A 3WHTA 1BZWA 4GOVA 3Q7XA 1LTEA 1FWVA 1LOAA 1MS9A 2KLLA 1ISZA 1N3OA 5DUWA 3N7JA 2JKBA 2AXMA 4I4RA 3D7WB 3EF2A 1DQ5A 3I8TA 3OY8B 1AVXB 5BXTA 5BXSA 4I3NA 5DUXA 1BLDA 4X38A 4I7IA 1Z2VA 3CRGA 3LLPA 4J2KA 4KBBA 1LHNA 1LOFC 3MW4A 3N3HA 1SR4C 4R9DA 1U0AA 1OKQA 4LBMA 4Q1RA 4AWDA 1WW7A 2LTNA 1TIEA 1KDKA 6I1BA 4PC4A 2ZGOA 1IKQA 3AJYA 3O0WA 3UD7A 1C1FA 5T55A 1W3AA 2GNDA 3BRGC 4YW2A 3BADA 2P3KA 4IYBA 3BA7A 1C57A 1W6PB 1FGAA 4P6AA 1AJKA 2W52A 3WO3A 2ZGUA 4Y20A 4G1RA 1SBEA 1YF8B 4FPGA 3NWKA 4XXPA 4FOWA 2PHTA 1RG8A 4Q2FA 1TWEA 1W0PA 2YXSA 1MS4A 3DGTA 2VW0A 1KITA 2FDBM 4YFWA 3I4IA 2RQ9A 5F8YA 2P3IA 5F9TA 3TC2A 3POYA 1W6MA 5DUYA 4K21A 1DYPA 3FJ9A 3O4CA 3QR5A 2B7YA 2XG3A 1M16A 2ERMA 3BAHA 1ONAA 1TP0A 1LOGA 3Q9OA 3ZSMA 1V6VA 1FV2A 3I2AA 5JLVA 4XIOA 1IT0A 3V0AB 1LU1A 5EG6C 4YW5A 1ENQA 4Y20B 1DZDA 2R0HA 1FNZA 2DVBA 3KM5A 4QBCA 1SACA 2JE9A 4K1ZA 4Y24A 1F9KA 4CTEA 2A75A 3ILAA 4GP0A 3VKLA 1S0GA 4XKIA 3JRRA 1PZ9A 1T9FA 1Z0HA 2J3PA 3O5WB 4XFSA 4P14A 2OVUA 2D20A 3H0OA 1L2HA 5FNWA 3ASIA 3CA1A 3BAGA 2TEPA 3FJ8A 3V0AA 3FJCA 1LHOA 4OW4A 1FV3A 3FJHA 2Y9XE 2AAIB 1IS4A 1QOSA 2CWSA 1BFBA 1WBFA 4ATEA 1HKDA 2UWAA 4GAFA 4AVSA 1ENRA 1KQRA 1N3QA 1YYNA 3O4AA 4I4VA 3IMNA 4Y1XA 1LULA 5D63A 3WDXA 1IILA 4P0JA 4USOA 3AKGA 4LBQD 1WLCA 4EKXB 4AYUA 4X39A 3PUBA 4Z9WB 2KKIA 2M49A 1N1YA 2Q3NB 1IJTA 5JOZA 3VT0A 3FJDA 4YGCA 5BP5A 1S0FA 2DTYA 4QD2B 4XJUA 3CA0A 3ZX7A 2D22A 2JJ6A 5KXDA 3TB0A 2CNAA 1YRZA 5CBLA 5FZZA 3CRHA 3WDWA 1ONKB 1CVSA 3FJIA 2EXJA 2H0BA 4P0KA 3ATGA 3BA4A 2D3RA 4WVVA 3UJOA 5DVHA 1M2TB 5KXEA 1HCDA 2NN8A 4ENDA 2ZGKA 3B00A 5DG1A 3AFKA 2AREA 4KEIA 1Z78A 1XG6A 3A23A 3WINC 4XE9A 3I29B 4OEFA 2L5XA 4YLZA 4FGFA 3OBRA 4ISQA 2WSVA 1JQZA 4XBQA 1SR4A 1I3HA 5FRAA 3RQ0A 2FMDA 4FPYA 1QQLA 4XMAA 3WG3A 1JT5A 4D69A 31BIA 2ZGLA 3HALA 3NBNA 4Q1PA 4EFQA 3APBA 2NP0A 4U2AA 1MC9A 1W6OA 4DS0A 2DRZA 3P53A 4TYSA 4ASMB 4TLPA 4XOGA 2NTDA 4D0ZA 2AQZA 1BKZA 3OJVA 3T1LA 1S0EA 3A07A 2A70A 3CA5A 3T8SA 3USUA 5BOWA 1LHVA 2ET2A 4HA2A 3H6RB 2P23A 3ZXDA 3O44A 1AJOA 2D6LX 4FQ4A 1DIWA 1FQ9A 4YOLA 1KJLA 1DZCA 2P37A 4DRRA 1LOBA 5B2HA 2Q5TA 2VW2A 5FNXA 2EAKA 4AVVA 3FGMA 4XJZA 1OQ1A 1K5VA 1FATA 2PHXA 4FPKA 3AZZA 1GZWA 1MS1A 1BARA 1DJSB 1UX6A 2D6MA 3ZXEA 5FZYA 1S0JA 1SBFA 1GZCA 4AN7B 1Q8QA 4YM3A 1BFFA 1Y7BA 4OEEA 1IS3A 4XJ9A 2D6KA 2FGFA 1WBLA 4PF5A 3IN9A 1QU0A 3NV1A 4EB2B 4OWKA 1RZOB 4UW6A 5DZEA 2PHWA 3NBEA 2DVFA 2DRYA 1WW6A 1HIBA 1WW4A 4BPZA 1N1VA 4LO3C 1FN0A 1N1TA 3ILNA 4I1BA 3AZVA 4BMBA 3RTJB 4UW4A 4OUJA 1DGLA 2UWCA 3R4UA 4L8QA 3W58A 1HWMB 3WG4A 4UW3A 4YZ2A 9ILBA 3POSA 4IY9A 2I2SA 3WCSA 1IRAX 4QD2C 3AP5A 5CA6A 5E24E 3B3QE 4QC4A 1CVNA 3FJAA 1AFCA 2K8RA 4ITCA 2WBCA 1JXNA 5DSSB 5EHAA 3NV3A 2VU9A 4IY8A 3WINA 4Q9GA 1CE7B 3BIWE 3T1MA 2PHRA 2D24A 1MVEA 2GMPA 1SZ6B 4M3CF 2EALA 1URXA 1TFMB 4XBNA 1CJPA 4HL0A 1RY7A 2JDZA 4GAIA 3WMUA 1KRIA 3CAHA 1FAYA 2DU0A 2LIQA 3USUB 1MS8A 5H9QA 1ULDA 3ZSKA 1ISYA 1W6QA 3VEQA 3CRIA 5DZFA 2P3JA 4GP3A 1QDOA 2ZACA 1V6NA 2A7AA 2D43A 4FOQA 1SLTA 3R05A 1LODA 4LBOA 1LHWA 4YZ1A 1X50A 4IONA 3WO2A 4WBCA 2EIGA 2LALA 4YM2A 4LBNA 3V79C 1AVBA 4XHXA 1BJQA 3HN1A 2AFGA 1HDKA 4M3CA 4I96A 3ILFA 5BVPI 4K1YA 1WCSA 5L73A 1JBCA 4II0A 2V73A 3HR9A 2ZMLA 1BXHA 2ZR1B 1YXWA 1GICA 2LIEA 2WQZC 3K1XA 3VWCA 3O4OA 2NMNA 4AGRA 2UURA 4IQPA 2KI4A 1ENSA 1SLBA 1IOAA 5E89A 1IOBA 1PWAA 1C1LA 3ZVXA 2ARBA 1LGBA 3M2MA 1FX5A 2GNBA 1V6UA 2VSAA 1AX1A 1CESA 4IZEA 3CA4A 4FVVA 1Q03A 3FUQA 3UL2A
chains in the Genus database with same CATH superfamily
2VNGA 3CHXA 4KMQA 3O4DA 3S30A 4OYUA 5B4XA 2FBEA 1WCKA 1YUDA 2QQKA 4Q0PA 3WZ1A 1F8VA 1RUI3 1BA7A 2ADDA 1CAXB 4I3GA 5BUVA 3IM6A 3AKHA 5FCCA 2LROA 3J9SA 4KQ7A 3SNMA 1OSGA 2GALA 5FZKA 4P9LA 4KWJA 1D2SA 1ND2C 2XUEA 3O3QA 3NNJA 4YG6A 1RUC3 4CEYA 4KU7A 5C8CA 2FFUA 5A3MA 2YC0A 1CD3G 3H50A 5F6LB 2WJSA 3AKTA 4HSJA 3WMVA 1W8FA 1EV11 1F31A 3NKGA 4BQ1A 3PG0A 8I1BA 3DPRC 1TNRA 3F62B 1A8DA 4Q8KA 3HBWA 1SDDB 4LQRA 1QDCA 2AEZA 1JZ7A 2QTWB 4I30A 1O3SA 4CA9A 3BAVA 4ZOTA 5ACA1 1B09A 2O8OA 2CYFA 3H9AA 3KT1A 4D6SA 2CSGA 4Z8BA 2YUGA 1RIRA 1UPSA 4J25A 3RJ2X 4DENA 2XJPA 4QU2A 4EQVA 3WNNA 5EC5A 3ZIWA 1ZBE3 4RGKA 5DAXA 2RM22 1C8M2 2OQ6A 3UYJA 3ACGA 4W6WA 3S8KA 4RGGA 5FPVA 1EP0A 1YFWA 3SISA 2WR9A 4TN7A 4CPBD 1ILR1 1HWNB 3VZMA 1W3XA 3WP5A 1B35C 1GP5A 1GQGA 3NNLA 4XFHA 1GNHA 1GANA 1MVQA 5C9AB 2EXHA 2TNFA 4PCRA 5FKBA 3RYPA 4FFIA 5FP7A 2CDOA 2FHRA 4NO4A 2AC1A 1OPOA 2HEYF 1JYCA 2E4MA 2Y6FA 2D6OX 2RS53 3GYDA 4BCUA 5FO8B 5KXCA 4FAGA 3WG2A 1W99A 4DUXA 1RGSA 4OZXA 4R9BA 4XYXA 5FPLA 5A7PA 2MLLB 4N53C 2JE7A 3S8JA 2R0FA 4A7KA 3IMMA 1ITBA 5FXXA 4QQOA 5F5IA 1NZCA 3N35A 3T2TA 4CCOA 4GZ9A 5C3PA 1ST8A 3W5NA 2PQQA 2QZ3A 4HPKB 4O9GA 1MEC3 1ZZ9A 3WNLA 4W6XA 4B29A 2AYHA 5JUVA 2QQJA 2WA4A 1W9FA 4LBLA 4AFCA 3Q7WA 3VBHB 5JOWA 3VBHA 4LK6A 1SFNA 2XVKA 2VH9A 4Q91A 1JZ5A 1S0DA 1SLLA 1LGCA 3H3UA 3K77A 4RR3C 1GWMA 5BNNC 1JS9A 3KHCA 3BTYA 2ZQNA 5JMOA 2HWB1 4LHKA 2O1QA 4QX7A 4WVWA 3E1F1 1H2MA 3UGFA 4TZDA 3K4ZA 3ZN6B 2D98A 4ZY9A 4FP3A 1TE1B 5JPMB 1W0OA 1GUIA 2E63A 2VG9A 4PIXA 2VMGA 3KQRA 1QWRA 1WCQA 1COV2 3FFZA 1C8M3 1EAH2 1S2EA 1VBE2 5A3PA 5AVPA 1RITA 1GNZA 2HWE1 3I2OA 3I3EA 4GB32 4Y1ZA 1DQ6A 4ZONA 4YVWA 4I4XA 1GBGA 4HK8A 5FK8A 3V0BB 4P00B 1A34A 3OJ2A 3AH2A 3T0BA 1QNWA 3UKNA 1HW5A 3J26N 3WDVA 2JDYA 4OHZA 3RPQA 3OYWB 4EYUA 1FNYA 2Z4FA 1T4QA 3Q7YA 4S2DA 3VT2A 1K5JA 4BDVB 5DDJ1 1NZIA 4I4OA 1YCIA 1JHNA 3AYAA 3CJIB 3ZR6A 1J83A 2YG0A 3OUJA 4YW1A 1IKPA 1UU5A 4N90A 1TZOA 2RSTA 5GLZA 3MF9A 3BAUA 4IE0A 1G9FA 1XC6A 1AR81 1WLDA 4ZHNA 2Y0OA 1AR61 1PO13 4XURA 4BB3A 5CFCB 1DFCA 3CBNA 1RHI3 4QPIA 4C1XA 4N43A 2A6VA 3MICA 3C7HA 1Q8SA 4DZGA 3KMVA 3OD4A 2VZQA 4FPHA 4LIVA 3FJEA 5IVFA 4QKSA 4DPNA 5FP8A 3GBGA 4JP0A 1BCXA 5FBJA 3T3YA 1RUF1 4HANA 3AX4A 4ZFWB 1JZ2A 4GOYA 2GZWA 3LOIA 2J1AA 2HH9A 3HSMA 5ABJB 5I0UA 4MO3M 3DYMA 1UZVA 3W5MA 5E16A 1HXS3 4DXZA 4R4XA 4SBVA 3TOJA 1VAMA 5FUPA 3J7MA 4FPFA 5CG8A 1NA1C 3C7GA 1R8NA 2MEV1 3AK0A 1QJY3 4KH9A 2UUSA 5B2GB 5DXDA 1K45A 5T5LA 4HFSA 4XFBA 4BLJA 1OA3A 1OUSA 1HN0A 1L3JA 2LS6A 3AP7A 4AW7A 4FAHA 1PUUB 2Y9FA 1ASJ1 3WP4A 1HWPB 1V9U3 2V5YA 4AEDA 3MALA 1J3QA 2W1WA 2I07B 3I59B 1JT4A 5LK5A 2F17A 3AKRA 4BYYA 1CR7A 3IPVA 3MUZ1 4BJ0A 1B35A 1ZRIA 3POWA 4E4SA 1O59A 5AVAA 2WT1A 2R072 3U10A 5KXBA 21BIA 2VZPA 4ZFUB 1NUKA 1OHFA 4K20A 3Q8AA 3RJRA 2EVXA 3VKNA 3I2XA 3A0KA 1JUIA 4EN6B 4L11A 1S0IA 2E4MC 4OI4A 2D5HA 2A6YA 1DF0A 4ZS3A 1VRH1 2HWD3 5ANNA 5A7QA 3JBG3 5IK8A 1UY4A 3DN7A 1S1AA 1G9BA 5SV5A 4EWDA 1PVC1 1XNKA 4N53A 4PI0A 5IT6A 3SMHA 1KD7A 3O1UA 4X3AA 3ECQA 4A3XA 2E7TA 4CYDA 5L36A 3TWIA 1Z4SA 5JOYA 3VUOA 2IVIB 3M8LA 1LKNA 2CGOA 1GGPB 3VHOA 5DZUA 1QJX3 1OOPC 2JEMA 2Y34A 4Y1YA 1CAWA 5F32A 3QCWA 1OQDA 3M3EA 3VBUA 3P6IA 4PBOA 3VDDC 2BEAA 3OYWA 4XXAA 1W3VA 2PA7A 4DIQA 4DINB 2BQPA 1AL0G 1XZZA 2RG9B 1ZVFA 1PUMB 3K3OA 1PMHX 3I3MA 1P8JA 5T52A 3AXDA 1MS3A 5C4WC 3I2FA 2JIJA 1GQPA 2AUYA 3A4UA 4RA0A 4ZKTB 1HRI1 3LWCA 4L9BA 2RV9A 1I1BA 3RWKX 1JOJA 3RI9A 3WVJA 1IHKA 1XBFA 5TSWA 5FY9A 4X37A 2WDBA 3JU9A 1R092 1DQ4A 3N9QA 1QJEA 3RRDA 4BM8A 2C24A 4KEJA 4LBKA 2J22A 4PF1A 3C7FA 3RG0A 4ZPIA 4WVMA 4FPJA 1HRI2 3RGBA 4AEDC 1KEXA 4NHXA 5J09A 3FMGA 2UY9A 4R8HA 1AL23 2K43A 4CSWA 5F8PA 1QEXA 1EV2A 1DQ0A 3L2YA 3GBFA 4Q0SA 1WLTA 2OX0A 3DCQA 1JYVA 3UJ0A 5IAVA 1AYN3 3C2UA 1Q8PA 1J1LA 1BBT1 2VVDA 1C8M1 1OD5A 4NUBA 1XSQA 1EV13 3AZXA 5A70A 3HNMA 4XUOA 2HWE3 3KV6A 4PDWB 3USSA 4NHLA 4CEYB 4ET7A 1REFA 2VZSA 3LSDA 4IE6A 2JIGA 5C8CB 1AXMA 3AJ5A 2CWMA 3BB2A 4ISRA 2R1DA 4MGSA 1NLSA 5D8AA 2QQUA 3VDBA 4IV3A 4AFBA 1OQLB 1LEDA 4OMDA 1P63A 2Z48A 2H6CA 3NV4A 3JD71 2JX9A 2J1TA 1K5MB 1TME2 2JB4A 2HWC1 2W68A 4URTA 3U0ZA 1PC8B 4GMP1 2BOIA 4I37A 4LO8B 2V4AA 4GWMA 2WA3A 2OS2A 4Y22B 2ETEA 5CAZA 2ZHLA 1OQEA 2E31A 2R7EB 4HG6B 3N7LA 3AP4A 4J6GA 4QX8A 3GHNA 1Q1UA 4GXLA 4N9HA 1RUJ2 2VL4A 1NOVA 2VVEA 2BWAA 2VULA 3OUIA 2RDNA 1BFCA 3ZXKA 4KGGA 4FFGA 1IPJA 3MV11 4Q4X2 4XPVA 4YVSB 5GZGA 1NX9A 2WNVA 3Q8BA 2X2SA 3RYKA 2P2KA 2DURA 5G04L 2A3XA 2ZGNA 4LK7A 1POV3 3N7MA 1QMJA 4CU8A 4B4RA 4JGYA 3ZYGA 2E32A 3EMRA 4S2GA 3CU7A 4M4RA 1DQ1A 3TRSB 4I1EA 3MW2A 3MPPG 4LXLA 1V6MA 4AVTA 4BU2A 1ULGA 4WM8A 3OBAA 5C3RA 1C28A 1O4TA 1ULFA 2SBAA 3OBTA 1FMD2 3MEPA 3THDA 3U78A 3PUAA 1G9CA 2PAKA 3BX1C 4AHYA 3NBCA 1XXNA 5FZ7A 5AFBA 1PK6B 2QQPA 2D22A 1I9RA 3RMYA 2GMMA 3M3CA 3EJKA 4QB2A 3IIRA 2D40A 4XDPA 4OHVA 4JDNA 1S0LA 3HWJA 4AQTA 1TMF1 2BNOA 4TTGA 2JICA 3LEGA 2OPWA 3UNPA 4OLLA 2ZZQA 2Z69A 1CAVB 1I5ZA 3VBOC 3AZWA 3BI3A 3LDBA 3OGFA 4GWNA 3PIGA 2PHUA 2EIDA 1DGRN 4QGLA 1CIWA 2R9KB 4J23B 1U5YA 4YZ5A 4AI2A 5LRRA 3ETQA 2ZX1A 4C1WA 2EICA 5FIXA 1UL9A 3IKWA 2FDHA 4XAAA 3DL3A 1MQTA 1JOPA 4QDRA 3LCPA 2GN3A 4BH9A 2RR13 1BK1A 2F2FA 4DB5A 4JAWA 1CAXA 2Q1ZB 2NLRA 3F95A 3J7HA 4IUGA 4PLMA 1AVAC 1ZM1A 4QXHA 4ZGRB 4AQ6A 3W59A 3H8OA 2CV6A 1W8ZA 3CF6E 4TLFA 5HXVA 4AZZA 2JDNA 4A3ZA 3BCWA 4XDOA 1V9U2 1AR63 3G7DA 2WZ8A 3M4FA 3ZFGB 1RHI1 4OWJA 5I0TA 4CDWB 2VVFA 1PO11 5F2WA 2DVAA 3LSEA 3TAYA 2WRYA 4PT6A 3E97A 4DNYA 1NY71 2MEV2 4CP9B 3OGSA 4P02B 3Q8EA 2VZOA 4JHTA 4RS5A 1UN1A 5LWBA 1CPNA 3NV2A 2ZJCA 2Q30A 4JZRA 4K40A 2DFBA 1LU2A 2WN3A 3SHRA 4L4HA 3CQAA 2VZTA 3S57A 4QPWA 2LW8A 2HYXA 5FJHA 3AP9A 4AHWA 5IK4A 1LOFA 1VBD2 1DYOA 2WNVB 2YMZA 3ZXJA 3OG2A 5C5UA 2VW1A 5LY1A 3RYRA 1H2KA 2XBO3 3INAA 3WDUA 1AF9A 4COWA 1VBB1 4JQTA 2EXKA 1GP6A 4CZSA 1GQHA 1HLCA 2IVJA 3AL5A 2ZHNA 1EV12 5LA0A 3N4MA 4RL7A 2B5HA 4IW3A 5FXZA 3BOPA 3VBOB 1W3GA 2VCAA 3VKFC 3O1SA 3OGGA 4JTNA 2WZR1 4XMIA 1X9PA 5HI0A 5BNNA 1JYWA 2D23A 4UBHA 3B9UA 2W9XA 4PQ9A 3UGHA 1QXJA 3KB5A 1BBT3 3F2ZA 5ISLA 1YIPA 1V6WA 4YVWB 2XMLA 2VTXJ 5EWSA 4META 3S7EA 4AHZA 5KHKA 3E8LC 4DXSA 1NE6A 2BVBA 2WT2A 1KS4A 2ZGMA 2OT7A 5C8WA 3P1IA 1LAJA 1QQKA 2QBXA 1GOFA 3KCYA 4M01A 1PK6C 1W90A 1L7QA 2HWF1 5I93A 4F83A 3CKHA 2HWD1 1DYKA 4CRQA 5FYHA 2WUHA 2HWC3 5A32B 4A42A 3ZXLA 3I59A 2ZMNA 3BODA 1CONA 2XQRA 3MFAA 4COVA 3JQWA 3FJBA 1E5IA 1VIWB 5IVYA 2DYCA 5CEHA 5DSSB 1WUVA 4UAPA 3M3QA 1UOFA 1PO23 4WM8C 3ACHA 2D1ZA 3KV5A 4LO2A 3WOGA 2ZGRA 1E57A 5A33B 5IYYA 2BYVE 4NRPA 3MLJA 4RD7A 5JZGC 3ZMNA 2YY1A 1WBAA 3OOXA 3UK9A 4I4UA 3POEA 2BNNA 1Q04A 5GJ6A 1QNYA 1DP0A 3VBFC 1QOOA 3AZYA 2QYIB 2ORZA 5BXPA 3GGLA 3WCRA 1HRV2 4PDWC 4N7IA 4DOUA 1N1SA 2KH2A 4ASLA 3T09A 3NJZA 4X8PA 2WZPP 1POV1 1SDWA 1UXZA 4LKSA 2XONA 3ZKUA 2E51A 5FZGA 1H2LA 5HBAA 3FLRA 3MW3A 4DXTA 5CKMA 3QD6A 4MV2A 4WZFA 3IAQA 5FZAA 4J2XA 2A6XA 5FZLA 4AL9A 4R9CA 3Q8FA 2C9AA 3KT7A 2VZ1A 2D7FA 4D7TA 1G9DA 3RTIB 2HYKA 3GZUC 4PI2A 3LIHA 4Q27A 5G05L 2IWTB 3ZC8A 4WM7C 2HWE2 3C7EA 3T08A 4WM7A 4FXKB 1RUD2 5T3NA 3HOMA 5A6ZA 3WLUA 1D4M2 2ZEWA 4WBBA 4LPLA 3NAPB 3WX5A 2BUKA 1GSLA 4QQ2A 1TNFA 1AXZA 5I1BA 5D61A 2WNVC 5DG2A 3MLKA 1H0BA 1AYN1 1OXCA 1UZZA 2WT0A 3U11A 4E9KA 1YFXA 4HZFA 2A73B 4NN0A 3WP6A 4W65A 5C3QA 3NRUA 1RUD1 1JU4A 3WUDA 5DAWA 1PZ7A 4AGGA 4TSVA 4I6IA 2YU2A 2Z49A 4ZFYB 3C3VA 4DFSA 4YWAA 2Y26A 2FDIA 2FD8A 3PU8A 3THPA 1R1A1 2RDSA 1SFPA 1MACA 1KFXL 3MO4A 3QOPA 2PYTA 3BPSA 2PELA 1Y3TA 2I1BA 1O5LA 4JKQA 2GO2A 4CDWA 5K8SA 4LO3A 1UMHA 1RUH3 2AACA 1G8WA 2W39A 5FY8A 4AHXA 4KGQA 4XIKA 1BASA 3A22A 4QBVA 2J1EA 3GCXA 5F1RA 4OHWA 4GIQA 4CUBA 1MZFA 3AM2A 3TBDA 5FPZA 1PIV3 3TN92 3J8F2 5L7OA 4P5HA 4I4YA 3O12A 1MR5A 4YSFA 1GU3A 3OCPA 5FLHA 5SV8A 4CDXC 3O1PA 1W6OB 2WLQA 3SH5A 2JG8A 1I5PA 1RUI2 1NCRB 1VCLA 2VSEA 2P1BA 2WWUA 2EAAA 3BAQA 5CYYA 1V00A 3AYDA 1EY2A 2ZAAA 2XLAA 2D3PA 3WDYA 4I2SA 2P34A 2NMOA 5T5JA 4HK9A 4CDUB 3J8F1 4IERA 3I49A 1V6JA 3RZMA 4CU9A 1V0AA 4LUKA 2JECA 3K4DA 1AX0A 4W8JA 1O3QA 4G9MA 3HT2A 3KMHA 1AYM3 1LHUA 5CU1A 1R8OA 5GZDA 3POBA 4OUSA 4DUVA 5DUUA 1G6NA 2ZEZA 1QHDA 1CWPA 2K2SA 1DG6A 4JKKA 4DEQA 1PGW1 3SH3A 1VBB3 2XJQA 4XJ8A 3HQXA 5LCWL 1VBC1 3IM0A 4QKDA 1JLXA 2VMFA 2WAAA 4Y4YA 4E4HA 1F2NA 3P3PA 2BRTA 4SLIA 1QH6A 5LZ6A 4Y26A 1QGLA 1X8MA 2WN2A 1K5UA 4EN0A 2Z42A 1ZREA 4OWLA 1NXMA 4MHRA 5DZGA 5HCAA 1F5FA 4LTAA 1FWUA 2NPIA 1ZBA1 4HBNA 5EPAA 1GKBA 2BDRA 3N9NA 3T0DA 4BA6A 4LO8A 1H1MA 4XCBA 3LOBA 3RZZA 3PJYA 5F5AA 5F5CA 4YZ4A 3ZYJB 3O14A 5FUIA 5JIAA 2ZGSA 1IQDC 4YG0A 5F3CA 5I0DA 1J1TA 4M3CB 4QQPA 2VUAA 5B4NA 4GKYA 2WABA 1ZBA2 4PDWA 3WW1A 4CDWC 2A3WA 4NMIA 1NQJA 4ZLBB 2IZWA 3MBWA 2QQVA 1RUNA 4QO3A 4JC1A 5A6YA 3HNYM 1JT3A 1S0BA 2G19A 2WFF2 5FJKA 1TVGA 3IIIA 5JDBA 3MIHA 4YFZA 2RR11 3OY8A 1RUH2 2RJ2A 1BFGA 3JZVA 1WWYA 2I45A 1YC61 2DUOA 5IHRA 5J96B 2A6WA 5C5TA 4XTPA 2NM1A 1ZZBA 2HEWF 4E2GA 1AR93 4E8CA 5K0UC 4ONUA 1QOTA 1OVPA 2VMDA 3HNBM 2WS92 3AKFA 3UD9A 5FZUA 3POJA 3THCA 5ACA3 2ENRA 2BEBA 3KT4A 1UY3A 3O0VA 1O4ZA 2PLV2 2IXIA 4Q26A 4LO5B 5CADA 2BTVC 1FPN1 4MH0E 2ES3A 5A6QA 3FJFA 1UYPA 2RM21 5F90A 4D0TA 1TOOA 1VP6A 2NVHA 1V6OA 1O6UA 2GMEA 1SEFA 2CY6A 2FMYA 1GYKA 1Q5OA 1O3RA 3EQEA 1AVWB 1V6XA 4YZ3A 5EYYA 5F3GA 1UMIA 3DF0A 1D4M3 1XNAA 3GJBA 1X7NA 3I2HA 3JUUA 4FQZA 2ZZJA 3DXUA 4P08A 1YQ2A 4BQWA 5GZEA 1T6BX 2E9QA 2VOTA 5BNOA 3BTAA 3LD8A 3B9CA 1QF3A 3LE0A 4L2NA 3ENRA 4XUQA 4I0YA 2EXIA 4LO2C 4G9NA 2GAUA 4G6MA 5E88A 4JX0A 4CDQA 3E5XA 4QKRA 1E5SA 1GZWB 4Y4RA 3RZJA 1GR3A 1HJGA 2FZ1A 1FMMS 1UKGA 5HCBA 2VECA 2PQSA 3GF6A 4UWDA 1VRBA 1RUJ3 4U36A 1W39A 1MEC1 3WP3A 2WO1A 4Q0QA 3MFCA 5GM0A 1FYUA 3HQUA 1A3KA 1X82A 2F6BA 3ACLA 2NZ9A 3KF3A 2VBPA 3ZIXA 4BXSV 2W08A 4QGMA 5IK5A 3V56A 2K4AB 4H75A 1BEV3 2ADEA 2X29A 5FO7B 3TNQA 4BK4A 3SQOA 5I8YA 2DCZA 3OBZA 3TN93 2ZA9A 3HBZA 2DS0A 4J1WA 4AVBA 3HT1A 5IW0A 3VDDA 2BWCA 1MS5A 2JD9A 3N0KA 3M1HA 1DQ2A 5JMCA 1FI2A 1OMIA 1POQA 2A1XA 2KM2A 3LDRA 5FK7A 3H1WA 2VTXA 4FCAA 2R49A 3ZYIB 3WA1A 4NE9A 3ES1A 3P6JA 5JXHA 3MV01 5FV3A 1POV0 4I4SA 1WD4A 2DVGA 4HJJA 5BXRA 2QKDA 4RQPC 3VD3A 4EJRA 2DUPA 2W95A 2P39A 2RS32 3PJQA 1GOGA 5BXXA 3ZYFA 3FUOA 1NLQA 1BVP1 2K46A 1CX1A 2FFVA 1UU6A 4Y5SA 1V6KA 1S55A 3B01A 4CCCA 1SCSA 3HMYA 5F8SA 4LE4A 4IE4A 1ABRB 5FPBA 5FXVA 5KC5A 2Q9XA 4XFFA 2E6VA 3UL2A 1PZZA 2XKPA 1E5HA 1MZ5A 4JAAA 1VB2A 3N9LA 1AUYA 3A0NA 2RS11 5C6CA 2DVDA 5FZEA 5H9PA 1UZ0A 2YHJA 2BV4A 2W1SA 1W2NA 3EBRA 3LA2A 1G86A 4HSLA 3PMSA 5A6XA 2ESUA 3U07A 3N7KA 1DU3D 1GWKA 3EO6A 1LECA 1DBNA 1R1A2 4LE3A 5EYXA 2LM3A 4LHLA 4XQDA 3V64A 3WF0A 3IAGC 4LOSA 2PHDA 3QLQA 1HQWA 4JV4A 4NAMA 4ZU5A 2Y9WC 1QJZA 4O7XA 4HXCA 1RMLA 5FZ1A 5T5PA 2C6SA 1QJX2 1JH5A 3D6EA 4ARXA 4E2SA 1U5IA 4LBQB 3VZLA 4NAOA 4RN5A 4EFRA 4QALA 2NYYA 2A71A 1R1A3 4QAWA 1W05A 4RR3A 3WW3A 1KDMA 1Q8VA 1X9TA 2E53A 3THTA 1ISWA 1AXYA 2D6NA 3U4SA 1MPXA 3AKPA 3FJJA 4H55A 4F8AA 4JKXB 5J48A 3ZPOA 5HV0A 4S2HA 4XZPA 3LTQA 3KQ4B 1Z7S1 3IB3A 4B7EA 3O1OA 1H4GA 5FZ9A 3KWVA 2ZQOA 3IT8A 2D7IA 5F7UA 1RINA 3CA3A 1DCSA 2WNUA 3KGLA 1MZ6A 2XOMA 1JTCA 1RMU2 3L9JT 3ZFEC 5A7WA 2QQLA 3HPNA 3NQHA 4CCJA 1UYZA 2RJKA 1NZKA 3ZFEB 4YPJA 1YTOA 1H1IA 3CU1B 4XACA 3BA5A 4NOTA 3FZ3A 3ZSEA 5JZGA 5LRSA 1IS5A 1W6PA 4JRLA 4Y1UA 4QKFA 3F1RA 4DCKC 1CPMA 3GM8A 1FPN3 4ZXKA 3WNXA 4AEKA 1F5JA 1QJU2 1JLYA 1H9PA 5F3IA 3OUHA 4M00A 4UFJA 4XJAA 3WY6A 1YBIA 4CJMA 5EJ1B 4IGOA 1IS6A 5FYUA 3PLQA 5L9VA 2GP5A 3SKVA 1BLAA 2A6ZA 4A45A 1HWOB 2UWBA 2XH6A 5EFUA 3IM7A 4FTBA 2P6CA 3I3DA 4FPEA 1H30A 1HXS1 4QDSA 4LO0C 2W5FA 3K51A 4XTMA 1XNTA 1VBC3 3FBYA 2IXJA 4DQAA 2F4LA 5JSRA 5H9SA 2YV8A 3FBMA 1QH7A 4IEQA 3AVSA 4R52A 5DPNA 3AXEA 4NIDA 1TG7A 1ZBA3 3RVHA 1JY0A 5D1IA 2R30A 3M3OA 1R091 2OUJA 2Y6JA 3LFMA 3OPWA 1UOJA 4EROA 2XLFA 4KC3A 4YGDA 4HPKA 2OUHA 1LENA 5FMOS 1ZA4A 4AI9A 5JAXA 5KHIA 4ARYA 1O4YA 1MQTC 1WLWA 4FI9A 4QPGB 1ISXA 1CQ9A 1HJFA 5JOXA 3NO8A 2JD4A 3LEMA 4I4PA 1GLHA 4Z8SB 3M3IA 5GLVA 2Y64A 3U4XA 4DY5A 4KL1A 5BNPB 5FLIA 1W6NB 1DDLA 2VXTI 4COUA 2IC1A 1VLNA 3VZOA 5KR7A 3J4UH 3ZSLA 5BNPC 2DBIA 3AKIA 3IDCB 4MLOA 4NROA 4ZU4A 1WW5A 3NJYA 4LBJA 2DV9A 2P17A 1ULCA 3CLPA 1GFF2 4XABA 3SITA 2D3SA 2PAMA 3K48A 3KCCA 4K6BA 4OUMA 5GLUA 1ZRFA 2BPA2 3FHAA 3CNAA 1HB2A 1NUNA 1XYFA 5D62A 3VKMA 5L9BA 2ZCWA 5J7MA 2DF7A 4FPCA 2MIBA 2CTVA 5DAQA 3H6QA 4ZA3B 3D0JA 3LEKA 3D8CA 2ARXA 4YVSC 2EF6A 3MHZA 4BXFA 4QPGA 3ZC9A 3ZFGA 4QB6A 1A8MA 4CP0A 2ZX0A 3E5UA 1BYHA 5FYIA 5L7OB 1DGRA 4MGKE 3VD5A 2E7QA 1YIFA 5T50A 2FO1A 1ODMA 4J1XA 1ZYBA 3IIAA 4GMP3 4GWJA 1WZXA 2GNTA 4G4FA 4Y5Z0 4DEPA 1R1ZA 2DUQA 3UETA 4RFT0 1JODA 5F37A 4AQ2A 3P5BA 4IHZA 2D6PA 4DY3A 2CHHA 4R4ZA 1D4M1 4N43C 3J7LA 4HT1T 1MEC2 3M70A 4PHZA 4XFGA 1TEIA 3VBUC 4GWIA 2Y6HA 3LPGA 2MPFA 4IE5A 2XBO2 1JW6A 2F8XC 3OEAA 1Y9MA 2BFUL 4M4PA 3W20A 2O0OA 2YZ4A 2XB6C 4IEUA 1PX3A 3ZN4A 4GA9A 4KWUA 2XVLA 5L19A 3D5OA 4GALA 2D7RA 2DBNA 2JDKA 3KV4A 2B45X 2QUOA 3O5SA 5JWPA 3NL1A 1LJ7A 2KI6B 4MVTA 2ZGPA 4HMZA 4JDOA 4WVMB 4QU1A 2J1SA 1CZSA 1DZTA 1DFQA 2HW9A 1STMA 2CU5A 2DREA 4EFPA 3VD4A 1LEMA 1W06A 5CVRA 1APNA 1SCRA 1VBA3 2HBTA 3VGIA 5EHDA 3POKA 1NXD1 3UESA 5FZ3A 5FWJA 4A2UA 4KEKA 1AL21 3ZYPA 4FP2A 3U14A 3VL9A 3LZZA 1AR82 3B02A 3PHMA 4MYEA 3TN91 4BOWA 5M0TA 3ZDVA 4RFRB 5LA9A 3UV9A 2RS31 4MGQA 4PJYA 3WUCA 4UFKA 4XFTA 4M0HA 1TWMA 4XBLA 1UAIA 4JQRA 4FOVA 4JKMA 1IZ3A 3CZJA 4YGEA 4C91A 5KC6A 5DUVA 1Z7S3 1UMZA 3LIGA 1HKNA 4FPOB 4MSVA 4YG3A 1CAUA 4JRAA 3S6PA 4BQYA 4DRVA 4UXAA 1KNMA 1JZ6A 3FJKA 3AP6A 1YI7A 2D44A 3ACFA 1LNSA 2IXCA 4YYOA 5DN2A 3VD9A 3ZN5A 4RGAA 2ZGQA 3ZSJA 4HKOA 2AENA 5IK7A 1EUTA 5A7OA 2OKXA 3BN6A 1MD6A 4YW4A 5FPUA 4BMEA 1OOPA 4IV1B 1DZQA 1OI6A 2AGSA 1CN1A 1OURA 1O3TA 4COYA 4PIZA 2J1UA 3ETPA 4QXCA 1IG3A 5FKCA 3VDCA 3ZXAC 4XFUA 1YFYA 1RUE3 3AMQA 2B8MA 1D0HA 3H3ZA 4Q8LA 5A32A 1HCEA 7I1BA 5FZIA 3FE5A 4IZXA 3ILRA 2Q8CA 3PNAA 2VMEA 3LGRA 4I2OA 1K5MC 3RSJA 1SZBA 5K4LA 5DABA 5LEJA 4I8MA 2A3YA 2MC2A 3ZFFB 4QM8A 3RZKA 3UJ4A 4BLIA 2YROA 1OC1A 2WLPA 4EE2A 4F34A 3BRDA 2PN5A 1AR73 1ISVA 4Q4V2 4QDQA 5LBCA 3SNVA 1LGNA 4XF3A 3WG1A 4HLTA 2WYFA 1W6QB 2ZABA 4UOJA 3JXSA 1RMU3 5FYCA 3UGGA 3HD8B 5C7GA 1WGPA 3S5AA 1HQLA 3LA3A 3A21A 2H6BA 1SHWB 1OLMA 4I3PA 5JI7A 4AOCA 2WSUA 1AZDA 5JR7B 1EAH3 1VBE3 4Q4V1 1WKYA 2ZMKA 4Q9PA 3TYJA 4CCKA 4GKXA 4UW5A 3DUIA 2ZHKA 4Q0VA 1S0CA 1WMXA 1W6MB 2C0ZA 3M7AA 3CA6A 1IRPA 5ERLA 1G9AA 3RZGA 5IVJA 3ST7A 1NCQB 5ABJA 4HR6C 4CU6A 5E6HA 2YB7A 1NT0A 3RMXA 4O61A 2WZR3 3T30A 4QX3A 5IFPA 2WS91 3GCWA 4R9AA 3ZXGA 1L7RA 2J7MA 5GAQA 4X8NA 2ERFA 2PHFA 3WQ7A 5CNAA 2HJIA 5A1FA 5CFCA 3AJ6A 4MZHA 3R4SA 1W04A 3WNOA 2W2IA 4E4DX 3C7OA 4Y3OA 2ZKNA 3RI8A 1SBDA 3UKTA 2DWRA 4BIFA 4LBQA 4ATFA 5CB7A 4OHXA 3HBKA 5F3EA 4B3NA 2X2TA 3FLTA 3POGA 1K3IA 1YJKA 2R1BA 4WV8A 5FXWA 4FO9A 2GNMA 4ZBVB 3KVBA 3H3LA 3NMBA 3OJBA 3VZNA 1NG0A 2XOAA 3R4DB 4H2AA 4A7ZA 5LY2A 1RVF1 4AN6A 4P0LA 3JB4C 4NRMA 4AGVA 4C90A 2YGMA 4RQPA 4OEGA 3H8XA 2DCYA 1LB2A 4MADA 2OXBA 2QCSB 1IQAA 4WM8B 5BYNA 3E5QA 2RHPA 5GLWA 4H9WA 3L2HA 3PVOA 4YW3A 1GZTA 3B9IA 1V6IA 2G4IA 3V65A 3PVNA 2ZHMA 4LJHA 1REEA 4CDUA 4N7UA 2RJLA 4CDQC 3H6SE 3AH1A 3FLPA 2XDVA 5H9RA 4RS5B 4HVQA 1JZ4A 2FCVA 2QJVA 4YVSA 5JVVA 2FDGA 2GDFA 1UXXX 4CP9A 4IXLA 3SC7X 3IPVB 3QH6A 4GB31 3BPZA 1EUUA 1LOEA 2G9FA 5FY0A 2Y38A 2VOWA 4MUVA 3VKOA 1XQNA 4H7MA 3LFIA 1ZZ8A 2QN4A 4HOOA 3OPZA 5FYTA 1PM4A 4I4QA 4BQ3A 3WF2A 3R0RA 4LUMA 2YC2A 1RUG2 1RUE2 5T54A 1O7FA 2ET1A 4Q5OA 2R063 2Z79A 4XFIA 4QHBA 5LA2A 2GC1A 4AG4A 3PHZA 2VXJA 2WNEA 3SEEA 1UQXA 4WZCA 4NPMA 1NYWA 3GNEA 2XJUA 1SLAA 3RDIA 1QXMA 3VDDB 4PBPA 1SMVA 3ZO0B 4JHZA 1OFSA 1EPWA 1RUG1 2D97A 3EB7A 4LO6B 3DPRA 3MIEA 1YFUA 1PMIA 4COZA 5AC91 3IDAA 4RHV2 2IXLA 4JCKA 5JPNB 2N7GA 1UOGA 2ZX3A 1W3FA 1FMZA 1TTUA 4MGYE 1WMFA 2ZPXA 2VBBA 4XUTA 4IEYA 1LCLA 2V72A 2ZAHA 3WV6A 2XHNA 5G00A 1F4HA 2JDHA 2E7AA 2XR4A 2LUWA 1O8SA 4GAZA 2Z2SB 3ZFEA 2VQAA 4H3WA 4M3CE 2VLCA 4CU7A 1N4KA 2XGXA 1Q3EA 1W8OA 3CZUA 3LA7A 1UU4A 4KBZA 1D2QA 5J3UA 5F8WA 5JR2A 4Q4W3 2VZUA 5FZFA 4CEWC 2CGPA 4FXGB 2DU1A 4Q4W2 4OI0A 2HZ9A 4S2FA 1AR62 4CEWA 1CGPA 3BKZA 3C9ZA 1II4A 4GMP0 1OF4A 5CZKA 3PUQA 3RWNA 4UFLA 4YW7A 1OBNA 4CDXB 2BFHA 2OQ7A 2GC0A 3ZFFC 5HPZA 2VUJA 3WQ1A 2IWGB 2Y8KA 4AF9A 4D94A 3AMHA 2PMWB 3T2QA 1W6NA 3WW4A 2AR6A 2H0VA 3O1RA 1LOCA 2WWJA 3FC0A 3ACIA 2RE9A 4EZ4A 1AVUA 2HWAA 2PFWA 1XE8A 4JTOA 4AEMA 4LO7B 5GZFA 1EPZA 3O49A 1PHMA 1W2UA 2XVGA 5C71A 1AYM1 2XXZA 4LO7C 1VRH2 2IHOA 4R6UB 4BQ5A 4LNVA 3AC0A 3W9AA 3ZYRA 2R32A 5GZCA 3VSFA 3VBRC 1GZ9A 5A3OA 3NKTA 4P9GA 5FYVA 3RFRA 1I1EA 1UZYA 2XWBB 3ELNA 3H6RA 3VBHC 1YLLA 3N36A 4XHBA 5FY1A 2R062 1G82A 1N3PA 1J0SA 5BY5A 3HVDA 2XKOA 1OPMA 1ASJ3 3ZPYA 3B69A 1NA1A 1SFYA 1UD1A 4YW6A 1W9YA 1ULEA 2DTWA 1XSRA 2K9ZA 3AKSA 3WNMA 1Q56A 1UYXA 4YM1A 1DLLA 5DQ0A 5AFEA 3UD8A 4FBFA 3EYPA 1PMJX 5EP9A 3VSZA 41BIA 2W3JA 4NR1A 2Y6GA 5JSOA 1Q8OA 4XILA 1EVTA 5GALA 1DHKB 4J2YA 4D8HA 2JKXA 1PGL2 1XYNA 5T5OA 5HV4A 3IZOA 1VBD1 2BFUS 2CL2A 1WD3A 3N9OA 2D5FA 3GZTB 4AQSA 5FO9B 2NQYA 4K7JA 2FDJA 4XDQA 5D2AA 3JUTA 3VT1A 1SLCA 2ZGTA 5HCFA 2VNVA 4Y22A 3VBSC 1HV1A 1ZBE1 2YFUA 2UU8A 3AMPA 2BBVA 1DQOA 2QDNA 1JN2P 3CQOA 3I2GA 1X33A 5FZMA 2ZXQA 5F5QA 4BQ2A 4JQ0A 1GNYA 1SPPA 3AYCA 2WZR2 5BQUC 1XOYA 2XL7A 4RYDA 1XNBA 2YPJA 1F4AA 2LRPA 4Y1VA 2GZBA 4LO1C 1XNDA 3WDTA 4LO1A 3VHPA 4LA2A 1O8PA 3S5QA 1H9WA 2BP6A 3LF7A 3T4HB 1W8HA 5IUQA 1HX6A 5BPXA 5HCHA 1QJFA 4XJWA 2RS51 2WQ4A 3UJQA 3D4KA 2WKKA 3J8F3 3ZR5A 2VCMA 5EXOA 4IGPA 1PO22 2Q1MA 4H04A 1VJ2A 4L4IA 4Q4Y2 2HWF2 5E8AA 2B39A 3IM5A 3UDAA 1F15A 1XU1A 5FPAA 1HIXA 3SXWA 3VLBB 1C4RA 3OTFA 1A78A 5FZCA 4FTSA 2JG9B 2R16A 1VMHA 2GC3A 4I01A 5FZHA 1UIJA 1AX2A 1NAEA 4A44A 4WVZA 2HWMA 1J84A 1N47A 2MEV3 5ANQA 2F2FC 1QKQA 2P3YA 2FCUA 4KWKA 4BWOA 3PVEA 1H8VA 1H6XA 2RMU2 3PMEA 2Y9GA 4W50A 1K12A 1GV9A 1WA4A 3LAGA 4G6JA 1YO8A 4QGNA 5A3WA 1BQPA 2A5ZA 3V0BA 5EZWA 5FZOB 4JPZA 1RUJ1 2Y6LA 3OGRA 4IL7A 1PZ8A 3JB8A 1GP4A 1HB1A 4A7YA 4P9XA 5BP5C 2CAUA 2W46A 3RS6A 4P9YA 2VE1A 3BAOA 5FYSA 3GALA 5E1RA 3AH4A 1W8WA 1VPHA 2P5BA 1V70A 1KJRA 4JGZC 3ZFFA 5BNNB 1DQGA 1S2KA 3DYOA 4JGZA 4FOYA 4D3WA 3VBUB 4EEEB 4FFFA 5FBZA 2FQPA 5GLTA 5BQUA 1RVF3 1EYLA 3OJMA 2W1QA 4X6QB 4Q0UA 3WINE 3SH4A 4CCEA 3MIDA 1OOPB 1V6LA 1KXGA 3VL8A 4D6QA 3MI8A 3BTXA 1HB3A 1QJU3 2ID4A 2VXRA 2FZ2A 3O4BA 4KG8A 1PNFA 2QE3A 3O1VA 1UIKA 1AR83 2BOJA 4H7LA 5EJZB 3SLIA 4MOAA 3WHUA 1WBCA 4FPLA 3LDKA 5FLJA 4BZ4A 4Q4X1 1HRV3 2QQMA 3I7DA 4IDZA 1CAUB 4P9WA 4AI8A 5KHGA 3GBWA 4N43B 2BZDA 3ZMOA 1JT7A 3ORJA 4D7YA 2W1UA 3WO4A 1XHBA 2GN7A 1ZA7A 4G9SB 4QB1A 2G1MA 2KA3A 3AYEA 3FL7A 2OW4A 1QXPA 3G6JB 3MIGA 3SCHA 1BLZA 4CXYA 1ZZCA 1E0OA 4LORA 4AFMA 4AXOA 1FMD1 1S2BA 3RZLA 2RS12 3TEYA 2Q0AA 1W03A 4YM0A 2AH2A 1G7YA 3E6DA 1VAVA 3P3NA 4QXKA 4NPLA 4XF4A 4AE2A 2VOKA 1RL3A 1SLIA 1LESA 1UY0A 1YQCA 3BRFA 1W8TA 2ZKLA 3H7JA 5JIUA 4J2SA 3NJ5A 4B4QA 2VY0A 1V9U1 5I0RA 5IFTA 5L9RA 2C5DA 1QY4A 5ABJC 5CFDA 3VBFA 3AJZA 2VUCA 4DEVA 2SLIA 3ZXFA 1RUG3 3K2OA 3H1MA 1VALA 4USPA 3WQBA 5FREA 1PIV2 3QYDA 2ZBJA 4YGBA 1AXKA 4QX2A 1BK0A 1H6YA 3O0XA 4ZZ8A 1VBD3 3H8RA 1CAVA 1VRH3 3VV1A 3NBDA 3JD73 1MS0A 3MGUA 1NCRA 3WHTA 1BZWA 2ATFA 5A7SA 4GOVA 2ET7A 3Q7XA 1LTEA 4IETA 1W28A 1VBC2 1FWVA 3GDBA 1LOAA 1MS9A 1Y4WA 2KLLA 3OPTA 1CJDA 2FDFA 1N3OA 1H2NA 5DUWA 1ISZA 3N7JA 4MZGB 2JKBA 2AXMA 5HXMA 4I4RA 4P5YA 4ZS2A 3VBSB 4UF0A 3D7WB 2VPVA 1DQ5A 3EF2A 3I8TA 4HETA 1H8TB 4GD4A 4MXWA 3H7YA 1JUHA 3BU0A 3MLLA 3VHRA 5FP4A 3OY8B 4D0QA 2Q1FA 4XFAA 1SG3A 4DO0A 1AVXB 1S4CA 2Y0IA 3DYPA 3HEIA 4UFIA 4LKDA 5FZ4A 4CUGA 4F3JA 5BXTA 4LKFA 1VR3A 2VO5A 1VBA2 5BXSA 4I3NA 5DUXA 2QDRA 3H8UA 1BLDA 2X10A 1RXFA 4ORFA 5EHAA 3FFQA 1NKGA 4X38A 1IPKA 2HKXA 4I7IA 2ARCA 4E27A 5BNOC 4OUEA 1Z2VA 3HIFA 1VB4A 2JE8A 4CEWB 2DFCA 5LBEA 4CCNA 4NWWA 2WFF1 5FOBB 3CRGA 3LLPA 4J2KA 2RS13 3BB6A 3R6SA 3VBSA 2ZEYA 2ZX4A 4RQPB 4KBBA 4OMCA 2JXAA 4W6YA 4XZUG 3U75A 3TEZA 1LHNA 1OT5A 3HOBA 1LOFC 2BU9A 3MW4A 4EWAA 3N3HA 4PLNA 1SR4C 2GSYA 1WCUA 1U0AA 1OKQA 4LLOA 2YPDA 1IGOA 4LBMA 2B9UA 4Q1RA 4R9DA 5DAPA 1GMMA 4AWDA 3MUY1 4QMAA 1WW7A 2LTNA 3URFA 4QPIC 1W9TA 1TIEA 5APAA 1KDKA 6I1BA 2DCKA 4PC4A 2YYOA 5BNQA 4Q29A 2ZGOA 4G3YC 4NHYA 1IKQA 1UWWA 1RVF2 1Y9GA 2JENA 2JDAA 3AJYA 1NCRC 1OA4A 2VC9A 3D0SA 3O0WA 4IEPA 1C1FA 3UD7A 2JB8A 3CDZB 4M0NA 2VUDA 4A6OA 4AEDB 1DLCA 5CISA 2OYZA 2RMU1 4V1PA 5T55A 3WD5A 2HWD2 2GC2A 2GNDA 1W3AA 3VBFB 4YW2A 4CPBA 4UY4A 4A6SA 3BRGC 1XPWA 2YBKA 1H1AA 3BADA 4L0PA 2P3KA 5FZ0A 2RS52 4IYBA 1TME1 3BA7A 1COV3 2ZEXA 1PO21 5DAVA 1C57A 1W6PB 2WRAA 4IE7A 4Q4Y1 4UFMA 1AJKA 1GOHA 2W52A 5FY4A 4EN9B 1CX4A 1FGAA 4P6AA 3WO3A 2C26A 2ZGUA 2HWB2 4NJ4A 4Y20A 4G1RA 1SBEA 3TNPB 1YF8B 3B94A 4E2QA 4FPGA 5J98B 1YJLA 4QQHA 1ACCA 3NWKA 1HRV1 1QXRA 4XXPA 2YGLA 2QQOA 1VE0A 3I2KA 5IVBA 1ZRCA 4OHYA 3AMMA 4OCTA 4X6RB 1J58A 4FOWA 4CUAA 2PHTA 3BTZA 1RG8A 3K75B 1CZTA 4Q2FA 1H8TC 2ORXA 1TWEA 5FR3A 1W0PA 3A7QA 2BEOA 2YXSA 1PGSA 3JD72 4GQ7A 1FXZA 1MS4A 1XRUA 1CZVA 1R093 1KITA 2VW0A 3DGTA 3PU3A 4K9SA 2B9VA 5A3TA 2FDBM 3PURA 4YFWA 2XUMA 5FYBA 2RG4A 4I09A 3I4IA 4XF9A 2XBO1 2RQ9A 5F8YA 1L7LA 2P3IA 5F9TA 5IAXA 3POYA 1W6MA 3TC2A 5DUYA 4K21A 1VMJA 1DYPA 2C1FA 3FJ9A 4EWEA 1UW8A 2E26A 3IWZA 2WO7A 4LHSA 5FFOC 2UY8A 3O4CA 3QR5A 2R043 5CIRA 2B42B 3I2JA 2B7YA 2XG3A 1QIQA 1M16A 1AHSA 1SQ4A 4P9IA 2QQIA 4H14A 5BNOB 4URAA 2PAEA 5KHJA 2ERMA 3BAHA 1ONAA 2X05A 5C4WA 3GZAA 2HBUA 1W8NA 1TP0A 1RUI1 1WA6X 2VQUA 1ZRDA 4A41A 2P4EA 3B5LB 4IV3B 5JCTA 4LKEA 1LOGA 3Q9OA 4CE8A 1QJY2 3ZSMA 1V6VA 1NA1B 1C5HA 1QQP2 1C8NA 1OVSA 1FV2A 5C9AC 5JI9A 1RUF2 4MG2A 5JLVA 4XIOA 1IT0A 3I2AA 1RXGA 2KD7A 1B35B 3E6BA 3LKJA 4IGQA 1XU2A 3V0AB 4PQQA 5LBFA 4B7KA 4C8DA 4XUPA 4AI3A 1LU1A 1M4WA 5EG6C 4YW5A 1ENQA 3LQCA 4Y20B 4CDUC 1DZDA 2R073 2XJSA 4HKLA 2PTMA 3KD4A 4ZU7A 1X36A 1PIV1 2R0HA 1W0NA 3HN3A 3MPBA 4HONA 1FNZA 2DVBA 3SKJE 3WF4A 1NLRA 3KM5A 5FMCA 4AEJA 2WIIB 5A7WB 4QBCA 1SACA 1CIYA 1TMF2 4IV1C 1RHI2 2JE9A 4K1ZA 2PLV3 1RB8G 1ULPA 2Y33A 2OZJA 3OEBA 5F39A 4Q4X3 3KLSA 2GP3A 1NY72 3T0AA 3SCGA 4Y24A 1F9KA 1PNGA 4CTEA 2A75A 5F6KA 4CDXA 3ILAA 2G9ZA 4GP0A 3VKLA 1S0GA 2VNOA 3AMNA 4XKIA 3JRRA 1PZ9A 1T9FA 1BHGA 3PVBB 5EIYB 3KHBA 1Z0HA 4IEOA 2J3PA 2WFF3 3WR0A 2WO2A 2L9LA 1PGW2 3IAPA 5EQUA 3O5WB 2CDPA 1UYYA 1FMD3 2QVSB 3ROUA 4XFSA 1PVC2 1REDA 4B1LA 3WSOA 1ULOA 1UZWA 4QM9A 2VCBA 4P14A 1VBA1 2OVUA 3FHIB 4AI1A 4AFAA 1UOBA 2EIBA 3C8XA 5A3LA 3WNPA 2TBVA 2D20A 1PGL1 1U5XA 4JDMA 5FZ8A 3H0OA 4CDQB 4NRQA 1L2HA 5FNWA 4Z07A 3ASIA 3CA1A 4Z82A 5FQ0B 2BNMA 3BAGA 2JDMA 2TEPA 3KSCA 3PDQA 4LA3A 4NHMA 1D4VB 3N9PA 3FJ8A 3V0AA 4O65A 5GKAC 3FJCA 1LHOA 1LRHA 3SEPA 4OW4A 1ODNA 1ZBE2 1IPSA 1FV3A 3DEMA 3CJIC 2QNKA 4BIOA 2Y9XE 3FJHA 2AAIB 1IS4A 5C33A 1QOSA 3X29B 2CWSA 4QX0A 4CUCA 2W92A 4D6RA 4NIHA 1BFBA 4NVPA 1VBB2 1WBFA 4XQ4A 4ATEA 1HXS2 2VAUA 1RUH1 2PHLA 5J1XA 1OD3A 5IVEA 1HKDA 4K3UA 4KWLA 3NAPC 2UWAA 4IV1A 3LB9A 3MIBA 1RYYA 5LA1A 3ON7A 5CFDC 3HJRA 3U1XA 4GAFA 4AVSA 1FOD2 2E33A 1ENRA 3NNGA 1DGWA 1MZEA 4YRDA 5LASA 1KQRA 3CL1A 3KZ4C 1WMEA 2X5IB 4I0BA 1N3QA 1HN1A 1YYNA 5DDJ3 3O4AA 5CG9A 1HQNA 4I4VA 2X5IC 3N9MA 3IMNA 2JG8C 4Y1XA 2BJSA 4ZXEA 4LO7A 1LULA 1X8EA 1D7PM 2VNRA 3FN9A 5FP3A 4JGYB 4CXXA 1J59A 5D63A 1KFUL 3WDXA 4MGZE 1C5IA 1DGWX 4I0AA 1O91A 2B46X 1IILA 4P0JA 2YBSA 4USOA 2HLEA 3AKGA 3BGAA 4LBQD 3H1YA 2WZEA 1WLCA 1W2TA 3SCFA 3PTRB 4FFHA 1W8UA 1YQ6A 4EKXB 2XQXA 4AYUA 2WC2A 4B1MA 4NIAA 4X39A 5BV6A 4CCLA 3PUBA 2VGDA 3EXUA 4MGIE 4V2VA 4XAEA 4Z9WB 2KKIA 2M49A 2ARAA 3MZHA 1N1YA 4KI5M 1D0GA 1IJTA 3KS7A 2Q3NB 2JG9C 5JOZA 3BU7A 3VT0A 2WNUC 3FJDA 1JU3A 3U37A 4HVOA 3FHQA 5IVCA 3BALA 2WNUB 5J37A 3QH7A 1OA2A 4YGCA 2JDUA 1S0FA 2DTYA 4JGYC 5BP5A 1OLRA 4QD2B 2VMHA 3JQXA 4XJUA 3CA0A 3ZX7A 2YBPA 1FT9A 3QBQA 4QWNA 2JJ6A 2VQTA 1UO9A 4LLFA 3K4AA 4OFGA 4HN1A 5KXDA 3VD7A 3TB0A 4BHPA 2WBKA 3NSTA 2CNAA 1JHJA 1YRZA 2WQ8A 5I0SA 1UX7A 3WQ0A 5KWRA 5HPOA 3WF1A 5CBLA 3BVCA 1I6XA 2RMU3 4GH4A 4BISA 2VCCA 2WS93 3ABZA 3KVAA 2VZVA 4CP1A 5CFDB 3CRHA 3WDWA 3I3BA 5FZZA 1UNBA 1YQ5A 3CEWA 5I8TA 4CVUA 1UF2C 5D8AC 5DMYA 2VOVA 2YU1A 3ZOIA 4F7ZA 2HEVF 4AK3A 3KGZA 2NS2A 4K8FA 1ONKB 1CVSA 2BW8A 5AC92 3S0MA 3FJIA 3HQRA 4RHV1 1JMUB 2JG8B 4XVHA 2EXJA 4Z92B 2H0BA 2X5IA 4Q4Y3 1W2OA 4P0KA 4QT6A 3ATGA 1NCQC 1W9SA 1AR91 3K3NA 3JBG1 2YUEA 1AYN2 1JZ3A 3BA4A 1T6GC 3B93A 2VOXA 4CXWA 2D3RA 3H42B 4FT8A 4WVVA 3UJOA 1EYBA 4QKNA 2RM23 3CO2A 5DVHA 5KHHA 1M2TB 4B4PA 5KXEA 1HCDA 4PLOA 3LPFA 2NN8A 3K46A 1HRI3 4FSJA 1HV0A 1QJX1 4NHKA 1US3A 4ENDA 1E5RA 4Q4W1 2ZGKA 3B00A 2XHKA 4TXWA 5DG1A 3AFKA 3WW2A 2VTFA 2AREA 5C4WB 4XW3A 5BNPA 4KEIA 1Z78A 4A4AA 1W9WA 5FQ0A 3OB8A 1XG6A 3NW4A 3A23A 3WINC 4OQ8A 1PVXA 1QJY1 1IG0A 4L99A 4XE9A 3I29B 4OEFA 5JZGB 2L5XA 2W94A 4YLZA 5FZBA 4WM7B 4EV0A 4FGFA 5FOJB 2X09A 1PX4A 2R041 1R083 3NAPA 1ASJ2 3OBRA 4ISQA 3WNKA 2WSVA 1JQZA 3I3QA 1OF3A 4XBQA 1SR4A 1I3HA 3T2PA 4DMIA 1XJAA 4CP2A 5CKQA 1ND2B 5FRAA 2YFZA 4K8RB 3OF1A 2ILMA 3RQ0A 2FMDA 5IATA 4XF1A 5D8AB 5IWFA 4FPYA 1QQLA 4XMAA 2TUNA 2R061 3WG3A 1OLME 2XLGA 3ME2A 4BE3A 1JT5A 5FMOL 4N8MA 4YNIA 3ZYBA 4D69A 2ZGLA 2X8KA 3DKWA 3DPRB 1FOD3 4AVAA 31BIA 3VHNA 3HALA 1R082 3NBNA 1PVC3 4XCAA 5FZOA 4Q1PA 3PIJA 3VN4A 3MF6A 4EFQA 3JCIA 1Z7S2 1XE0A 3APBA 2WL1A 3FWEA 3TEXA 2NP0A 1J3PA 4U2AA 3OGVA 1PM7A 4JVAA 3DKQA 4Y5TA 5AC93 1MC9A 1ENXA 2RDQA 4GJYA 1ZZ6A 1W6OA 4DS0A 4OI1A 2DRZA 3P53A 4N9IA 4TYSA 4ASMB 4Z2WA 2JDPA 3GJAA 2O14A 2Q8OA 4XOGA 4TLPA 2NTDA 4QX5A 2JG9A 4BK5A 4EN7B 1GWLA 2PLV1 2RDRA 1UPIA 4D0ZA 4JGZB 3ZDSA 3BIEA 4MGTA 3DXTA 2BBAA 2AQZA 3AKQA 2XJVA 3IDBB 4HN0A 1BKZA 1JYXA 3S7IA 3OJVA 3T1LA 2K0GA 1S0EA 2OIIA 3KV9A 1RJ8A 5ACA2 3A07A 2A70A 4TLGA 2MNGA 3CMGA 5LEKA 3CA5A 2RR12 3T8SA 4QPIB 3RZHA 5EV7A 1XB9A 5D21A 2MHFA 5LK7B 3IDEA 3USUA 4QQLA 5BOWA 1LHVA 1CAWB 3NJVA 2XPJA 2YC4A 2ET2A 4HA2A 5FY5A 3H6RB 1NE4A 2UYAA 3DV8A 3I97A 3WEZA 4LO0A 4PIYA 1KS5A 2V4VA 4UBGA 2P23A 2QFEA 1JTZX 3ZXDA 2WO3A 3T4VA 3VBOA 2R6QA 2AEYA 3QACA 4IEZA 4ES8A 1BBT2 3O44A 1AJOA 3NVCA 1TMF3 1JI6A 2JWPA 3BOWA 3FJSA 3AL6A 2D6LX 4FQ4A 3NNMA 4QPYA 1U5ZA 4EZHA 1DIWA 1FQ9A 5LB6A 4YOLA 3POFA 1UY1A 4EN8B 4CEYC 1BEV1 4XFCA 4LO4B 5C8CC 2EIEA 3J7NA 1KJLA 1DZCA 3LEIA 5A1LA 1ND3A 2P37A 2AZ5A 3ES4A 3ZYHA 4DRRA 1LOBA 5B2HA 2Q5TA 2VW2A 2HWC2 4UYBA 1WCDJ 1Q43A 5FNXA 4IESA 5C9AA 4YARA 4I0WB 2EAKA 4V2WA 1UCXA 4INDA 4D8MA 3VZKA 4QD2A 2VMCA 2X53S 1QQP3 4AVVA 2VD7A 3FGMA 4XJZA 1OQ1A 2BVVA 2OPKA 5I8SA 3OGJA 4CCDA 1K5VA 1FATA 5A7NA 2PHXA 4ASKA 4FPKA 3CJIA 1AR72 4E8DA 4RS5C 5K0UB 3AZZA 1GZWA 5FZ6A 1MS1A 4FTEA 2CGNA 4LR4A 1BARA 4UT5A 5EJ3A 4ZZ5A 3KCXA 1DJSB 2WYSA 4NWVA 3ZKYA 1F35A 1UY2A 1RJ7A 1UX6A 4RSUA 2D6MA 4MHUA 1VAKA 2Q4SA 5C70A 3ZXEA 5FYZA 2QQNA 4BQ4A 3JBG2 5FZYA 1YQ8A 3PTYA 3WT3A 1S0JA 4P9JA 2EA7A 1SBFA 1GZCA 5LATA 3I54A 4AN7B 1Q8QA 4YM3A 1U12A 2IXKA 1ND2A 4QKBA 5K0UA 3EHKA 5FMDA 1SPPB 2G9GA 2J42A 3ZLIA 3W9TA 1XE7A 1ZX5A 4DXRA 1BFFA 1Y7BA 4O9EA 5FP9A 1R64A 2QZ2A 4OEEA 5A3UA 1IS3A 4XJ9A 3FX3A 2D6KA 1M06G 4XEZA 2FGFA 3CJXA 5J36A 2D93A 2FDKA 5FYYA 2OA2A 4LIUA 1WBLA 2PXJA 1AL22 3IN9A 1QU0A 4PF5A 3NV1A 2WNOA 3AB0A 3VZJA 4Z2AA 2CAVA 4NIGA 4EB2B 4OWKA 5C3OA 1RZOB 4RR3B 4UW6A 5DZEA 2PHWA 3PUHA 5FY7A 3NBEA 1ALYA 2DVFA 1RUC1 3D3AA 4RHV3 2DRYA 1WW6A 1HIBA 1WW4A 4BPZA 1N1VA 3NNFA 4LO3C 4W4ZA 1FN0A 3VB9A 4HKWA 1N1TA 1A6CA 2HWF3 3ILNA 3T2OA 1US2A 1H8TA 2V5DA 3AZVA 4MXWB 4BMBA 5KBFA 4QPGC 4I1BA 3RTJB 3I2IA 4I02A 1PO12 2OZ6A 5L7OC 1XYOA 4UW4A 4OUJA 4OZOA 1DGLA 1ZNPA 2UWCA 5K9YA 1ZZ7A 4AAPA 2Q8EA 3R4UA 4L8QA 3WF3A 3W58A 2W47A 1QJU1 1HWMB 2R042 3MDPA 4LEJA 4GJZA 3WG4A 4UW3A 4YZ2A 9ILBA 5A1AA 3VBRA 3VDAA 4MZUA 2BERA 2XWJB 1OLQA 2ZTNA 1W2AX 5FZDA 3POSA 4QX1A 5JXGA 1JYTA 2QQWA 1JZ8A 2I74A 3PUSA 4XC9A 3ALQA 1RMU1 4IY9A 4OI2A 2DCJA 2I2SA 4AR2A 3I2DA 1NQDA 1R081 1YI9A 3WCSA 1IRAX 1K42A 4QD2C 2IFWA 3MIFA 2VZRA 3AP5A 3O7OA 4YVWC 5CA6A 5E24E 2C9KA 3B3QE 1PK6A 2VM9A 4QXBA 2GH8A 2ZX2A 1ZRRA 4QC4A 2RVAA 1CVNA 2VQ0A 3FJAA 1AFCA 1OUXA 2K8RA 2F4PA 1FPN2 4IEXA 5LBBA 4ITCA 2WBCA 2HWB3 1JXNA 2W87A 3PUIA 3GXUA 3ITQA 3NV3A 4OVEA 3RNSA 1J3RA 2VU9A 4IY8A 3WINA 4Q9GA 1CE7B 3BIWE 3POIA 1FOD1 2GH2A 3T1MA 1RTVA 2PHRA 3P6BA 2D24A 1MVEA 2J1VA 2GMPA 2ZOEB 4NPRA 1YNAA 4L97A 5A80A 2RS33 1SZ6B 4MZFB 4M3CF 2EALA 2P6HA 1YWKA 1URXA 1ND3B 2C4XA 4IEWA 3O1MA 4XBNA 1C3HA 1JYIA 1TFMB 1CJPA 1RUD3 2UYBA 1YHFA 5FWEA 4AFDA 1VMFA 4HL0A 1RY7A 3GZEA 5JXIA 2JDZA 2BGPA 3GHMA 4GAIA 4CCMA 1BEV2 5IVVA 2KXLA 3WMUA 1KRIA 3CAHA 1FAYA 2DU0A 5FYMA 5A33A 2O8QA 1JYNA 2LIQA 4IV3C 5FTTC 1XYPA 4UF0B 3UT0A 4E4ZA 3B7MA 3USUB 5FUNA 1MS8A 4C0HA 1H4HA 1COV1 3BYWA 5H9QA 5CKNA 4AI0A 1ULDA 3OD0A 3ZSKA 2Z5WA 4XUNA 3IBMA 4AVCA 3WXPA 1DZRA 4JKLA 1W6QA 1K5MA 1RUE1 1ISYA 3VEQA 5JXJA 3CRIA 2KR2A 4XF0A 2P3JA 3HAGA 5DZFA 4XETA 4B8EA 2IFRA 4LULA 3DECA 5K7PA 4GP3A 1AR71 3AVRA 1QDOA 4HVRA 2FCTA 5FPXA 4OQ9A 2ZACA 2VMIA 1UKRA 1V6NA 1Y9QA 2XJTA 4MX3A 5FMBA 2A7AA 2D43A 1OH3A 4IEVA 3AFGA 3UKVA 4Y33A 4FOQA 4GB33 1RUF3 1SLTA 3R05A 2J1RA 1BVVA 1LODA 4LBOA 3PL0A 5LW9A 1LHWA 2IXHA 4YZ1A 3TEWA 2Q8DA 2DCTA 5JSPA 1X50A 1RC6A 4UFHA 4IONA 4MXVA 1OKOA 4GULA 1BMV2 1EAH1 1VBE1 3WO2A 1TQ5A 4Q4V3 2W0XA 1OH4A 4WBCA 2EIGA 2BGOA 2W91A 3W21A 2LALA 4YM2A 4LBNA 5I91A 1AVBA 3OSDA 4XHXA 3V79C 1KGYA 2IUWA 1BJQA 4GH4C 4KG0A 3HN1A 1MQTB 4KNCA 4KU8A 4C0BA 2WAOA 2WFPA 4ES9A 5C3SA 4GH4B 2AFGA 2VZ3A 1BMV1 1AR92 5DDJ2 3BUCA 1HDKA 4LHNA 4M3CA 4I96A 3ILFA 5BVPI 5CFCC 4K1YA 3O1TA 1TME3 1WCSA 5L73A 4D7SA 1JBCA 4II0A 2V73A 3HR9A 2ZMLA 2ZS6B 1BXHA 2ZR1B 1YXWA 3ZM8A 2Y60A 1GICA 1Y43B 4L92A 1NCQA 2DDUA 2LIEA 1O5UA 2WQZC 2XJRA 4LMFA 3K1XA 1QQP1 4LITA 3E6CC 4LT5A 3VWCA 2V09A 1XNCA 3O4OA 2NMNA 4AAXA 2Y6KA 4XQWA 4QHZA 5FDBA 5A3NA 1RUOA 4AGRA 2UURA 4BQXA 5FAXA 3NJXA 4IQPA 2KI4A 3Q8CA 1ND3C 3KF5A 1ENSA 1SLBA 3CIHA 2R071 4N53B 1YEWA 4QHOA 1IOAA 4LOTA 5E89A 1IOBA 1PWAA 1C1LA 1OFNA 5F2SA 3ZVXA 2ARBA 2BGCA 1LGBA 3M2MA 1HB4A 1FX5A 2B4KA 4Z1VA 1WMDA 2GNBA 1IHMA 4NIIA 1V6UA 2VSAA 1AX1A 1CESA 3VBRB 2VJXA 4DUWA 2VBDA 4IZEA 2WWSA 2GU9A 3MYXA 3CA4A 1T2XA 2YDEA 4FVVA 4OULA 4TWTA 3ZFGC 1JOBA 1Q03A 5IJRA 1LR5A 2VR4A 3ZN6A 3FUQA 1AYM2 4UI9L 2XL9A 2WINB 1RUC2 3D82A
chains in the Genus database with same CATH topology
2VNGA 3O4DA 3S30A 2FBEA 1WCKA 1YUDA 4Q0PA 1F8VA 3WZ1A 1RUI3 1BA7A 4I3GA 1CAXB 5BUVA 3IM6A 3AKHA 5FCCA 3J9SA 4KQ7A 3SNMA 1OSGA 2GALA 4P9LA 4KWJA 1D2SA 1ND2C 3O3QA 4YG6A 1RUC3 4CEYA 4KU7A 5C8CA 2FFUA 5A3MA 2YC0A 1CD3G 3H50A 5F6LB 2WJSA 3AKTA 4HSJA 3WMVA 3NKGA 1EV11 1F31A 4BQ1A 3PG0A 8I1BA 3DPRC 1TNRA 3F62B 1A8DA 4Q8KA 3HBWA 1QDCA 1O3SA 4I30A 3BAVA 4ZOTA 5ACA1 1B09A 2O8OA 2CYFA 3H9AA 3KT1A 4Z8BA 2YUGA 1RIRA 1UPSA 3RJ2X 4DENA 2XJPA 4QU2A 5EC5A 3ZIWA 1ZBE3 2RM22 1C8M2 4W6WA 3S8KA 4RGGA 1EP0A 1YFWA 3SISA 1ILR1 1HWNB 3VZMA 3WP5A 1B35C 1GQGA 4XFHA 1GNHA 1GANA 1MVQA 5C9AB 2EXHA 2TNFA 4PCRA 3RYPA 2FHRA 4NO4A 1OPOA 2HEYF 1JYCA 2E4MA 2D6OX 2RS53 3GYDA 4BCUA 5FO8B 5KXCA 4FAGA 3WG2A 1RGSA 4OZXA 4R9BA 4XYXA 2MLLB