1ILR1

Crystal structure of the interleukin-1 receptor antagonist
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
145
structure length
145
Chain Sequence
SKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 RECEPTOR ANTAGONIST PROTEIN
publication title Refined crystal structure of the interleukin-1 receptor antagonist. Presence of a disulfide link and a cis-proline.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Binding protein
total genus 26
structure length 145
sequence length 145
chains with identical sequence 2
ec nomenclature
pdb deposition date 1994-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1ilr100
1J0SA 2LIQA 3A23A 3AH4A 3LTQA 1G82A 1ILR1 1WBCA 1AVAC 3N0KA 5DUYA 1JT7A 5F8WA 1DFQA 4LO7B 1FMZA 3ZXDA 3UJ0A 1BFCA 3PUBA 2FGFA 2D7IA 4ISQA 1KNMA 1T9FA 3O4AA 4HR6C 4D8HA 2F2FC 1T4QA 3CA5A 4XFUA 4I2SA 1DZDA 2KLLA 3NJ5A 4IZEA 4P6AA 1Q03A 3FJBA 3N7MA 3F62B 3OBRA 1IRPA 4I3NA 8I1BA 1XZZA 3OGFA 3FUQA 5D62A 3BRFA 2QYIB 3VUOA 3VWCA 3JRRA 3OGGA 2VXRA 4GAFA 4IQPA 1QQLA 1S0FA 1JT4A 2QN4A 4I4YA 3AJ5A 3A07A 3O4OA 1TFMB 2ZQNA 1TIEA 3UDAA 3S8JA 3A22A 4Q9PA 3BTAA 1E0OA 4QKSA 2DREA 2FDBM 5FNXA 1TOOA 1S0GA 5EHAA 5F8YA 3FJHA 4LO2A 5FZYA 2MLLB 3OJMA 3O3QA 2XOAA 2RQ9A 2Y9WC 4G9NA 3VT1A 4TLPA 5I1BA 2P39A 2Y9FA 1FGAA 4H9WA 4QD2C 3CA4A 2AQZA 2VLCA 5BXTA 1QXMA 4I4PA 3FJKA 1S0BA 1CE7B 3E8LC 4DEPA 3R4SA 1HKNA 4D0ZA 2Z48A 1N4KA 4QBCA 4USOA 2FFUA 1TTUA 3HMYA 1JQZA 2BEBA 3AZWA 5FNWA 4Q9GA 3BADA 4A7KA 1PUUB 2BFHA 1FMMS 3BA7A 1ITBA 2VUAA 4ZLBB 3RMXA 3OJVA 4OEGA 1D0HA 4I4RA 1YTOA 3O4DA 1DQOA 4P0LA 1RMLA 4D0TA 4LO2C 3MALA 4HJJA 2NP0A 4AN6A 2AFGA 2NZ9A 3C9ZA 3FJ8A 4GOYA 3BAQA 3RTJB 1K5VA 3K1XA 1R8OA 3HBWA 3UD7A 1PZZA 1RY7A 2Y9XE 3V0BA 1HCEA 1G9BA 4ISRA 5JMCA 1WBAA 3IIRA 3IM5A 3VEQA 1I1BA 2HW9A 4P0KA 4IHZA 3RTIB 2AAIB 1IOBA 3FJFA 3O49A 2D1ZA 4EFQA 3P53A 1ONKB 2Z49A 4OWLA 1AVWB 4HA2A 5DSSB 3T8SA 1XHBA 3O4CA 4KEJA 1R8NA 3AH1A 3H6RB 3KMVA 5BQUA 3NBDA 1PWAA 2NTDA 3BA5A 3RSJA 2P23A 2DRYA 3RMYA 3O44A 2NM1A 2X2SA 3WO3A 3BA4A 1OQLB 3CRHA 4LO0A 2Y9GA 1WD3A 3WMVA 1HIBA 3BRGC 1P63A 4I8MA 4IONA 2UUSA 1ISVA 4GAIA 3WO4A 2MIBA 5JLVA 1BFFA 1V6UA 3NBCA 1ISZA 1YF8B 1BARA 5F90A 4DCKC 4G6JA 1PC8B 2J3PA 3SNVA 1HWOB 3UD8A 3VSFA 1W3AA 4XFTA 1UPSA 3CA6A 1Q1UA 4KC3A 2L5XA 1IT0A 3ILAA 1M16A 2HZ9A 3FGMA 3ZXGA 4KBBA 4EB2B 2BEAA 3H6RA 3O5WB 5BQUC 3WO2A 2KH2A 3V0AB 21BIA 2VSEA 3FJCA 3H6QA 1K5UA 5BVPI 4Z9WB 4I4XA 4I1EA 5FZZA 4LO0C 1S0CA 2AXMA 3QYDA 4I0YA 4L4IA 5BOWA 3AZVA 2D23A 4I7IA 5BXSA 3WINA 1S0LA 2RG9B 3UD9A 3NBEA 4I4UA 1AVUA 2NVHA 5D61A 4A7YA 1I1EA 4II0A 5B2HA 3VT0A 4I4SA 4I4QA 2IHOA 3PMEA 1JLXA 3N7JA 4ZFWB 1W3FA 1V6XA 3A21A 3WA1A 4Z8SB 1TWMA 2Q3NB 4PC4A 4J23B 4I4OA 1HWNB 3N7KA 4J2XA 1V6WA 2ZR1B 3Q7WA 2D22A 3FJDA 2WBCA 1W3GA 3AKIA 4KEIA 1ABRB 3BAVA 5BXPA 1HCDA 4LO7C 1MD6A 4H04A 3V0AA 3CQAA 5G00A 1AVXB 5DVHA 2DRZA 4X3AA 4I96A 1FQ9A 1PUMB 3I2XA 3BAOA 1MC9A 1BASA 4IYBA 4JKQA 1FWUA 3W9TA 1NZKA 2D44A 4X39A 4JPZA 3WINC 2Q9XA 2M49A 1M2TB 1Z4SA 3CRIA 3AKGA 3OBTA 1XG6A 3P6IA 3FJIA 1VCLA 4G9MA 5BP5A 5FZUA 4EEEB 6I1BA 1IRAX 2WRYA 2KKIA 5HPZA 4F83A 1DIWA 2D43A 4Q91A 1DQGA 4FGFA 1F31A 2ZQOA 3PHZA 41BIA 7I1BA 3N7LA 1YYNA 5DZUA 4QD2B 3AH2A 4IY8A 4ZGRB 2FO1A 4G6MA 1EVTA 4LO3A 1EYLA 3FJEA 3FUOA 1DLLA 1NUNA 2HWMA 1FWVA 1ISWA 4JAWA 3AKFA 4OUJA 4JKXB 3Q7XA 2LIEA 4LO8B 4XKIA 1G9CA 1DFCA 1TWEA 2GO2A 1G9DA 1IILA 1S0EA 4OEFA 3HSMA 1ISYA 3VSZA 2MC2A 4QO3A 3TC2A 1II4A 4XFSA 1IHKA 3AKHA 3O4BA 1FV3A 4ZKTB 1G9AA 3FJJA 2KI6B 1Z0HA 4EFRA 5BXRA 4EFPA 3ZC8A 1JY0A 3FJAA 1TP0A 2D7RA 1AF9A 5BP5C 3D7WB 3BX1C 1IJTA 9ILBA 3B9UA 3CU1B 1FV2A 4ZOTA 4R6UB 2VXTI 1HWPB 5E24E 4A7ZA 3AJ6A 2K4AB 1RZOB 3OJ2A 4DENA 4LO1A 3LLPA 2VSAA 4I4VA 4LO3C 2YUGA 4KEKA 4OWJA 3V79C 3MPPG 4L4HA 1BFGA 1SZ6B 3HALA 3IM7A 1RG8A 1DZCA 4J2SA 1JLYA 4YOLA 4F34A 4I37A 2K43A 2ERMA 2HWAA 5GAQA 4I1BA 1S0DA 2X2TA 4JQ0A 3HOMA 3EF2A 3CAHA 1Q04A 3P6JA 4J2KA 5EG6C 4OW4A 3BB2A 4X37A 4ZBVB 4GOVA 3NBNA 4FVVA 3H6SE 1WD4A 1JTCA 1SR4A 1BFBA 3BRDA 4P0JA 3ZX7A 2ET2A 2R9KB 1DJSB 1ISXA 5D63A 4QALA 3BAGA 1CVSA 2GZBA 4QKRA 3PG0A 4OWKA 2I1BA 4AN7B 1YBIA 1QQKA 3HN1A 2E4MA 3V0BB 3CA1A 3BAHA 3QR5A 1AFCA 4LO1C 3FJ9A 4WBCA 1V6VA 3POKA 31BIA 1XYFA 1BA7A 3CRGA 1BLDA 2F8XC 3CA0A 4GP3A 2DS0A 3I29B 4USPA 3R4UA 4QC4A 4G1RA 3UJ4A 4GP0A 3Q7YA 4IY9A 2D24A 1JT3A 1GGPB 4EKXB 1AXMA 1Z2VA 4ZFYB 1EPWA 2RSTA 2F2FA 1BLAA 1SR4C 3CA3A 3I2AA 2K8RA 4X38A 5F8SA 2KI4A 5EC5A 3WMUA 4JRAA 1FN0A 4ZA3B 2IWTB 1HWMB 1EV2A 1A8DA 3VT2A 1JT5A 4IZXA 4QBVA 4ZFUB 2NYYA 3JUTA 3S8KA 4I6IA 4CJMA 2FFVA 4JP0A 3IAGC 2E4MC 4OEEA 3F1RA 2ESUA 3ZC9A 1L2HA 3BAUA 2VU9A 1YXWA 3IM6A 4J2YA 4ENDA 2D20A 3FFZA
chains in the Genus database with same CATH superfamily
1J0SA 2LIQA 3A23A 3AH4A 2NS2A 3LTQA 1G82A 1ILR1 1WBCA 1AVAC 3N0KA 5DUYA 1JT7A 5F8WA 1DFQA 4LO7B 1FMZA 3ZXDA 3UJ0A 1BFCA 3PUBA 2FGFA 2D7IA 4ISQA 1KNMA 1T9FA 3O4AA 4HR6C 4D8HA 2F2FC 1T4QA 3CA5A 4XFUA 4I2SA 1DZDA 2KLLA 3NJ5A 4IZEA 4P6AA 1Q03A 3FJBA 3N7MA 3F62B 3OBRA 1IRPA 4I3NA 8I1BA 1XZZA 3OGFA 3FUQA 5D62A 3BRFA 2QYIB 3VUOA 3VWCA 3JRRA 3OGGA 2VXRA 4GAFA 4IQPA 1QQLA 1S0FA 1JT4A 2QN4A 4I4YA 3AJ5A 3A07A 3O4OA 1TFMB 2ZQNA 1TIEA 3UDAA 3S8JA 3A22A 4Q9PA 3BTAA 1E0OA 4QKSA 2DREA 2FDBM 5FNXA 1TOOA 1S0GA 5EHAA 5F8YA 3FJHA 4LO2A 5FZYA 2MLLB 3OJMA 3O3QA 2XOAA 2RQ9A 2Y9WC 4G9NA 3VT1A 4H75A 4TLPA 5I1BA 2P39A 2Y9FA 1FGAA 4H9WA 4QD2C 3CA4A 2AQZA 2VLCA 5BXTA 1QXMA 4I4PA 3FJKA 1S0BA 1CE7B 3E8LC 4DEPA 3R4SA 1HKNA 4D0ZA 2Z48A 1N4KA 4QBCA 4USOA 2FFUA 1TTUA 3HMYA 1JQZA 2BEBA 3AZWA 5FNWA 4Q9GA 3BADA 4A7KA 1PUUB 2BFHA 1FMMS 3BA7A 1ITBA 2VUAA 4ZLBB 3RMXA 3OJVA 4OEGA 1D0HA 4I4RA 1YTOA 3O4DA 1DQOA 4P0LA 1RMLA 4D0TA 4LO2C 3MALA 4HJJA 2NP0A 4AN6A 2AFGA 2NZ9A 3C9ZA 3FJ8A 4GOYA 3BAQA 3RTJB 1K5VA 3K1XA 1R8OA 3HBWA 3UD7A 1PZZA 1RY7A 2Y9XE 3V0BA 1HCEA 1G9BA 4ISRA 5JMCA 1WBAA 3IIRA 3IM5A 3VEQA 1I1BA 2HW9A 4P0KA 4IHZA 3RTIB 2AAIB 1IOBA 3FJFA 3O49A 2D1ZA 4EFQA 3P53A 1ONKB 2Z49A 4OWLA 1AVWB 4HA2A 5DSSB 3T8SA 1XHBA 3O4CA 4KEJA 1R8NA 4MZFB 3AH1A 3H6RB 3KMVA 5BQUA 3NBDA 1PWAA 2NTDA 3BA5A 3RSJA 2P23A 2DRYA 3RMYA 3O44A 2NM1A 2X2SA 3WO3A 3BA4A 1OQLB 3CRHA 4LO0A 2Y9GA 1WD3A 3WMVA 1HIBA 3BRGC 1P63A 4I8MA 4IONA 2UUSA 1ISVA 4GAIA 3WO4A 2MIBA 5JLVA 1BFFA 1V6UA 3NBCA 1ISZA 1YF8B 1BARA 5F90A 4DCKC 4G6JA 1PC8B 2J3PA 3SNVA 1HWOB 3UD8A 3VSFA 1W3AA 4XFTA 1UPSA 3CA6A 1Q1UA 4KC3A 2L5XA 1IT0A 3ILAA 1M16A 2HZ9A 3FGMA 3ZXGA 4KBBA 4EB2B 2BEAA 3H6RA 3O5WB 5BQUC 3WO2A 4UY4A 2KH2A 3V0AB 21BIA 2VSEA 3FJCA 3H6QA 1K5UA 5BVPI 4Z9WB 4I4XA 4I1EA 5FZZA 4LO0C 1S0CA 2AXMA 3QYDA 4I0YA 4L4IA 5BOWA 3AZVA 2D23A 4I7IA 5BXSA 3WINA 1S0LA 2RG9B 3UD9A 3NBEA 4I4UA 1AVUA 2NVHA 5D61A 4A7YA 1I1EA 4II0A 5B2HA 3VT0A 4I4SA 4I4QA 2IHOA 3PMEA 1JLXA 3N7JA 4ZFWB 1W3FA 1V6XA 3A21A 3WA1A 4Z8SB 1TWMA 2Q3NB 4PC4A 4J23B 4I4OA 1HWNB 3N7KA 4J2XA 1V6WA 2ZR1B 3Q7WA 2D22A 3FJDA 2WBCA 1W3GA 3AKIA 4KEIA 1ABRB 3BAVA 5BXPA 1HCDA 4LO7C 1MD6A 4H04A 3V0AA 3CQAA 5G00A 1AVXB 5DVHA 2DRZA 4X3AA 4I96A 1FQ9A 1PUMB 3I2XA 3BAOA 1MC9A 1BASA 4IYBA 4JKQA 1FWUA 3W9TA 1NZKA 2D44A 4X39A 4JPZA 3WINC 2Q9XA 2M49A 1M2TB 1Z4SA 3CRIA 3AKGA 3OBTA 1XG6A 3P6IA 3FJIA 1VCLA 4G9MA 5BP5A 5FZUA 4EEEB 6I1BA 1IRAX 2WRYA 2KKIA 5HPZA 4F83A 1DIWA 2D43A 4Q91A 1DQGA 4FGFA 1F31A 2ZQOA 3PHZA 41BIA 7I1BA 3N7LA 1YYNA 5DZUA 4QD2B 3AH2A 4IY8A 4ZGRB 2FO1A 4G6MA 1EVTA 4LO3A 1EYLA 3FJEA 3FUOA 1DLLA 1NUNA 2HWMA 1FWVA 1ISWA 4JAWA 3AKFA 4OUJA 4JKXB 3Q7XA 2LIEA 4LO8B 4XKIA 1G9CA 1DFCA 1TWEA 2GO2A 1G9DA 1IILA 1S0EA 4OEFA 3HSMA 1ISYA 3VSZA 2MC2A 4QO3A 3TC2A 1II4A 4XFSA 1IHKA 3AKHA 3O4BA 1FV3A 4ZKTB 1G9AA 3FJJA 2KI6B 1Z0HA 4EFRA 5BXRA 4EFPA 3ZC8A 1JY0A 3FJAA 1TP0A 2D7RA 1AF9A 5BP5C 3D7WB 3BX1C 1IJTA 9ILBA 3B9UA 3CU1B 1FV2A 4ZOTA 4R6UB 2VXTI 1HWPB 5E24E 4A7ZA 3AJ6A 2K4AB 1RZOB 3OJ2A 4DENA 4LO1A 3LLPA 2VSAA 4I4VA 4LO3C 2YUGA 4KEKA 4OWJA 3V79C 3MPPG 4L4HA 1BFGA 1SZ6B 3HALA 3IM7A 1RG8A 1DZCA 4J2SA 1JLYA 4YOLA 4F34A 4I37A 2K43A 2ERMA 2HWAA 5GAQA 4I1BA 1S0DA 2X2TA 4JQ0A 3HOMA 3EF2A 3CAHA 1Q04A 3P6JA 4J2KA 5EG6C 4OW4A 3BB2A 4X37A 4ZBVB 4GOVA 3NBNA 4FVVA 3H6SE 1WD4A 1JTCA 1SR4A 1BFBA 3BRDA 4P0JA 3ZX7A 2ET2A 2R9KB 1DJSB 1ISXA 5D63A 4QALA 3BAGA 1CVSA 2GZBA 4QKRA 3PG0A 4OWKA 2I1BA 4AN7B 1YBIA 1QQKA 3HN1A 2E4MA 3V0BB 3CA1A 3BAHA 3QR5A 1AFCA 4LO1C 3FJ9A 4WBCA 1V6VA 3POKA 31BIA 1XYFA 1BA7A 3CRGA 1BLDA 2F8XC 3CA0A 4GP3A 2DS0A 4MZHA 3I29B 4USPA 3R4UA 4QC4A 4G1RA 3UJ4A 4GP0A 3Q7YA 4IY9A 2D24A 1JT3A 1GGPB 4MZGB 4EKXB 1AXMA 1Z2VA 4ZFYB 1EPWA 2RSTA 2F2FA 1BLAA 1SR4C 3CA3A 3I2AA 2K8RA 4X38A 5F8SA 2KI4A 5EC5A 3WMUA 4JRAA 1FN0A 4ZA3B 2IWTB 1HWMB 1EV2A 1A8DA 3VT2A 1JT5A 4IZXA 4QBVA 4ZFUB 2NYYA 3JUTA 3S8KA 4I6IA 4CJMA 2FFVA 4JP0A 3IAGC 2E4MC 4OEEA 3F1RA 2ESUA 3ZC9A 1L2HA 3BAUA 2VU9A 1YXWA 3IM6A 4J2YA 4ENDA 2D20A 3FFZA
chains in the Genus database with same CATH topology
1J0SA 2LIQA 3A23A 3AH4A 2NS2A 3LTQA 1G82A 1ILR1 1WBCA 1AVAC 3N0KA 5DUYA 1JT7A 5F8WA 1DFQA 4LO7B 1FMZA 3ZXDA 3UJ0A 1BFCA 3PUBA 2FGFA 2D7IA 4ISQA 1KNMA 1T9FA 3O4AA 4HR6C 4D8HA 2F2FC 1T4QA 3CA5A 4XFUA 4I2SA 1DZDA 2KLLA 3NJ5A 4IZEA 4P6AA 1Q03A 3FJBA 3N7MA 3F62B 3OBRA 1IRPA 4I3NA 8I1BA 1XZZA 3OGFA 3FUQA 5D62A 3BRFA 2QYIB 3VUOA 3VWCA 3JRRA 3OGGA 2VXRA 4GAFA 4IQPA 1QQLA 1S0FA 1JT4A 2QN4A 4I4YA 3AJ5A 3A07A 3O4OA 1TFMB 2ZQNA 1TIEA 3UDAA 3S8JA 3A22A 4Q9PA 3BTAA 1E0OA 4QKSA 2DREA 2FDBM 5FNXA 1TOOA 1S0GA 5EHAA 5F8YA 3FJHA 4LO2A 5FZYA 2MLLB 3OJMA 3O3QA 2XOAA 2RQ9A 2Y9WC 4G9NA 3VT1A 4H75A 4TLPA 5I1BA 2P39A 2Y9FA 1FGAA 4H9WA 4QD2C 3CA4A 2AQZA 2VLCA 5BXTA 1QXMA 4I4PA 3FJKA 1S0BA 1CE7B 3E8LC 4DEPA 3R4SA 1HKNA 4D0ZA 2Z48A 1N4KA 4QBCA 4USOA 2FFUA 1TTUA 3HMYA 1JQZA 2BEBA 3AZWA 5FNWA 4Q9GA 3BADA 4A7KA 1PUUB 2BFHA 1FMMS 3BA7A 1ITBA 2VUAA 4ZLBB 3RMXA 3OJVA 4OEGA 1D0HA 4I4RA 1YTOA 3O4DA 1DQOA 4P0LA 1RMLA 4D0TA 4LO2C 3MALA 4HJJA 2NP0A 4AN6A 2AFGA 2NZ9A 3C9ZA 3FJ8A 4GOYA 3BAQA 3RTJB 1K5VA 3K1XA 1R8OA 3HBWA 3UD7A 1PZZA 1RY7A 2Y9XE 3V0BA 1HCEA 1G9BA 4ISRA 5JMCA 1WBAA 3IIRA 3IM5A 3VEQA 1I1BA 2HW9A 4P0KA 4IHZA 3RTIB 2AAIB 1IOBA 3FJFA 3O49A 2D1ZA 4EFQA 3P53A 1ONKB 2Z49A 4OWLA 1AVWB 4HA2A 5DSSB 3T8SA 1XHBA 3O4CA 4KEJA 1R8NA 4MZFB 3AH1A 3H6RB 3KMVA 5BQUA 3NBDA 1PWAA 2NTDA 3BA5A 3RSJA 2P23A 2DRYA 3RMYA 3O44A 2NM1A 2X2SA 3WO3A 3BA4A 1OQLB 3CRHA 4LO0A 2Y9GA 1WD3A 3WMVA 1HIBA 3BRGC 1P63A 4I8MA 4IONA 2UUSA 1ISVA 4GAIA 3WO4A 2MIBA 5JLVA 1BFFA 1V6UA 3NBCA 1ISZA 1YF8B 1BARA 5F90A 4DCKC 4G6JA 1PC8B 2J3PA 3SNVA 1HWOB 3UD8A 3VSFA 1W3AA 4XFTA 1UPSA 3CA6A 1Q1UA 4KC3A 2L5XA 1IT0A 3ILAA 1M16A 2HZ9A 3FGMA 3ZXGA 4KBBA 4EB2B 2BEAA 3H6RA 3O5WB 5BQUC 3WO2A 4UY4A 2KH2A 3V0AB 21BIA 2VSEA 3FJCA 3H6QA 1K5UA 5BVPI 4Z9WB 4I4XA 4I1EA 5FZZA 4LO0C 1S0CA 2AXMA 3QYDA 4I0YA 4L4IA 5BOWA 3AZVA 2D23A 4I7IA 5BXSA 3WINA 1S0LA 2RG9B 3UD9A 3NBEA 4I4UA 1AVUA 2NVHA 5D61A 4A7YA 1I1EA 4II0A 5B2HA 3VT0A 4I4SA 4I4QA 2IHOA 3PMEA 1JLXA 3N7JA 4ZFWB 1W3FA 1V6XA 3A21A 3WA1A 4Z8SB 1TWMA 2Q3NB 4PC4A 4J23B 4I4OA 1HWNB 3N7KA 4J2XA 1V6WA 2ZR1B 3Q7WA 2D22A 3FJDA 2WBCA 1W3GA 3AKIA 4KEIA 1ABRB 3BAVA 5BXPA 1HCDA 4LO7C 1MD6A 4H04A 3V0AA 3CQAA 5G00A 1AVXB 5DVHA 2DRZA 4X3AA 4I96A 1FQ9A 1PUMB 3I2XA 3BAOA 1MC9A 1BASA 4IYBA 4JKQA 1FWUA 3W9TA 1NZKA 2D44A 4X39A 4JPZA 3WINC 2Q9XA 2M49A 1M2TB 1Z4SA 3CRIA 3AKGA 3OBTA 1XG6A 3P6IA 3FJIA 1VCLA 4G9MA 5BP5A 5FZUA 4EEEB 6I1BA 1IRAX 2WRYA 2KKIA 5HPZA 4F83A 1DIWA 2D43A 4Q91A 1DQGA 4FGFA 1F31A 2ZQOA 3PHZA 41BIA 7I1BA 3N7LA 1YYNA 5DZUA 4QD2B 3AH2A 4IY8A 4ZGRB 2FO1A 4G6MA 1EVTA 4LO3A 1EYLA 3FJEA 3FUOA 1DLLA 1NUNA 2HWMA 1FWVA 1ISWA 4JAWA 3AKFA 4OUJA 4JKXB 3Q7XA 2LIEA 4LO8B 4XKIA 1G9CA 1DFCA 1TWEA 2GO2A 1G9DA 1IILA 1S0EA 4OEFA 3HSMA 1ISYA 3VSZA 2MC2A 4QO3A 3TC2A 1II4A 4XFSA 1IHKA 3AKHA 3O4BA 1FV3A 4ZKTB 1G9AA 3FJJA 2KI6B 1Z0HA 4EFRA 5BXRA 4EFPA 3ZC8A 1JY0A 3FJAA 1TP0A 2D7RA 1AF9A 5BP5C 3D7WB 3BX1C 1IJTA 9ILBA 3B9UA 3CU1B 1FV2A 4ZOTA 4R6UB 2VXTI 1HWPB 5E24E 4A7ZA 3AJ6A 2K4AB 1RZOB 3OJ2A 4DENA 4LO1A 3LLPA 2VSAA 4I4VA 4LO3C 2YUGA 4KEKA 4OWJA 3V79C 3MPPG 4L4HA 1BFGA 1SZ6B 3HALA 3IM7A 1RG8A 1DZCA 4J2SA 1JLYA 4YOLA 4F34A 4I37A 2K43A 2ERMA 2HWAA 5GAQA 4I1BA 1S0DA 2X2TA 4JQ0A 3HOMA 3EF2A 3CAHA 1Q04A 3P6JA 4J2KA 5EG6C 4OW4A 3BB2A 4X37A 4ZBVB 4GOVA 3NBNA 4FVVA 3H6SE 1WD4A 1JTCA 1SR4A 1BFBA 3BRDA 4P0JA 3ZX7A 2ET2A 2R9KB 1DJSB 1ISXA 5D63A 4QALA 3BAGA 1CVSA 2GZBA 4QKRA 3PG0A 4OWKA 2I1BA 4AN7B 1YBIA 1QQKA 3HN1A 2E4MA 3V0BB 3CA1A 3BAHA 3QR5A 1AFCA 4LO1C 3FJ9A 4WBCA 1V6VA 3POKA 31BIA 1XYFA 1BA7A 3CRGA 1BLDA 2F8XC 3CA0A 4GP3A 2DS0A 4MZHA 3I29B 4USPA 3R4UA 4QC4A 4G1RA 3UJ4A 4GP0A 3Q7YA 4IY9A 2D24A 1JT3A 1GGPB 4MZGB 4EKXB 1AXMA 1Z2VA 4ZFYB 1EPWA 2RSTA 2F2FA 1BLAA 1SR4C 3CA3A 3I2AA 2K8RA 4X38A 5F8SA 2KI4A 5EC5A 3WMUA 4JRAA 1FN0A 4ZA3B 2IWTB 1HWMB 1EV2A 1A8DA 3VT2A 1JT5A 4IZXA 4QBVA 4ZFUB 2NYYA 3JUTA 3S8KA 4I6IA 4CJMA 2FFVA 4JP0A 3IAGC 2E4MC 4OEEA 3F1RA 2ESUA 3ZC9A 1L2HA 3BAUA 2VU9A 1YXWA 3IM6A 4J2YA 4ENDA 2D20A 3FFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J0S A;  2LIQ A;  3A23 A;  3AH4 A;  3LTQ A;  1G82 A;  1ILR 1;  1WBC A;  1AVA C;  3N0K A;  5DUY A;  1JT7 A;  5F8W A;  1DFQ A;  4LO7 B;  1FMZ A;  3ZXD A;  3UJ0 A;  1BFC A;  3PUB A;  2FGF A;  2D7I A;  4ISQ A;  1KNM A;  1T9F A;  3O4A A;  4HR6 C;  4D8H A;  2F2F C;  1T4Q A;  3CA5 A;  4XFU A;  4I2S A;  1DZD A;  2KLL A;  3NJ5 A;  4IZE A;  4P6A A;  1Q03 A;  3FJB A;  3N7M A;  3F62 B;  3OBR A;  1IRP A;  4I3N A;  8I1B A;  1XZZ A;  3OGF A;  3FUQ A;  5D62 A;  3BRF A;  2QYI B;  3VUO A;  3VWC A;  3JRR A;  3OGG A;  2VXR A;  4GAF A;  4IQP A;  1QQL A;  1S0F A;  1JT4 A;  2QN4 A;  4I4Y A;  3AJ5 A;  3A07 A;  3O4O A;  1TFM B;  2ZQN A;  1TIE A;  3UDA A;  3S8J A;  3A22 A;  4Q9P A;  3BTA A;  1E0O A;  4QKS A;  2DRE A;  2FDB M;  5FNX A;  1TOO A;  1S0G A;  5EHA A;  5F8Y A;  3FJH A;  4LO2 A;  5FZY A;  2MLL B;  3OJM A;  3O3Q A;  2XOA A;  2RQ9 A;  2Y9W C;  4G9N A;  3VT1 A;  4TLP A;  5I1B A;  2P39 A;  2Y9F A;  1FGA A;  4H9W A;  4QD2 C;  3CA4 A;  2AQZ A;  2VLC A;  5BXT A;  1QXM A;  4I4P A;  3FJK A;  1S0B A;  1CE7 B;  3E8L C;  4DEP A;  3R4S A;  1HKN A;  4D0Z A;  2Z48 A;  1N4K A;  4QBC A;  4USO A;  2FFU A;  1TTU A;  3HMY A;  1JQZ A;  2BEB A;  3AZW A;  5FNW A;  4Q9G A;  3BAD A;  4A7K A;  1PUU B;  2BFH A;  1FMM S;  3BA7 A;  1ITB A;  2VUA A;  4ZLB B;  3RMX A;  3OJV A;  4OEG A;  1D0H A;  4I4R A;  1YTO A;  3O4D A;  1DQO A;  4P0L A;  1RML A;  4D0T A;  4LO2 C;  3MAL A;  4HJJ A;  2NP0 A;  4AN6 A;  2AFG A;  2NZ9 A;  3C9Z A;  3FJ8 A;  4GOY A;  3BAQ A;  3RTJ B;  1K5V A;  3K1X A;  1R8O A;  3HBW A;  3UD7 A;  1PZZ A;  1RY7 A;  2Y9X E;  3V0B A;  1HCE A;  1G9B A;  4ISR A;  5JMC A;  1WBA A;  3IIR A;  3IM5 A;  3VEQ A;  1I1B A;  2HW9 A;  4P0K A;  4IHZ A;  3RTI B;  2AAI B;  1IOB A;  3FJF A;  3O49 A;  2D1Z A;  4EFQ A;  3P53 A;  1ONK B;  2Z49 A;  4OWL A;  1AVW B;  4HA2 A;  5DSS B;  3T8S A;  1XHB A;  3O4C A;  4KEJ A;  1R8N A;  3AH1 A;  3H6R B;  3KMV A;  5BQU A;  3NBD A;  1PWA A;  2NTD A;  3BA5 A;  3RSJ A;  2P23 A;  2DRY A;  3RMY A;  3O44 A;  2NM1 A;  2X2S A;  3WO3 A;  3BA4 A;  1OQL B;  3CRH A;  4LO0 A;  2Y9G A;  1WD3 A;  3WMV A;  1HIB A;  3BRG C;  1P63 A;  4I8M A;  4ION A;  2UUS A;  1ISV A;  4GAI A;  3WO4 A;  2MIB A;  5JLV A;  1BFF A;  1V6U A;  3NBC A;  1ISZ A;  1YF8 B;  1BAR A;  5F90 A;  4DCK C;  4G6J A;  1PC8 B;  2J3P A;  3SNV A;  1HWO B;  3UD8 A;  3VSF A;  1W3A A;  4XFT A;  1UPS A;  3CA6 A;  1Q1U A;  4KC3 A;  2L5X A;  1IT0 A;  3ILA A;  1M16 A;  2HZ9 A;  3FGM A;  3ZXG A;  4KBB A;  4EB2 B;  2BEA A;  3H6R A;  3O5W B;  5BQU C;  3WO2 A;  2KH2 A;  3V0A B;  21BI A;  2VSE A;  3FJC A;  3H6Q A;  1K5U A;  5BVP I;  4Z9W B;  4I4X A;  4I1E A;  5FZZ A;  4LO0 C;  1S0C A;  2AXM A;  3QYD A;  4I0Y A;  4L4I A;  5BOW A;  3AZV A;  2D23 A;  4I7I A;  5BXS A;  3WIN A;  1S0L A;  2RG9 B;  3UD9 A;  3NBE A;  4I4U A;  1AVU A;  2NVH A;  5D61 A;  4A7Y A;  1I1E A;  4II0 A;  5B2H A;  3VT0 A;  4I4S A;  4I4Q A;  2IHO A;  3PME A;  1JLX A;  3N7J A;  4ZFW B;  1W3F A;  1V6X A;  3A21 A;  3WA1 A;  4Z8S B;  1TWM A;  2Q3N B;  4PC4 A;  4J23 B;  4I4O A;  1HWN B;  3N7K A;  4J2X A;  1V6W A;  2ZR1 B;  3Q7W A;  2D22 A;  3FJD A;  2WBC A;  1W3G A;  3AKI A;  4KEI A;  1ABR B;  3BAV A;  5BXP A;  1HCD A;  4LO7 C;  1MD6 A;  4H04 A;  3V0A A;  3CQA A;  5G00 A;  1AVX B;  5DVH A;  2DRZ A;  4X3A A;  4I96 A;  1FQ9 A;  1PUM B;  3I2X A;  3BAO A;  1MC9 A;  1BAS A;  4IYB A;  4JKQ A;  1FWU A;  3W9T A;  1NZK A;  2D44 A;  4X39 A;  4JPZ A;  3WIN C;  2Q9X A;  2M49 A;  1M2T B;  1Z4S A;  3CRI A;  3AKG A;  3OBT A;  1XG6 A;  3P6I A;  3FJI A;  1VCL A;  4G9M A;  5BP5 A;  5FZU A;  4EEE B;  6I1B A;  1IRA X;  2WRY A;  2KKI A;  5HPZ A;  4F83 A;  1DIW A;  2D43 A;  4Q91 A;  1DQG A;  4FGF A;  1F31 A;  2ZQO A;  3PHZ A;  41BI A;  7I1B A;  3N7L A;  1YYN A;  5DZU A;  4QD2 B;  3AH2 A;  4IY8 A;  4ZGR B;  2FO1 A;  4G6M A;  1EVT A;  4LO3 A;  1EYL A;  3FJE A;  3FUO A;  1DLL A;  1NUN A;  2HWM A;  1FWV A;  1ISW A;  4JAW A;  3AKF A;  4OUJ A;  4JKX B;  3Q7X A;  2LIE A;  4LO8 B;  4XKI A;  1G9C A;  1DFC A;  1TWE A;  2GO2 A;  1G9D A;  1IIL A;  1S0E A;  4OEF A;  3HSM A;  1ISY A;  3VSZ A;  2MC2 A;  4QO3 A;  3TC2 A;  1II4 A;  4XFS A;  1IHK A;  3AKH A;  3O4B A;  1FV3 A;  4ZKT B;  1G9A A;  3FJJ A;  2KI6 B;  1Z0H A;  4EFR A;  5BXR A;  4EFP A;  3ZC8 A;  1JY0 A;  3FJA A;  1TP0 A;  2D7R A;  1AF9 A;  5BP5 C;  3D7W B;  3BX1 C;  1IJT A;  9ILB A;  3B9U A;  3CU1 B;  1FV2 A;  4ZOT A;  4R6U B;  2VXT I;  1HWP B;  5E24 E;  4A7Z A;  3AJ6 A;  2K4A B;  1RZO B;  3OJ2 A;  4DEN A;  4LO1 A;  3LLP A;  2VSA A;  4I4V A;  4LO3 C;  2YUG A;  4KEK A;  4OWJ A;  3V79 C;  3MPP G;  4L4H A;  1BFG A;  1SZ6 B;  3HAL A;  3IM7 A;  1RG8 A;  1DZC A;  4J2S A;  1JLY A;  4YOL A;  4F34 A;  4I37 A;  2K43 A;  2ERM A;  2HWA A;  5GAQ A;  4I1B A;  1S0D A;  2X2T A;  4JQ0 A;  3HOM A;  3EF2 A;  3CAH A;  1Q04 A;  3P6J A;  4J2K A;  5EG6 C;  4OW4 A;  3BB2 A;  4X37 A;  4ZBV B;  4GOV A;  3NBN A;  4FVV A;  3H6S E;  1WD4 A;  1JTC A;  1SR4 A;  1BFB A;  3BRD A;  4P0J A;  3ZX7 A;  2ET2 A;  2R9K B;  1DJS B;  1ISX A;  5D63 A;  4QAL A;  3BAG A;  1CVS A;  2GZB A;  4QKR A;  3PG0 A;  4OWK A;  2I1B A;  4AN7 B;  1YBI A;  1QQK A;  3HN1 A;  2E4M A;  3V0B B;  3CA1 A;  3BAH A;  3QR5 A;  1AFC A;  4LO1 C;  3FJ9 A;  4WBC A;  1V6V A;  3POK A;  31BI A;  1XYF A;  1BA7 A;  3CRG A;  1BLD A;  2F8X C;  3CA0 A;  4GP3 A;  2DS0 A;  3I29 B;  4USP A;  3R4U A;  4QC4 A;  4G1R A;  3UJ4 A;  4GP0 A;  3Q7Y A;  4IY9 A;  2D24 A;  1JT3 A;  1GGP B;  4EKX B;  1AXM A;  1Z2V A;  4ZFY B;  1EPW A;  2RST A;  2F2F A;  1BLA A;  1SR4 C;  3CA3 A;  3I2A A;  2K8R A;  4X38 A;  5F8S A;  2KI4 A;  5EC5 A;  3WMU A;  4JRA A;  1FN0 A;  4ZA3 B;  2IWT B;  1HWM B;  1EV2 A;  1A8D A;  3VT2 A;  1JT5 A;  4IZX A;  4QBV A;  4ZFU B;  2NYY A;  3JUT A;  3S8K A;  4I6I A;  4CJM A;  2FFV A;  4JP0 A;  3IAG C;  2E4M C;  4OEE A;  3F1R A;  2ESU A;  3ZC9 A;  1L2H A;  3BAU A;  2VU9 A;  1YXW A;  3IM6 A;  4J2Y A;  4END A;  2D20 A;  3FFZ A; 
#chains in the Genus database with same CATH topology
 1J0S A;  2LIQ A;  3A23 A;  3AH4 A;  2NS2 A;  3LTQ A;  1G82 A;  1ILR 1;  1WBC A;  1AVA C;  3N0K A;  5DUY A;  1JT7 A;  5F8W A;  1DFQ A;  4LO7 B;  1FMZ A;  3ZXD A;  3UJ0 A;  1BFC A;  3PUB A;  2FGF A;  2D7I A;  4ISQ A;  1KNM A;  1T9F A;  3O4A A;  4HR6 C;  4D8H A;  2F2F C;  1T4Q A;  3CA5 A;  4XFU A;  4I2S A;  1DZD A;  2KLL A;  3NJ5 A;  4IZE A;  4P6A A;  1Q03 A;  3FJB A;  3N7M A;  3F62 B;  3OBR A;  1IRP A;  4I3N A;  8I1B A;  1XZZ A;  3OGF A;  3FUQ A;  5D62 A;  3BRF A;  2QYI B;  3VUO A;  3VWC A;  3JRR A;  3OGG A;  2VXR A;  4GAF A;  4IQP A;  1QQL A;  1S0F A;  1JT4 A;  2QN4 A;  4I4Y A;  3AJ5 A;  3A07 A;  3O4O A;  1TFM B;  2ZQN A;  1TIE A;  3UDA A;  3S8J A;  3A22 A;  4Q9P A;  3BTA A;  1E0O A;  4QKS A;  2DRE A;  2FDB M;  5FNX A;  1TOO A;  1S0G A;  5EHA A;  5F8Y A;  3FJH A;  4LO2 A;  5FZY A;  2MLL B;  3OJM A;  3O3Q A;  2XOA A;  2RQ9 A;  2Y9W C;  4G9N A;  3VT1 A;  4H75 A;  4TLP A;  5I1B A;  2P39 A;  2Y9F A;  1FGA A;  4H9W A;  4QD2 C;  3CA4 A;  2AQZ A;  2VLC A;  5BXT A;  1QXM A;  4I4P A;  3FJK A;  1S0B A;  1CE7 B;  3E8L C;  4DEP A;  3R4S A;  1HKN A;  4D0Z A;  2Z48 A;  1N4K A;  4QBC A;  4USO A;  2FFU A;  1TTU A;  3HMY A;  1JQZ A;  2BEB A;  3AZW A;  5FNW A;  4Q9G A;  3BAD A;  4A7K A;  1PUU B;  2BFH A;  1FMM S;  3BA7 A;  1ITB A;  2VUA A;  4ZLB B;  3RMX A;  3OJV A;  4OEG A;  1D0H A;  4I4R A;  1YTO A;  3O4D A;  1DQO A;  4P0L A;  1RML A;  4D0T A;  4LO2 C;  3MAL A;  4HJJ A;  2NP0 A;  4AN6 A;  2AFG A;  2NZ9 A;  3C9Z A;  3FJ8 A;  4GOY A;  3BAQ A;  3RTJ B;  1K5V A;  3K1X A;  1R8O A;  3HBW A;  3UD7 A;  1PZZ A;  1RY7 A;  2Y9X E;  3V0B A;  1HCE A;  1G9B A;  4ISR A;  5JMC A;  1WBA A;  3IIR A;  3IM5 A;  3VEQ A;  1I1B A;  2HW9 A;  4P0K A;  4IHZ A;  3RTI B;  2AAI B;  1IOB A;  3FJF A;  3O49 A;  2D1Z A;  4EFQ A;  3P53 A;  1ONK B;  2Z49 A;  4OWL A;  1AVW B;  4HA2 A;  5DSS B;  3T8S A;  1XHB A;  3O4C A;  4KEJ A;  1R8N A;  4MZF B;  3AH1 A;  3H6R B;  3KMV A;  5BQU A;  3NBD A;  1PWA A;  2NTD A;  3BA5 A;  3RSJ A;  2P23 A;  2DRY A;  3RMY A;  3O44 A;  2NM1 A;  2X2S A;  3WO3 A;  3BA4 A;  1OQL B;  3CRH A;  4LO0 A;  2Y9G A;  1WD3 A;  3WMV A;  1HIB A;  3BRG C;  1P63 A;  4I8M A;  4ION A;  2UUS A;  1ISV A;  4GAI A;  3WO4 A;  2MIB A;  5JLV A;  1BFF A;  1V6U A;  3NBC A;  1ISZ A;  1YF8 B;  1BAR A;  5F90 A;  4DCK C;  4G6J A;  1PC8 B;  2J3P A;  3SNV A;  1HWO B;  3UD8 A;  3VSF A;  1W3A A;  4XFT A;  1UPS A;  3CA6 A;  1Q1U A;  4KC3 A;  2L5X A;  1IT0 A;  3ILA A;  1M16 A;  2HZ9 A;  3FGM A;  3ZXG A;  4KBB A;  4EB2 B;  2BEA A;  3H6R A;  3O5W B;  5BQU C;  3WO2 A;  4UY4 A;  2KH2 A;  3V0A B;  21BI A;  2VSE A;  3FJC A;  3H6Q A;  1K5U A;  5BVP I;  4Z9W B;  4I4X A;  4I1E A;  5FZZ A;  4LO0 C;  1S0C A;  2AXM A;  3QYD A;  4I0Y A;  4L4I A;  5BOW A;  3AZV A;  2D23 A;  4I7I A;  5BXS A;  3WIN A;  1S0L A;  2RG9 B;  3UD9 A;  3NBE A;  4I4U A;  1AVU A;  2NVH A;  5D61 A;  4A7Y A;  1I1E A;  4II0 A;  5B2H A;  3VT0 A;  4I4S A;  4I4Q A;  2IHO A;  3PME A;  1JLX A;  3N7J A;  4ZFW B;  1W3F A;  1V6X A;  3A21 A;  3WA1 A;  4Z8S B;  1TWM A;  2Q3N B;  4PC4 A;  4J23 B;  4I4O A;  1HWN B;  3N7K A;  4J2X A;  1V6W A;  2ZR1 B;  3Q7W A;  2D22 A;  3FJD A;  2WBC A;  1W3G A;  3AKI A;  4KEI A;  1ABR B;  3BAV A;  5BXP A;  1HCD A;  4LO7 C;  1MD6 A;  4H04 A;  3V0A A;  3CQA A;  5G00 A;  1AVX B;  5DVH A;  2DRZ A;  4X3A A;  4I96 A;  1FQ9 A;  1PUM B;  3I2X A;  3BAO A;  1MC9 A;  1BAS A;  4IYB A;  4JKQ A;  1FWU A;  3W9T A;  1NZK A;  2D44 A;  4X39 A;  4JPZ A;  3WIN C;  2Q9X A;  2M49 A;  1M2T B;  1Z4S A;  3CRI A;  3AKG A;  3OBT A;  1XG6 A;  3P6I A;  3FJI A;  1VCL A;  4G9M A;  5BP5 A;  5FZU A;  4EEE B;  6I1B A;  1IRA X;  2WRY A;  2KKI A;  5HPZ A;  4F83 A;  1DIW A;  2D43 A;  4Q91 A;  1DQG A;  4FGF A;  1F31 A;  2ZQO A;  3PHZ A;  41BI A;  7I1B A;  3N7L A;  1YYN A;  5DZU A;  4QD2 B;  3AH2 A;  4IY8 A;  4ZGR B;  2FO1 A;  4G6M A;  1EVT A;  4LO3 A;  1EYL A;  3FJE A;  3FUO A;  1DLL A;  1NUN A;  2HWM A;  1FWV A;  1ISW A;  4JAW A;  3AKF A;  4OUJ A;  4JKX B;  3Q7X A;  2LIE A;  4LO8 B;  4XKI A;  1G9C A;  1DFC A;  1TWE A;  2GO2 A;  1G9D A;  1IIL A;  1S0E A;  4OEF A;  3HSM A;  1ISY A;  3VSZ A;  2MC2 A;  4QO3 A;  3TC2 A;  1II4 A;  4XFS A;  1IHK A;  3AKH A;  3O4B A;  1FV3 A;  4ZKT B;  1G9A A;  3FJJ A;  2KI6 B;  1Z0H A;  4EFR A;  5BXR A;  4EFP A;  3ZC8 A;  1JY0 A;  3FJA A;  1TP0 A;  2D7R A;  1AF9 A;  5BP5 C;  3D7W B;  3BX1 C;  1IJT A;  9ILB A;  3B9U A;  3CU1 B;  1FV2 A;  4ZOT A;  4R6U B;  2VXT I;  1HWP B;  5E24 E;  4A7Z A;  3AJ6 A;  2K4A B;  1RZO B;  3OJ2 A;  4DEN A;  4LO1 A;  3LLP A;  2VSA A;  4I4V A;  4LO3 C;  2YUG A;  4KEK A;  4OWJ A;  3V79 C;  3MPP G;  4L4H A;  1BFG A;  1SZ6 B;  3HAL A;  3IM7 A;  1RG8 A;  1DZC A;  4J2S A;  1JLY A;  4YOL A;  4F34 A;  4I37 A;  2K43 A;  2ERM A;  2HWA A;  5GAQ A;  4I1B A;  1S0D A;  2X2T A;  4JQ0 A;  3HOM A;  3EF2 A;  3CAH A;  1Q04 A;  3P6J A;  4J2K A;  5EG6 C;  4OW4 A;  3BB2 A;  4X37 A;  4ZBV B;  4GOV A;  3NBN A;  4FVV A;  3H6S E;  1WD4 A;  1JTC A;  1SR4 A;  1BFB A;  3BRD A;  4P0J A;  3ZX7 A;  2ET2 A;  2R9K B;  1DJS B;  1ISX A;  5D63 A;  4QAL A;  3BAG A;  1CVS A;  2GZB A;  4QKR A;  3PG0 A;  4OWK A;  2I1B A;  4AN7 B;  1YBI A;  1QQK A;  3HN1 A;  2E4M A;  3V0B B;  3CA1 A;  3BAH A;  3QR5 A;  1AFC A;  4LO1 C;  3FJ9 A;  4WBC A;  1V6V A;  3POK A;  31BI A;  1XYF A;  1BA7 A;  3CRG A;  1BLD A;  2F8X C;  3CA0 A;  4GP3 A;  2DS0 A;  4MZH A;  3I29 B;  4USP A;  3R4U A;  4QC4 A;  4G1R A;  3UJ4 A;  4GP0 A;  3Q7Y A;  4IY9 A;  2D24 A;  1JT3 A;  1GGP B;  4MZG B;  4EKX B;  1AXM A;  1Z2V A;  4ZFY B;  1EPW A;  2RST A;  2F2F A;  1BLA A;  1SR4 C;  3CA3 A;  3I2A A;  2K8R A;  4X38 A;  5F8S A;  2KI4 A;  5EC5 A;  3WMU A;  4JRA A;  1FN0 A;  4ZA3 B;  2IWT B;  1HWM B;  1EV2 A;  1A8D A;  3VT2 A;  1JT5 A;  4IZX A;  4QBV A;  4ZFU B;  2NYY A;  3JUT A;  3S8K A;  4I6I A;  4CJM A;  2FFV A;  4JP0 A;  3IAG C;  2E4M C;  4OEE A;  3F1R A;  2ESU A;  3ZC9 A;  1L2H A;  3BAU A;  2VU9 A;  1YXW A;  3IM6 A;  4J2Y A;  4END A;  2D20 A;  3FFZ A; 
#chains in the Genus database with same CATH homology
 1J0S A;  2LIQ A;  3A23 A;  3AH4 A;  2NS2 A;  3LTQ A;  1G82 A;  1ILR 1;  1WBC A;  1AVA C;  3N0K A;  5DUY A;  1JT7 A;  5F8W A;  1DFQ A;  4LO7 B;  1FMZ A;  3ZXD A;  3UJ0 A;  1BFC A;  3PUB A;  2FGF A;  2D7I A;  4ISQ A;  1KNM A;  1T9F A;  3O4A A;  4HR6 C;  4D8H A;  2F2F C;  1T4Q A;  3CA5 A;  4XFU A;  4I2S A;  1DZD A;  2KLL A;  3NJ5 A;  4IZE A;  4P6A A;  1Q03 A;  3FJB A;  3N7M A;  3F62 B;  3OBR A;  1IRP A;  4I3N A;  8I1B A;  1XZZ A;  3OGF A;  3FUQ A;  5D62 A;  3BRF A;  2QYI B;  3VUO A;  3VWC A;  3JRR A;  3OGG A;  2VXR A;  4GAF A;  4IQP A;  1QQL A;  1S0F A;  1JT4 A;  2QN4 A;  4I4Y A;  3AJ5 A;  3A07 A;  3O4O A;  1TFM B;  2ZQN A;  1TIE A;  3UDA A;  3S8J A;  3A22 A;  4Q9P A;  3BTA A;  1E0O A;  4QKS A;  2DRE A;  2FDB M;  5FNX A;  1TOO A;  1S0G A;  5EHA A;  5F8Y A;  3FJH A;  4LO2 A;  5FZY A;  2MLL B;  3OJM A;  3O3Q A;  2XOA A;  2RQ9 A;  2Y9W C;  4G9N A;  3VT1 A;  4H75 A;  4TLP A;  5I1B A;  2P39 A;  2Y9F A;  1FGA A;  4H9W A;  4QD2 C;  3CA4 A;  2AQZ A;  2VLC A;  5BXT A;  1QXM A;  4I4P A;  3FJK A;  1S0B A;  1CE7 B;  3E8L C;  4DEP A;  3R4S A;  1HKN A;  4D0Z A;  2Z48 A;  1N4K A;  4QBC A;  4USO A;  2FFU A;  1TTU A;  3HMY A;  1JQZ A;  2BEB A;  3AZW A;  5FNW A;  4Q9G A;  3BAD A;  4A7K A;  1PUU B;  2BFH A;  1FMM S;  3BA7 A;  1ITB A;  2VUA A;  4ZLB B;  3RMX A;  3OJV A;  4OEG A;  1D0H A;  4I4R A;  1YTO A;  3O4D A;  1DQO A;  4P0L A;  1RML A;  4D0T A;  4LO2 C;  3MAL A;  4HJJ A;  2NP0 A;  4AN6 A;  2AFG A;  2NZ9 A;  3C9Z A;  3FJ8 A;  4GOY A;  3BAQ A;  3RTJ B;  1K5V A;  3K1X A;  1R8O A;  3HBW A;  3UD7 A;  1PZZ A;  1RY7 A;  2Y9X E;  3V0B A;  1HCE A;  1G9B A;  4ISR A;  5JMC A;  1WBA A;  3IIR A;  3IM5 A;  3VEQ A;  1I1B A;  2HW9 A;  4P0K A;  4IHZ A;  3RTI B;  2AAI B;  1IOB A;  3FJF A;  3O49 A;  2D1Z A;  4EFQ A;  3P53 A;  1ONK B;  2Z49 A;  4OWL A;  1AVW B;  4HA2 A;  5DSS B;  3T8S A;  1XHB A;  3O4C A;  4KEJ A;  1R8N A;  4MZF B;  3AH1 A;  3H6R B;  3KMV A;  5BQU A;  3NBD A;  1PWA A;  2NTD A;  3BA5 A;  3RSJ A;  2P23 A;  2DRY A;  3RMY A;  3O44 A;  2NM1 A;  2X2S A;  3WO3 A;  3BA4 A;  1OQL B;  3CRH A;  4LO0 A;  2Y9G A;  1WD3 A;  3WMV A;  1HIB A;  3BRG C;  1P63 A;  4I8M A;  4ION A;  2UUS A;  1ISV A;  4GAI A;  3WO4 A;  2MIB A;  5JLV A;  1BFF A;  1V6U A;  3NBC A;  1ISZ A;  1YF8 B;  1BAR A;  5F90 A;  4DCK C;  4G6J A;  1PC8 B;  2J3P A;  3SNV A;  1HWO B;  3UD8 A;  3VSF A;  1W3A A;  4XFT A;  1UPS A;  3CA6 A;  1Q1U A;  4KC3 A;  2L5X A;  1IT0 A;  3ILA A;  1M16 A;  2HZ9 A;  3FGM A;  3ZXG A;  4KBB A;  4EB2 B;  2BEA A;  3H6R A;  3O5W B;  5BQU C;  3WO2 A;  4UY4 A;  2KH2 A;  3V0A B;  21BI A;  2VSE A;  3FJC A;  3H6Q A;  1K5U A;  5BVP I;  4Z9W B;  4I4X A;  4I1E A;  5FZZ A;  4LO0 C;  1S0C A;  2AXM A;  3QYD A;  4I0Y A;  4L4I A;  5BOW A;  3AZV A;  2D23 A;  4I7I A;  5BXS A;  3WIN A;  1S0L A;  2RG9 B;  3UD9 A;  3NBE A;  4I4U A;  1AVU A;  2NVH A;  5D61 A;  4A7Y A;  1I1E A;  4II0 A;  5B2H A;  3VT0 A;  4I4S A;  4I4Q A;  2IHO A;  3PME A;  1JLX A;  3N7J A;  4ZFW B;  1W3F A;  1V6X A;  3A21 A;  3WA1 A;  4Z8S B;  1TWM A;  2Q3N B;  4PC4 A;  4J23 B;  4I4O A;  1HWN B;  3N7K A;  4J2X A;  1V6W A;  2ZR1 B;  3Q7W A;  2D22 A;  3FJD A;  2WBC A;  1W3G A;  3AKI A;  4KEI A;  1ABR B;  3BAV A;  5BXP A;  1HCD A;  4LO7 C;  1MD6 A;  4H04 A;  3V0A A;  3CQA A;  5G00 A;  1AVX B;  5DVH A;  2DRZ A;  4X3A A;  4I96 A;  1FQ9 A;  1PUM B;  3I2X A;  3BAO A;  1MC9 A;  1BAS A;  4IYB A;  4JKQ A;  1FWU A;  3W9T A;  1NZK A;  2D44 A;  4X39 A;  4JPZ A;  3WIN C;  2Q9X A;  2M49 A;  1M2T B;  1Z4S A;  3CRI A;  3AKG A;  3OBT A;  1XG6 A;  3P6I A;  3FJI A;  1VCL A;  4G9M A;  5BP5 A;  5FZU A;  4EEE B;  6I1B A;  1IRA X;  2WRY A;  2KKI A;  5HPZ A;  4F83 A;  1DIW A;  2D43 A;  4Q91 A;  1DQG A;  4FGF A;  1F31 A;  2ZQO A;  3PHZ A;  41BI A;  7I1B A;  3N7L A;  1YYN A;  5DZU A;  4QD2 B;  3AH2 A;  4IY8 A;  4ZGR B;  2FO1 A;  4G6M A;  1EVT A;  4LO3 A;  1EYL A;  3FJE A;  3FUO A;  1DLL A;  1NUN A;  2HWM A;  1FWV A;  1ISW A;  4JAW A;  3AKF A;  4OUJ A;  4JKX B;  3Q7X A;  2LIE A;  4LO8 B;  4XKI A;  1G9C A;  1DFC A;  1TWE A;  2GO2 A;  1G9D A;  1IIL A;  1S0E A;  4OEF A;  3HSM A;  1ISY A;  3VSZ A;  2MC2 A;  4QO3 A;  3TC2 A;  1II4 A;  4XFS A;  1IHK A;  3AKH A;  3O4B A;  1FV3 A;  4ZKT B;  1G9A A;  3FJJ A;  2KI6 B;  1Z0H A;  4EFR A;  5BXR A;  4EFP A;  3ZC8 A;  1JY0 A;  3FJA A;  1TP0 A;  2D7R A;  1AF9 A;  5BP5 C;  3D7W B;  3BX1 C;  1IJT A;  9ILB A;  3B9U A;  3CU1 B;  1FV2 A;  4ZOT A;  4R6U B;  2VXT I;  1HWP B;  5E24 E;  4A7Z A;  3AJ6 A;  2K4A B;  1RZO B;  3OJ2 A;  4DEN A;  4LO1 A;  3LLP A;  2VSA A;  4I4V A;  4LO3 C;  2YUG A;  4KEK A;  4OWJ A;  3V79 C;  3MPP G;  4L4H A;  1BFG A;  1SZ6 B;  3HAL A;  3IM7 A;  1RG8 A;  1DZC A;  4J2S A;  1JLY A;  4YOL A;  4F34 A;  4I37 A;  2K43 A;  2ERM A;  2HWA A;  5GAQ A;  4I1B A;  1S0D A;  2X2T A;  4JQ0 A;  3HOM A;  3EF2 A;  3CAH A;  1Q04 A;  3P6J A;  4J2K A;  5EG6 C;  4OW4 A;  3BB2 A;  4X37 A;  4ZBV B;  4GOV A;  3NBN A;  4FVV A;  3H6S E;  1WD4 A;  1JTC A;  1SR4 A;  1BFB A;  3BRD A;  4P0J A;  3ZX7 A;  2ET2 A;  2R9K B;  1DJS B;  1ISX A;  5D63 A;  4QAL A;  3BAG A;  1CVS A;  2GZB A;  4QKR A;  3PG0 A;  4OWK A;  2I1B A;  4AN7 B;  1YBI A;  1QQK A;  3HN1 A;  2E4M A;  3V0B B;  3CA1 A;  3BAH A;  3QR5 A;  1AFC A;  4LO1 C;  3FJ9 A;  4WBC A;  1V6V A;  3POK A;  31BI A;  1XYF A;  1BA7 A;  3CRG A;  1BLD A;  2F8X C;  3CA0 A;  4GP3 A;  2DS0 A;  4MZH A;  3I29 B;  4USP A;  3R4U A;  4QC4 A;  4G1R A;  3UJ4 A;  4GP0 A;  3Q7Y A;  4IY9 A;  2D24 A;  1JT3 A;  1GGP B;  4MZG B;  4EKX B;  1AXM A;  1Z2V A;  4ZFY B;  1EPW A;  2RST A;  2F2F A;  1BLA A;  1SR4 C;  3CA3 A;  3I2A A;  2K8R A;  4X38 A;  5F8S A;  2KI4 A;  5EC5 A;  3WMU A;  4JRA A;  1FN0 A;  4ZA3 B;  2IWT B;  1HWM B;  1EV2 A;  1A8D A;  3VT2 A;  1JT5 A;  4IZX A;  4QBV A;  4ZFU B;  2NYY A;  3JUT A;  3S8K A;  4I6I A;  4CJM A;  2FFV A;  4JP0 A;  3IAG C;  2E4M C;  4OEE A;  3F1R A;  2ESU A;  3ZC9 A;  1L2H A;  3BAU A;  2VU9 A;  1YXW A;  3IM6 A;  4J2Y A;  4END A;  2D20 A;  3FFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...