1ILR1

Crystal structure of the interleukin-1 receptor antagonist
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
145
structure length
145
Chain Sequence
b'SKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 RECEPTOR ANTAGONIST PROTEIN
publication title Refined crystal structure of the interleukin-1 receptor antagonist. Presence of a disulfide link and a cis-proline.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Binding protein
total genus 26
structure length 145
sequence length 145
chains with identical sequence 2
ec nomenclature
pdb deposition date 1994-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
1 PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1ilr100
2NZ9A 2Q9XA 3JUTA 1BFGA 3O4CA 4QBCA 2MLLB 3Q7WA 4JPZA 1BARA 1JLXA 1FV3A 3BA5A 4J2KA 2BFHA 5FZUA 3FJCA 3BA7A 4OUJA 3N7KA 2D1ZA 4IZEA 4R6UB 1L2HA 4CJMA 3FJDA 4EB2B 5FZYA 1CVSA 3HMYA 1V6UA 1BA7A 4ISQA 3BA4A 3CQAA 3UDAA 3W9TA 4G6MA 2WRYA 5BXSA 3V79C 2I1BA 5BP5C 2VSAA 3BAUA 3FJAA 5G00A 2ET2A 3WINC 1D0HA 3VT0A 3N7LA 4GP3A 1JT7A 1UPSA 5JLVA 2NVHA 4IY9A 4L4HA 6I1BA 2QN4A 4ZGRB 3IAGC 4IHZA 4IONA 4KC3A 4XFUA 3BAQA 3R4SA 3AKGA 3HN1A 4DEPA 3O44A 2GZBA 1HWMB 1JT3A 2KH2A 3BAOA 3O4DA 3AKHA 1IRAX 5EC5A 1MD6A 2LIEA 4QBVA 1QXMA 1K5VA 3VSFA 4I4OA 4J2SA 2AQZA 2ZR1B 2VU9A 1BASA 5FZZA 4GOYA 3CA5A 3PMEA 1XHBA 4QO3A 3N7MA 1ISXA 4H04A 1ITBA 4GAFA 1G9AA 2AXMA 3CRGA 4I4RA 2X2SA 3FJKA 4I1BA 1SZ6B 4ZKTB 1ISZA 3CA3A 41BIA 4I8MA 4I7IA 4LO3C 4XKIA 4F83A 2Y9WC 3WMVA 4QD2B 4Q9GA 4JKQA 3CRIA 2MC2A 4I6IA 1AXMA 4X39A 3AH4A 1R8OA 5BP5A 3AZVA 1JT5A 4L4IA 4X3AA 3VWCA 1TFMB 3F62B 1XYFA 1IHKA 5BQUA 4Q91A 2J3PA 4G6JA 4TLPA 3NJ5A 2D7IA 3SNVA 2FO1A 3BRGC 1Q03A 1FWVA 3WO2A 2Y9GA 3CA1A 1R8NA 4IQPA 1XZZA 1IT0A 3FJFA 4D0ZA 3HALA 2RG9B 3FJHA 2P23A 4EEEB 4I4QA 1S0BA 1S0CA 4GAIA 1DIWA 5DZUA 2VSEA 3O4OA 2WBCA 4LO7B 1W3FA 1DQOA 1HCEA 1S0LA 2IWTB 4QD2C 5D63A 1JTCA 1AFCA 3CA6A 4FVVA 2MIBA 4G9NA 3O49A 4JAWA 2R9KB 3JRRA 3I2AA 3CAHA 5BOWA 1W3GA 3BAGA 1J0SA 4I4VA 1FQ9A 3BAHA 4YOLA 3D7WB 4II0A 3NBNA 1FN0A 2HW9A 4G9MA 3VSZA 4LO3A 4OWJA 1Q1UA 3FJ8A 3ZC8A 2ZQNA 4HA2A 1HKNA 4ENDA 5F8SA 4D0TA 1TWEA 3K1XA 1N4KA 3BB2A 3F1RA 4Z9WB 3IIRA 4USOA 3HSMA 1II4A 4OEEA 3VT2A 1CE7B 3HBWA 3FJIA 5BQUC 4ZFWB 2KLLA 4KBBA 2BEBA 4Q9PA 5BXTA 4HJJA 2IHOA 3V0BA 2KKIA 5F90A 1M16A 2M49A 2ZQOA 4LO7C 1MC9A 4HR6C 1FMMS 2YUGA 4EKXB 8I1BA 2D24A 2HWAA 3I2XA 4JP0A 3LLPA 1VCLA 1G9DA 1PUMB 4D8HA 3FJEA 3OBTA 2AAIB 1Q04A 1V6XA 2L5XA 1IRPA 2GO2A 3CRHA 3V0BB 1V6WA 1WD4A 1HIBA 3IM7A 3BRDA 3CA4A 2DRYA 4GP0A 4I96A 2VXRA 4I1EA 3RTJB 1TWMA 3H6SE 3HOMA 4A7YA 1DZDA 1RMLA 3O3QA 3V0AA 3OBRA 3IM5A 3WA1A 1HWNB 3ILAA 1YTOA 3AKIA 1AVUA 4OW4A 2UUSA 2Y9FA 4WBCA 3UJ0A 1G9CA 4I4PA 1YXWA 3H6QA 4ZBVB 1FMZA 3BTAA 2F2FA 4I4XA 4ZLBB 3O4BA 4JKXB 2K4AB 4QALA 4I37A 4A7KA 1S0GA 3N0KA 1WD3A 3V0AB 4I0YA 4P0KA 1BFFA 2RSTA 4G1RA 1EPWA 3C9ZA 4FGFA 2P39A 2Y9XE 4P6AA 3VUOA 3O5WB 3UD8A 4LO0A 1IILA 1SR4A 1DFQA 4IYBA 2NP0A 5JMCA 2D22A 3Q7XA 4DENA 1HWPB 1HWOB 2E4MA 4KEKA 4J2XA 5F8WA 3RMYA 3AJ6A 3P6IA 2F8XC 3PHZA 2Z49A 2HWMA 5FNXA 3T8SA 1YF8B 2Q3NB 2XOAA 3S8JA 4ZFUB 2X2TA 4A7ZA 3PG0A 4OWKA 3MALA 3OJVA 1IJTA 2DS0A 1FWUA 3AH2A 4QKRA 1KNMA 2D20A 2KI4A 1ISYA 1QQLA 4F34A 5EHAA 1F31A 1EVTA 3OGGA 4JRAA 5FNWA 1IOBA 4EFQA 3ZX7A 3O4AA 4KEIA 1FV2A 1G82A 4PC4A 3UD7A 1RG8A 4I4YA 2FGFA 2DREA 2F2FC 4QKSA 1AVWB 5EG6C 3R4UA 4H9WA 2HZ9A 2VUAA 3P6JA 1YYNA 4I3NA 4P0JA 3H6RA 2D23A 3CA0A 1FGAA 2FFVA 2NYYA 2NM1A 3AJ5A 3FGMA 5F8YA 4LO1C 3AKFA 2D44A 3Q7YA 3WO4A 1NZKA 1NUNA 1JQZA 2NTDA 4QC4A 4LO0C 1SR4C 1S0DA 3E8LC 2BEAA 3AH1A 3H6RB 1BLAA 3FJJA 1TIEA 1Z2VA 3CU1B 1BFCA 2K8RA 2E4MC 1M2TB 3B9UA 4JQ0A 1BLDA 1DLLA 1G9BA 4J2YA 1TOOA 1RY7A 4ZOTA 4IY8A 5D61A 3OGFA 1P63A 3FJBA 1RZOB 1PZZA 9ILBA 3NBEA 7I1BA 1PC8B 1QQKA 31BIA 1TTUA 1DZCA 4KEJA 3PUBA 5BXRA 5BVPI 4GOVA 5BXPA 1ONKB 4X38A 1V6VA 1S0FA 2DRZA 4Z8SB 1T4QA 3ZC9A 4I4SA 1ISVA 5DUYA 3UJ4A 3TC2A 3IM6A 2VXTI 3A22A 1JT4A 1ABRB 1ILR1 2FDBM 5HPZA 1AVXB 1HCDA 1PWAA 3FFZA 3QYDA 3RMXA 4LO2A 4P0LA 3AZWA 5B2HA 3BRFA 1W3AA 2ESUA 1WBAA 5E24E 3P53A 2D43A 1DJSB 4DCKC 2VLCA 3NBCA 1TP0A 1WBCA 2AFGA 4OWLA 4I2SA 1BFBA 1XG6A 3UD9A 1K5UA 4XFTA 4EFPA 4XFSA 1EYLA 4LO1A 2LIQA 1I1EA 3RTIB 3FJ9A 3FUQA 5DSSB 1I1BA 1YBIA 3MPPG 2K43A 1Z0HA 3A07A 1JLYA 3QR5A 4J23B 4AN7B 1JY0A 1S0EA 3A21A 4ZFYB 5I1BA 3WO3A 3KMVA 3ZXGA 2FFUA 4EFRA 3N7JA 21BIA 4OEFA 4OEGA 4I4UA 4X37A 3VT1A 1T9FA 3RSJA 3BAVA 1EV2A 3S8KA 3WINA 2QYIB 3ZXDA 1DQGA 3OJ2A 1Z4SA 5DVHA 4IZXA 1OQLB 2D7RA 2RQ9A 3NBDA 4LO8B 4USPA 3OJMA 4LO2C 3BX1C 4ISRA 3POKA 5GAQA 1PUUB 1DFCA 2ERMA 3A23A 3BADA 2KI6B 3I29B 4AN6A 3EF2A 2Z48A 3VEQA 1AVAC 1GGPB 1AF9A 3FUOA 3WMUA 5D62A 4ZA3B 1A8DA 3LTQA 1E0OA 1ISWA
chains in the Genus database with same CATH superfamily
2NZ9A 2Q9XA 3JUTA 1BFGA 3O4CA 4QBCA 2MLLB 3Q7WA 4JPZA 1BARA 1JLXA 1FV3A 3BA5A 4J2KA 2BFHA 5FZUA 3FJCA 3BA7A 4OUJA 3N7KA 2D1ZA 4IZEA 4R6UB 1L2HA 4CJMA 3FJDA 4EB2B 5FZYA 1CVSA 3HMYA 1V6UA 1BA7A 4ISQA 3BA4A 3CQAA 3UDAA 3W9TA 4G6MA 2WRYA 5BXSA 3V79C 2I1BA 5BP5C 2VSAA 3BAUA 3FJAA 5G00A 2ET2A 3WINC 1D0HA 3VT0A 3N7LA 4GP3A 1JT7A 1UPSA 5JLVA 2NVHA 4IY9A 4L4HA 6I1BA 2QN4A 4ZGRB 3IAGC 4IHZA 4IONA 4KC3A 4XFUA 3BAQA 3R4SA 3AKGA 3HN1A 4DEPA 3O44A 2GZBA 1HWMB 1JT3A 2KH2A 3BAOA 3O4DA 3AKHA 1IRAX 5EC5A 1MD6A 2LIEA 4QBVA 1QXMA 1K5VA 3VSFA 4I4OA 4J2SA 2AQZA 2ZR1B 2VU9A 1BASA 5FZZA 4GOYA 3CA5A 3PMEA 1XHBA 4QO3A 3N7MA 1ISXA 4H04A 1ITBA 4GAFA 1G9AA 2AXMA 3CRGA 4I4RA 2X2SA 3FJKA 4I1BA 1SZ6B 4ZKTB 1ISZA 3CA3A 41BIA 4I8MA 4I7IA 4LO3C 4XKIA 4F83A 2Y9WC 3WMVA 4QD2B 4Q9GA 4JKQA 3CRIA 2MC2A 4I6IA 1AXMA 4X39A 3AH4A 1R8OA 5BP5A 3AZVA 1JT5A 4L4IA 4X3AA 3VWCA 1TFMB 3F62B 1XYFA 1IHKA 5BQUA 4Q91A 4UY4A 2J3PA 4G6JA 4TLPA 3NJ5A 2D7IA 3SNVA 2FO1A 3BRGC 1Q03A 1FWVA 3WO2A 2Y9GA 3CA1A 1R8NA 4IQPA 1XZZA 1IT0A 3FJFA 4D0ZA 3HALA 2RG9B 3FJHA 2P23A 4EEEB 4I4QA 1S0BA 1S0CA 4GAIA 1DIWA 5DZUA 2VSEA 3O4OA 2WBCA 4LO7B 1W3FA 1DQOA 1HCEA 1S0LA 2IWTB 4QD2C 5D63A 1JTCA 1AFCA 3CA6A 4FVVA 2MIBA 4G9NA 3O49A 4JAWA 2R9KB 3JRRA 3I2AA 3CAHA 5BOWA 1W3GA 3BAGA 1J0SA 4I4VA 1FQ9A 3BAHA 4YOLA 3D7WB 4II0A 3NBNA 1FN0A 2HW9A 4G9MA 3VSZA 4LO3A 4OWJA 1Q1UA 3FJ8A 3ZC8A 2ZQNA 4HA2A 1HKNA 4ENDA 5F8SA 4D0TA 1TWEA 3K1XA 1N4KA 3BB2A 3F1RA 4Z9WB 3IIRA 4USOA 3HSMA 1II4A 4OEEA 3VT2A 1CE7B 3HBWA 3FJIA 5BQUC 4ZFWB 2KLLA 4KBBA 2BEBA 4Q9PA 5BXTA 4HJJA 2IHOA 3V0BA 2KKIA 5F90A 1M16A 2M49A 2ZQOA 4LO7C 1MC9A 4HR6C 1FMMS 2YUGA 4EKXB 8I1BA 2D24A 2HWAA 3I2XA 4JP0A 3LLPA 1VCLA 1G9DA 1PUMB 4D8HA 3FJEA 3OBTA 2AAIB 1Q04A 1V6XA 2L5XA 1IRPA 2GO2A 3CRHA 3V0BB 1V6WA 1WD4A 1HIBA 3IM7A 3BRDA 3CA4A 2DRYA 4GP0A 4I96A 2VXRA 4I1EA 3RTJB 1TWMA 3H6SE 3HOMA 4A7YA 1DZDA 1RMLA 3O3QA 3V0AA 3OBRA 3IM5A 3WA1A 1HWNB 3ILAA 1YTOA 3AKIA 1AVUA 4OW4A 2UUSA 2Y9FA 4WBCA 3UJ0A 1G9CA 4I4PA 1YXWA 3H6QA 4ZBVB 1FMZA 3BTAA 2F2FA 4I4XA 4ZLBB 3O4BA 4JKXB 2K4AB 4QALA 4I37A 4A7KA 1S0GA 3N0KA 1WD3A 4H75A 3V0AB 4I0YA 4P0KA 1BFFA 2RSTA 4G1RA 1EPWA 3C9ZA 4FGFA 2P39A 4MZHA 2Y9XE 4P6AA 3VUOA 3O5WB 3UD8A 4LO0A 1IILA 1SR4A 1DFQA 4IYBA 2NP0A 5JMCA 2D22A 3Q7XA 4DENA 1HWPB 1HWOB 2E4MA 4KEKA 4J2XA 5F8WA 3RMYA 3AJ6A 3P6IA 2F8XC 3PHZA 2Z49A 2HWMA 5FNXA 3T8SA 1YF8B 2Q3NB 2XOAA 3S8JA 4ZFUB 2X2TA 4A7ZA 3PG0A 4OWKA 3MALA 3OJVA 1IJTA 2DS0A 1FWUA 3AH2A 4QKRA 1KNMA 2D20A 2KI4A 1ISYA 1QQLA 4F34A 5EHAA 1F31A 1EVTA 3OGGA 4JRAA 5FNWA 1IOBA 4EFQA 3ZX7A 3O4AA 4KEIA 1FV2A 1G82A 4PC4A 3UD7A 1RG8A 4I4YA 2FGFA 2DREA 2F2FC 4QKSA 1AVWB 5EG6C 3R4UA 4H9WA 2HZ9A 2VUAA 3P6JA 1YYNA 4I3NA 4P0JA 3H6RA 2D23A 3CA0A 1FGAA 2FFVA 2NYYA 2NM1A 3AJ5A 3FGMA 5F8YA 4LO1C 3AKFA 2D44A 3Q7YA 3WO4A 1NZKA 1NUNA 1JQZA 2NTDA 4QC4A 4LO0C 1SR4C 1S0DA 3E8LC 2BEAA 3AH1A 3H6RB 1BLAA 3FJJA 1TIEA 1Z2VA 3CU1B 1BFCA 2K8RA 2E4MC 1M2TB 3B9UA 4JQ0A 1BLDA 1DLLA 1G9BA 4J2YA 1TOOA 1RY7A 4ZOTA 4IY8A 5D61A 3OGFA 1P63A 3FJBA 1RZOB 1PZZA 9ILBA 3NBEA 7I1BA 1PC8B 1QQKA 31BIA 1TTUA 1DZCA 4KEJA 3PUBA 5BXRA 5BVPI 4GOVA 5BXPA 1ONKB 4X38A 1V6VA 1S0FA 2DRZA 4Z8SB 1T4QA 3ZC9A 4I4SA 1ISVA 5DUYA 3UJ4A 3TC2A 3IM6A 2VXTI 3A22A 1JT4A 1ABRB 1ILR1 2FDBM 5HPZA 1AVXB 1HCDA 1PWAA 3FFZA 3QYDA 3RMXA 4LO2A 4P0LA 3AZWA 5B2HA 3BRFA 1W3AA 2ESUA 1WBAA 5E24E 3P53A 2D43A 1DJSB 4DCKC 2VLCA 3NBCA 1TP0A 1WBCA 2AFGA 4OWLA 4I2SA 1BFBA 1XG6A 3UD9A 1K5UA 4XFTA 4EFPA 4XFSA 1EYLA 4LO1A 2LIQA 1I1EA 3RTIB 3FJ9A 3FUQA 5DSSB 1I1BA 2NS2A 1YBIA 3MPPG 2K43A 1Z0HA 3A07A 1JLYA 3QR5A 4J23B 4AN7B 1JY0A 1S0EA 3A21A 4ZFYB 5I1BA 3WO3A 3KMVA 3ZXGA 2FFUA 4EFRA 3N7JA 21BIA 4OEFA 4OEGA 4I4UA 4MZFB 4X37A 3VT1A 1T9FA 3RSJA 3BAVA 1EV2A 3S8KA 3WINA 2QYIB 3ZXDA 1DQGA 3OJ2A 1Z4SA 5DVHA 4IZXA 1OQLB 2D7RA 2RQ9A 3NBDA 4LO8B 4USPA 3OJMA 4LO2C 3BX1C 4ISRA 3POKA 5GAQA 1PUUB 1DFCA 2ERMA 3A23A 3BADA 2KI6B 3I29B 4AN6A 3EF2A 2Z48A 3VEQA 1AVAC 4MZGB 1GGPB 1AF9A 3FUOA 3WMUA 5D62A 4ZA3B 1A8DA 3LTQA 1E0OA 1ISWA
chains in the Genus database with same CATH topology
2NZ9A 2Q9XA 3JUTA 1BFGA 3O4CA 4QBCA 2MLLB 3Q7WA 4JPZA 1BARA 1JLXA 1FV3A 3BA5A 4J2KA 2BFHA 5FZUA 3FJCA 3BA7A 4OUJA 3N7KA 2D1ZA 4IZEA 4R6UB 1L2HA 4CJMA 3FJDA 4EB2B 5FZYA 1CVSA 3HMYA 1V6UA 1BA7A 4ISQA 3BA4A 3CQAA 3UDAA 3W9TA 4G6MA 2WRYA 5BXSA 3V79C 2I1BA 5BP5C 2VSAA 3BAUA 3FJAA 5G00A 2ET2A 3WINC 1D0HA 3VT0A 3N7LA 4GP3A 1JT7A 1UPSA 5JLVA 2NVHA 4IY9A 4L4HA 6I1BA 2QN4A 4ZGRB 3IAGC 4IHZA 4IONA 4KC3A 4XFUA 3BAQA 3R4SA 3AKGA 3HN1A 4DEPA 3O44A 2GZBA 1HWMB 1JT3A 2KH2A 3BAOA 3O4DA 3AKHA 1IRAX 5EC5A 1MD6A 2LIEA 4QBVA 1QXMA 1K5VA 3VSFA 4I4OA 4J2SA 2AQZA 2ZR1B 2VU9A 1BASA 5FZZA 4GOYA 3CA5A 3PMEA 1XHBA 4QO3A 3N7MA 1ISXA 4H04A 1ITBA 4GAFA 1G9AA 2AXMA 3CRGA 4I4RA 2X2SA 3FJKA 4I1BA 1SZ6B 4ZKTB 1ISZA 3CA3A 41BIA 4I8MA 4I7IA 4LO3C 4XKIA 4F83A 2Y9WC 3WMVA 4QD2B 4Q9GA 4JKQA 3CRIA 2MC2A 4I6IA 1AXMA 4X39A 3AH4A 1R8OA 5BP5A 3AZVA 1JT5A 4L4IA 4X3AA 3VWCA 1TFMB 3F62B 1XYFA 1IHKA 5BQUA 4Q91A 4UY4A 2J3PA 4G6JA 4TLPA 3NJ5A 2D7IA 3SNVA 2FO1A 3BRGC 1Q03A 1FWVA 3WO2A 2Y9GA 3CA1A 1R8NA 4IQPA 1XZZA 1IT0A 3FJFA 4D0ZA 3HALA 2RG9B 3FJHA 2P23A 4EEEB 4I4QA 1S0BA 1S0CA 4GAIA 1DIWA 5DZUA 2VSEA 3O4OA 2WBCA 4LO7B 1W3FA 1DQOA 1HCEA 1S0LA 2IWTB 4QD2C 5D63A 1JTCA 1AFCA 3CA6A 4FVVA 2MIBA 4G9NA 3O49A 4JAWA 2R9KB 3JRRA 3I2AA 3CAHA 5BOWA 1W3GA 3BAGA 1J0SA 4I4VA 1FQ9A 3BAHA 4YOLA 3D7WB 4II0A 3NBNA 1FN0A 2HW9A 4G9MA 3VSZA 4LO3A 4OWJA 1Q1UA 3FJ8A 3ZC8A 2ZQNA 4HA2A 1HKNA 4ENDA 5F8SA 4D0TA 1TWEA 3K1XA 1N4KA 3BB2A 3F1RA 4Z9WB 3IIRA 4USOA 3HSMA 1II4A 4OEEA 3VT2A 1CE7B 3HBWA 3FJIA 5BQUC 4ZFWB 2KLLA 4KBBA 2BEBA 4Q9PA 5BXTA 4HJJA 2IHOA 3V0BA 2KKIA 5F90A 1M16A 2M49A 2ZQOA 4LO7C 1MC9A 4HR6C 1FMMS 2YUGA 4EKXB 8I1BA 2D24A 2HWAA 3I2XA 4JP0A 3LLPA 1VCLA 1G9DA 1PUMB 4D8HA 3FJEA 3OBTA 2AAIB 1Q04A 1V6XA 2L5XA 1IRPA 2GO2A 3CRHA 3V0BB 1V6WA 1WD4A 1HIBA 3IM7A 3BRDA 3CA4A 2DRYA 4GP0A 4I96A 2VXRA 4I1EA 3RTJB 1TWMA 3H6SE 3HOMA 4A7YA 1DZDA 1RMLA 3O3QA 3V0AA 3OBRA 3IM5A 3WA1A 1HWNB 3ILAA 1YTOA 3AKIA 1AVUA 4OW4A 2UUSA 2Y9FA 4WBCA 3UJ0A 1G9CA 4I4PA 1YXWA 3H6QA 4ZBVB 1FMZA 3BTAA 2F2FA 4I4XA 4ZLBB 3O4BA 4JKXB 2K4AB 4QALA 4I37A 4A7KA 1S0GA 3N0KA 1WD3A 4H75A 3V0AB 4I0YA 4P0KA 1BFFA 2RSTA 4G1RA 1EPWA 3C9ZA 4FGFA 2P39A 4MZHA 2Y9XE 4P6AA 3VUOA 3O5WB 3UD8A 4LO0A 1IILA 1SR4A 1DFQA 4IYBA 2NP0A 5JMCA 2D22A 3Q7XA 4DENA 1HWPB 1HWOB 2E4MA 4KEKA 4J2XA 5F8WA 3RMYA 3AJ6A 3P6IA 2F8XC 3PHZA 2Z49A 2HWMA 5FNXA 3T8SA 1YF8B 2Q3NB 2XOAA 3S8JA 4ZFUB 2X2TA 4A7ZA 3PG0A 4OWKA 3MALA 3OJVA 1IJTA 2DS0A 1FWUA 3AH2A 4QKRA 1KNMA 2D20A 2KI4A 1ISYA 1QQLA 4F34A 5EHAA 1F31A 1EVTA 3OGGA 4JRAA 5FNWA 1IOBA 4EFQA 3ZX7A 3O4AA 4KEIA 1FV2A 1G82A 4PC4A 3UD7A 1RG8A 4I4YA 2FGFA 2DREA 2F2FC 4QKSA 1AVWB 5EG6C 3R4UA 4H9WA 2HZ9A 2VUAA 3P6JA 1YYNA 4I3NA 4P0JA 3H6RA 2D23A 3CA0A 1FGAA 2FFVA 2NYYA 2NM1A 3AJ5A 3FGMA 5F8YA 4LO1C 3AKFA 2D44A 3Q7YA 3WO4A 1NZKA 1NUNA 1JQZA 2NTDA 4QC4A 4LO0C 1SR4C 1S0DA 3E8LC 2BEAA 3AH1A 3H6RB 1BLAA 3FJJA 1TIEA 1Z2VA 3CU1B 1BFCA 2K8RA 2E4MC 1M2TB 3B9UA 4JQ0A 1BLDA 1DLLA 1G9BA 4J2YA 1TOOA 1RY7A 4ZOTA 4IY8A 5D61A 3OGFA 1P63A 3FJBA 1RZOB 1PZZA 9ILBA 3NBEA 7I1BA 1PC8B 1QQKA 31BIA 1TTUA 1DZCA 4KEJA 3PUBA 5BXRA 5BVPI 4GOVA 5BXPA 1ONKB 4X38A 1V6VA 1S0FA 2DRZA 4Z8SB 1T4QA 3ZC9A 4I4SA 1ISVA 5DUYA 3UJ4A 3TC2A 3IM6A 2VXTI 3A22A 1JT4A 1ABRB 1ILR1 2FDBM 5HPZA 1AVXB 1HCDA 1PWAA 3FFZA 3QYDA 3RMXA 4LO2A 4P0LA 3AZWA 5B2HA 3BRFA 1W3AA 2ESUA 1WBAA 5E24E 3P53A 2D43A 1DJSB 4DCKC 2VLCA 3NBCA 1TP0A 1WBCA 2AFGA 4OWLA 4I2SA 1BFBA 1XG6A 3UD9A 1K5UA 4XFTA 4EFPA 4XFSA 1EYLA 4LO1A 2LIQA 1I1EA 3RTIB 3FJ9A 3FUQA 5DSSB 1I1BA 2NS2A 1YBIA 3MPPG 2K43A 1Z0HA 3A07A 1JLYA 3QR5A 4J23B 4AN7B 1JY0A 1S0EA 3A21A 4ZFYB 5I1BA 3WO3A 3KMVA 3ZXGA 2FFUA 4EFRA 3N7JA 21BIA 4OEFA 4OEGA 4I4UA 4MZFB 4X37A 3VT1A 1T9FA 3RSJA 3BAVA 1EV2A 3S8KA 3WINA 2QYIB 3ZXDA 1DQGA 3OJ2A 1Z4SA 5DVHA 4IZXA 1OQLB 2D7RA 2RQ9A 3NBDA 4LO8B 4USPA 3OJMA 4LO2C 3BX1C 4ISRA 3POKA 5GAQA 1PUUB 1DFCA 2ERMA 3A23A 3BADA 2KI6B 3I29B 4AN6A 3EF2A 2Z48A 3VEQA 1AVAC 4MZGB 1GGPB 1AF9A 3FUOA 3WMUA 5D62A 4ZA3B 1A8DA 3LTQA 1E0OA 1ISWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ9 A;  2Q9X A;  3JUT A;  1BFG A;  3O4C A;  4QBC A;  2MLL B;  3Q7W A;  4JPZ A;  1BAR A;  1JLX A;  1FV3 A;  3BA5 A;  4J2K A;  2BFH A;  5FZU A;  3FJC A;  3BA7 A;  4OUJ A;  3N7K A;  2D1Z A;  4IZE A;  4R6U B;  1L2H A;  4CJM A;  3FJD A;  4EB2 B;  5FZY A;  1CVS A;  3HMY A;  1V6U A;  1BA7 A;  4ISQ A;  3BA4 A;  3CQA A;  3UDA A;  3W9T A;  4G6M A;  2WRY A;  5BXS A;  3V79 C;  2I1B A;  5BP5 C;  2VSA A;  3BAU A;  3FJA A;  5G00 A;  2ET2 A;  3WIN C;  1D0H A;  3VT0 A;  3N7L A;  4GP3 A;  1JT7 A;  1UPS A;  5JLV A;  2NVH A;  4IY9 A;  4L4H A;  6I1B A;  2QN4 A;  4ZGR B;  3IAG C;  4IHZ A;  4ION A;  4KC3 A;  4XFU A;  3BAQ A;  3R4S A;  3AKG A;  3HN1 A;  4DEP A;  3O44 A;  2GZB A;  1HWM B;  1JT3 A;  2KH2 A;  3BAO A;  3O4D A;  3AKH A;  1IRA X;  5EC5 A;  1MD6 A;  2LIE A;  4QBV A;  1QXM A;  1K5V A;  3VSF A;  4I4O A;  4J2S A;  2AQZ A;  2ZR1 B;  2VU9 A;  1BAS A;  5FZZ A;  4GOY A;  3CA5 A;  3PME A;  1XHB A;  4QO3 A;  3N7M A;  1ISX A;  4H04 A;  1ITB A;  4GAF A;  1G9A A;  2AXM A;  3CRG A;  4I4R A;  2X2S A;  3FJK A;  4I1B A;  1SZ6 B;  4ZKT B;  1ISZ A;  3CA3 A;  41BI A;  4I8M A;  4I7I A;  4LO3 C;  4XKI A;  4F83 A;  2Y9W C;  3WMV A;  4QD2 B;  4Q9G A;  4JKQ A;  3CRI A;  2MC2 A;  4I6I A;  1AXM A;  4X39 A;  3AH4 A;  1R8O A;  5BP5 A;  3AZV A;  1JT5 A;  4L4I A;  4X3A A;  3VWC A;  1TFM B;  3F62 B;  1XYF A;  1IHK A;  5BQU A;  4Q91 A;  2J3P A;  4G6J A;  4TLP A;  3NJ5 A;  2D7I A;  3SNV A;  2FO1 A;  3BRG C;  1Q03 A;  1FWV A;  3WO2 A;  2Y9G A;  3CA1 A;  1R8N A;  4IQP A;  1XZZ A;  1IT0 A;  3FJF A;  4D0Z A;  3HAL A;  2RG9 B;  3FJH A;  2P23 A;  4EEE B;  4I4Q A;  1S0B A;  1S0C A;  4GAI A;  1DIW A;  5DZU A;  2VSE A;  3O4O A;  2WBC A;  4LO7 B;  1W3F A;  1DQO A;  1HCE A;  1S0L A;  2IWT B;  4QD2 C;  5D63 A;  1JTC A;  1AFC A;  3CA6 A;  4FVV A;  2MIB A;  4G9N A;  3O49 A;  4JAW A;  2R9K B;  3JRR A;  3I2A A;  3CAH A;  5BOW A;  1W3G A;  3BAG A;  1J0S A;  4I4V A;  1FQ9 A;  3BAH A;  4YOL A;  3D7W B;  4II0 A;  3NBN A;  1FN0 A;  2HW9 A;  4G9M A;  3VSZ A;  4LO3 A;  4OWJ A;  1Q1U A;  3FJ8 A;  3ZC8 A;  2ZQN A;  4HA2 A;  1HKN A;  4END A;  5F8S A;  4D0T A;  1TWE A;  3K1X A;  1N4K A;  3BB2 A;  3F1R A;  4Z9W B;  3IIR A;  4USO A;  3HSM A;  1II4 A;  4OEE A;  3VT2 A;  1CE7 B;  3HBW A;  3FJI A;  5BQU C;  4ZFW B;  2KLL A;  4KBB A;  2BEB A;  4Q9P A;  5BXT A;  4HJJ A;  2IHO A;  3V0B A;  2KKI A;  5F90 A;  1M16 A;  2M49 A;  2ZQO A;  4LO7 C;  1MC9 A;  4HR6 C;  1FMM S;  2YUG A;  4EKX B;  8I1B A;  2D24 A;  2HWA A;  3I2X A;  4JP0 A;  3LLP A;  1VCL A;  1G9D A;  1PUM B;  4D8H A;  3FJE A;  3OBT A;  2AAI B;  1Q04 A;  1V6X A;  2L5X A;  1IRP A;  2GO2 A;  3CRH A;  3V0B B;  1V6W A;  1WD4 A;  1HIB A;  3IM7 A;  3BRD A;  3CA4 A;  2DRY A;  4GP0 A;  4I96 A;  2VXR A;  4I1E A;  3RTJ B;  1TWM A;  3H6S E;  3HOM A;  4A7Y A;  1DZD A;  1RML A;  3O3Q A;  3V0A A;  3OBR A;  3IM5 A;  3WA1 A;  1HWN B;  3ILA A;  1YTO A;  3AKI A;  1AVU A;  4OW4 A;  2UUS A;  2Y9F A;  4WBC A;  3UJ0 A;  1G9C A;  4I4P A;  1YXW A;  3H6Q A;  4ZBV B;  1FMZ A;  3BTA A;  2F2F A;  4I4X A;  4ZLB B;  3O4B A;  4JKX B;  2K4A B;  4QAL A;  4I37 A;  4A7K A;  1S0G A;  3N0K A;  1WD3 A;  3V0A B;  4I0Y A;  4P0K A;  1BFF A;  2RST A;  4G1R A;  1EPW A;  3C9Z A;  4FGF A;  2P39 A;  2Y9X E;  4P6A A;  3VUO A;  3O5W B;  3UD8 A;  4LO0 A;  1IIL A;  1SR4 A;  1DFQ A;  4IYB A;  2NP0 A;  5JMC A;  2D22 A;  3Q7X A;  4DEN A;  1HWP B;  1HWO B;  2E4M A;  4KEK A;  4J2X A;  5F8W A;  3RMY A;  3AJ6 A;  3P6I A;  2F8X C;  3PHZ A;  2Z49 A;  2HWM A;  5FNX A;  3T8S A;  1YF8 B;  2Q3N B;  2XOA A;  3S8J A;  4ZFU B;  2X2T A;  4A7Z A;  3PG0 A;  4OWK A;  3MAL A;  3OJV A;  1IJT A;  2DS0 A;  1FWU A;  3AH2 A;  4QKR A;  1KNM A;  2D20 A;  2KI4 A;  1ISY A;  1QQL A;  4F34 A;  5EHA A;  1F31 A;  1EVT A;  3OGG A;  4JRA A;  5FNW A;  1IOB A;  4EFQ A;  3ZX7 A;  3O4A A;  4KEI A;  1FV2 A;  1G82 A;  4PC4 A;  3UD7 A;  1RG8 A;  4I4Y A;  2FGF A;  2DRE A;  2F2F C;  4QKS A;  1AVW B;  5EG6 C;  3R4U A;  4H9W A;  2HZ9 A;  2VUA A;  3P6J A;  1YYN A;  4I3N A;  4P0J A;  3H6R A;  2D23 A;  3CA0 A;  1FGA A;  2FFV A;  2NYY A;  2NM1 A;  3AJ5 A;  3FGM A;  5F8Y A;  4LO1 C;  3AKF A;  2D44 A;  3Q7Y A;  3WO4 A;  1NZK A;  1NUN A;  1JQZ A;  2NTD A;  4QC4 A;  4LO0 C;  1SR4 C;  1S0D A;  3E8L C;  2BEA A;  3AH1 A;  3H6R B;  1BLA A;  3FJJ A;  1TIE A;  1Z2V A;  3CU1 B;  1BFC A;  2K8R A;  2E4M C;  1M2T B;  3B9U A;  4JQ0 A;  1BLD A;  1DLL A;  1G9B A;  4J2Y A;  1TOO A;  1RY7 A;  4ZOT A;  4IY8 A;  5D61 A;  3OGF A;  1P63 A;  3FJB A;  1RZO B;  1PZZ A;  9ILB A;  3NBE A;  7I1B A;  1PC8 B;  1QQK A;  31BI A;  1TTU A;  1DZC A;  4KEJ A;  3PUB A;  5BXR A;  5BVP I;  4GOV A;  5BXP A;  1ONK B;  4X38 A;  1V6V A;  1S0F A;  2DRZ A;  4Z8S B;  1T4Q A;  3ZC9 A;  4I4S A;  1ISV A;  5DUY A;  3UJ4 A;  3TC2 A;  3IM6 A;  2VXT I;  3A22 A;  1JT4 A;  1ABR B;  1ILR 1;  2FDB M;  5HPZ A;  1AVX B;  1HCD A;  1PWA A;  3FFZ A;  3QYD A;  3RMX A;  4LO2 A;  4P0L A;  3AZW A;  5B2H A;  3BRF A;  1W3A A;  2ESU A;  1WBA A;  5E24 E;  3P53 A;  2D43 A;  1DJS B;  4DCK C;  2VLC A;  3NBC A;  1TP0 A;  1WBC A;  2AFG A;  4OWL A;  4I2S A;  1BFB A;  1XG6 A;  3UD9 A;  1K5U A;  4XFT A;  4EFP A;  4XFS A;  1EYL A;  4LO1 A;  2LIQ A;  1I1E A;  3RTI B;  3FJ9 A;  3FUQ A;  5DSS B;  1I1B A;  1YBI A;  3MPP G;  2K43 A;  1Z0H A;  3A07 A;  1JLY A;  3QR5 A;  4J23 B;  4AN7 B;  1JY0 A;  1S0E A;  3A21 A;  4ZFY B;  5I1B A;  3WO3 A;  3KMV A;  3ZXG A;  2FFU A;  4EFR A;  3N7J A;  21BI A;  4OEF A;  4OEG A;  4I4U A;  4X37 A;  3VT1 A;  1T9F A;  3RSJ A;  3BAV A;  1EV2 A;  3S8K A;  3WIN A;  2QYI B;  3ZXD A;  1DQG A;  3OJ2 A;  1Z4S A;  5DVH A;  4IZX A;  1OQL B;  2D7R A;  2RQ9 A;  3NBD A;  4LO8 B;  4USP A;  3OJM A;  4LO2 C;  3BX1 C;  4ISR A;  3POK A;  5GAQ A;  1PUU B;  1DFC A;  2ERM A;  3A23 A;  3BAD A;  2KI6 B;  3I29 B;  4AN6 A;  3EF2 A;  2Z48 A;  3VEQ A;  1AVA C;  1GGP B;  1AF9 A;  3FUO A;  3WMU A;  5D62 A;  4ZA3 B;  1A8D A;  3LTQ A;  1E0O A;  1ISW A; 
#chains in the Genus database with same CATH topology
 2NZ9 A;  2Q9X A;  3JUT A;  1BFG A;  3O4C A;  4QBC A;  2MLL B;  3Q7W A;  4JPZ A;  1BAR A;  1JLX A;  1FV3 A;  3BA5 A;  4J2K A;  2BFH A;  5FZU A;  3FJC A;  3BA7 A;  4OUJ A;  3N7K A;  2D1Z A;  4IZE A;  4R6U B;  1L2H A;  4CJM A;  3FJD A;  4EB2 B;  5FZY A;  1CVS A;  3HMY A;  1V6U A;  1BA7 A;  4ISQ A;  3BA4 A;  3CQA A;  3UDA A;  3W9T A;  4G6M A;  2WRY A;  5BXS A;  3V79 C;  2I1B A;  5BP5 C;  2VSA A;  3BAU A;  3FJA A;  5G00 A;  2ET2 A;  3WIN C;  1D0H A;  3VT0 A;  3N7L A;  4GP3 A;  1JT7 A;  1UPS A;  5JLV A;  2NVH A;  4IY9 A;  4L4H A;  6I1B A;  2QN4 A;  4ZGR B;  3IAG C;  4IHZ A;  4ION A;  4KC3 A;  4XFU A;  3BAQ A;  3R4S A;  3AKG A;  3HN1 A;  4DEP A;  3O44 A;  2GZB A;  1HWM B;  1JT3 A;  2KH2 A;  3BAO A;  3O4D A;  3AKH A;  1IRA X;  5EC5 A;  1MD6 A;  2LIE A;  4QBV A;  1QXM A;  1K5V A;  3VSF A;  4I4O A;  4J2S A;  2AQZ A;  2ZR1 B;  2VU9 A;  1BAS A;  5FZZ A;  4GOY A;  3CA5 A;  3PME A;  1XHB A;  4QO3 A;  3N7M A;  1ISX A;  4H04 A;  1ITB A;  4GAF A;  1G9A A;  2AXM A;  3CRG A;  4I4R A;  2X2S A;  3FJK A;  4I1B A;  1SZ6 B;  4ZKT B;  1ISZ A;  3CA3 A;  41BI A;  4I8M A;  4I7I A;  4LO3 C;  4XKI A;  4F83 A;  2Y9W C;  3WMV A;  4QD2 B;  4Q9G A;  4JKQ A;  3CRI A;  2MC2 A;  4I6I A;  1AXM A;  4X39 A;  3AH4 A;  1R8O A;  5BP5 A;  3AZV A;  1JT5 A;  4L4I A;  4X3A A;  3VWC A;  1TFM B;  3F62 B;  1XYF A;  1IHK A;  5BQU A;  4Q91 A;  4UY4 A;  2J3P A;  4G6J A;  4TLP A;  3NJ5 A;  2D7I A;  3SNV A;  2FO1 A;  3BRG C;  1Q03 A;  1FWV A;  3WO2 A;  2Y9G A;  3CA1 A;  1R8N A;  4IQP A;  1XZZ A;  1IT0 A;  3FJF A;  4D0Z A;  3HAL A;  2RG9 B;  3FJH A;  2P23 A;  4EEE B;  4I4Q A;  1S0B A;  1S0C A;  4GAI A;  1DIW A;  5DZU A;  2VSE A;  3O4O A;  2WBC A;  4LO7 B;  1W3F A;  1DQO A;  1HCE A;  1S0L A;  2IWT B;  4QD2 C;  5D63 A;  1JTC A;  1AFC A;  3CA6 A;  4FVV A;  2MIB A;  4G9N A;  3O49 A;  4JAW A;  2R9K B;  3JRR A;  3I2A A;  3CAH A;  5BOW A;  1W3G A;  3BAG A;  1J0S A;  4I4V A;  1FQ9 A;  3BAH A;  4YOL A;  3D7W B;  4II0 A;  3NBN A;  1FN0 A;  2HW9 A;  4G9M A;  3VSZ A;  4LO3 A;  4OWJ A;  1Q1U A;  3FJ8 A;  3ZC8 A;  2ZQN A;  4HA2 A;  1HKN A;  4END A;  5F8S A;  4D0T A;  1TWE A;  3K1X A;  1N4K A;  3BB2 A;  3F1R A;  4Z9W B;  3IIR A;  4USO A;  3HSM A;  1II4 A;  4OEE A;  3VT2 A;  1CE7 B;  3HBW A;  3FJI A;  5BQU C;  4ZFW B;  2KLL A;  4KBB A;  2BEB A;  4Q9P A;  5BXT A;  4HJJ A;  2IHO A;  3V0B A;  2KKI A;  5F90 A;  1M16 A;  2M49 A;  2ZQO A;  4LO7 C;  1MC9 A;  4HR6 C;  1FMM S;  2YUG A;  4EKX B;  8I1B A;  2D24 A;  2HWA A;  3I2X A;  4JP0 A;  3LLP A;  1VCL A;  1G9D A;  1PUM B;  4D8H A;  3FJE A;  3OBT A;  2AAI B;  1Q04 A;  1V6X A;  2L5X A;  1IRP A;  2GO2 A;  3CRH A;  3V0B B;  1V6W A;  1WD4 A;  1HIB A;  3IM7 A;  3BRD A;  3CA4 A;  2DRY A;  4GP0 A;  4I96 A;  2VXR A;  4I1E A;  3RTJ B;  1TWM A;  3H6S E;  3HOM A;  4A7Y A;  1DZD A;  1RML A;  3O3Q A;  3V0A A;  3OBR A;  3IM5 A;  3WA1 A;  1HWN B;  3ILA A;  1YTO A;  3AKI A;  1AVU A;  4OW4 A;  2UUS A;  2Y9F A;  4WBC A;  3UJ0 A;  1G9C A;  4I4P A;  1YXW A;  3H6Q A;  4ZBV B;  1FMZ A;  3BTA A;  2F2F A;  4I4X A;  4ZLB B;  3O4B A;  4JKX B;  2K4A B;  4QAL A;  4I37 A;  4A7K A;  1S0G A;  3N0K A;  1WD3 A;  4H75 A;  3V0A B;  4I0Y A;  4P0K A;  1BFF A;  2RST A;  4G1R A;  1EPW A;  3C9Z A;  4FGF A;  2P39 A;  4MZH A;  2Y9X E;  4P6A A;  3VUO A;  3O5W B;  3UD8 A;  4LO0 A;  1IIL A;  1SR4 A;  1DFQ A;  4IYB A;  2NP0 A;  5JMC A;  2D22 A;  3Q7X A;  4DEN A;  1HWP B;  1HWO B;  2E4M A;  4KEK A;  4J2X A;  5F8W A;  3RMY A;  3AJ6 A;  3P6I A;  2F8X C;  3PHZ A;  2Z49 A;  2HWM A;  5FNX A;  3T8S A;  1YF8 B;  2Q3N B;  2XOA A;  3S8J A;  4ZFU B;  2X2T A;  4A7Z A;  3PG0 A;  4OWK A;  3MAL A;  3OJV A;  1IJT A;  2DS0 A;  1FWU A;  3AH2 A;  4QKR A;  1KNM A;  2D20 A;  2KI4 A;  1ISY A;  1QQL A;  4F34 A;  5EHA A;  1F31 A;  1EVT A;  3OGG A;  4JRA A;  5FNW A;  1IOB A;  4EFQ A;  3ZX7 A;  3O4A A;  4KEI A;  1FV2 A;  1G82 A;  4PC4 A;  3UD7 A;  1RG8 A;  4I4Y A;  2FGF A;  2DRE A;  2F2F C;  4QKS A;  1AVW B;  5EG6 C;  3R4U A;  4H9W A;  2HZ9 A;  2VUA A;  3P6J A;  1YYN A;  4I3N A;  4P0J A;  3H6R A;  2D23 A;  3CA0 A;  1FGA A;  2FFV A;  2NYY A;  2NM1 A;  3AJ5 A;  3FGM A;  5F8Y A;  4LO1 C;  3AKF A;  2D44 A;  3Q7Y A;  3WO4 A;  1NZK A;  1NUN A;  1JQZ A;  2NTD A;  4QC4 A;  4LO0 C;  1SR4 C;  1S0D A;  3E8L C;  2BEA A;  3AH1 A;  3H6R B;  1BLA A;  3FJJ A;  1TIE A;  1Z2V A;  3CU1 B;  1BFC A;  2K8R A;  2E4M C;  1M2T B;  3B9U A;  4JQ0 A;  1BLD A;  1DLL A;  1G9B A;  4J2Y A;  1TOO A;  1RY7 A;  4ZOT A;  4IY8 A;  5D61 A;  3OGF A;  1P63 A;  3FJB A;  1RZO B;  1PZZ A;  9ILB A;  3NBE A;  7I1B A;  1PC8 B;  1QQK A;  31BI A;  1TTU A;  1DZC A;  4KEJ A;  3PUB A;  5BXR A;  5BVP I;  4GOV A;  5BXP A;  1ONK B;  4X38 A;  1V6V A;  1S0F A;  2DRZ A;  4Z8S B;  1T4Q A;  3ZC9 A;  4I4S A;  1ISV A;  5DUY A;  3UJ4 A;  3TC2 A;  3IM6 A;  2VXT I;  3A22 A;  1JT4 A;  1ABR B;  1ILR 1;  2FDB M;  5HPZ A;  1AVX B;  1HCD A;  1PWA A;  3FFZ A;  3QYD A;  3RMX A;  4LO2 A;  4P0L A;  3AZW A;  5B2H A;  3BRF A;  1W3A A;  2ESU A;  1WBA A;  5E24 E;  3P53 A;  2D43 A;  1DJS B;  4DCK C;  2VLC A;  3NBC A;  1TP0 A;  1WBC A;  2AFG A;  4OWL A;  4I2S A;  1BFB A;  1XG6 A;  3UD9 A;  1K5U A;  4XFT A;  4EFP A;  4XFS A;  1EYL A;  4LO1 A;  2LIQ A;  1I1E A;  3RTI B;  3FJ9 A;  3FUQ A;  5DSS B;  1I1B A;  2NS2 A;  1YBI A;  3MPP G;  2K43 A;  1Z0H A;  3A07 A;  1JLY A;  3QR5 A;  4J23 B;  4AN7 B;  1JY0 A;  1S0E A;  3A21 A;  4ZFY B;  5I1B A;  3WO3 A;  3KMV A;  3ZXG A;  2FFU A;  4EFR A;  3N7J A;  21BI A;  4OEF A;  4OEG A;  4I4U A;  4MZF B;  4X37 A;  3VT1 A;  1T9F A;  3RSJ A;  3BAV A;  1EV2 A;  3S8K A;  3WIN A;  2QYI B;  3ZXD A;  1DQG A;  3OJ2 A;  1Z4S A;  5DVH A;  4IZX A;  1OQL B;  2D7R A;  2RQ9 A;  3NBD A;  4LO8 B;  4USP A;  3OJM A;  4LO2 C;  3BX1 C;  4ISR A;  3POK A;  5GAQ A;  1PUU B;  1DFC A;  2ERM A;  3A23 A;  3BAD A;  2KI6 B;  3I29 B;  4AN6 A;  3EF2 A;  2Z48 A;  3VEQ A;  1AVA C;  4MZG B;  1GGP B;  1AF9 A;  3FUO A;  3WMU A;  5D62 A;  4ZA3 B;  1A8D A;  3LTQ A;  1E0O A;  1ISW A; 
#chains in the Genus database with same CATH homology
 2NZ9 A;  2Q9X A;  3JUT A;  1BFG A;  3O4C A;  4QBC A;  2MLL B;  3Q7W A;  4JPZ A;  1BAR A;  1JLX A;  1FV3 A;  3BA5 A;  4J2K A;  2BFH A;  5FZU A;  3FJC A;  3BA7 A;  4OUJ A;  3N7K A;  2D1Z A;  4IZE A;  4R6U B;  1L2H A;  4CJM A;  3FJD A;  4EB2 B;  5FZY A;  1CVS A;  3HMY A;  1V6U A;  1BA7 A;  4ISQ A;  3BA4 A;  3CQA A;  3UDA A;  3W9T A;  4G6M A;  2WRY A;  5BXS A;  3V79 C;  2I1B A;  5BP5 C;  2VSA A;  3BAU A;  3FJA A;  5G00 A;  2ET2 A;  3WIN C;  1D0H A;  3VT0 A;  3N7L A;  4GP3 A;  1JT7 A;  1UPS A;  5JLV A;  2NVH A;  4IY9 A;  4L4H A;  6I1B A;  2QN4 A;  4ZGR B;  3IAG C;  4IHZ A;  4ION A;  4KC3 A;  4XFU A;  3BAQ A;  3R4S A;  3AKG A;  3HN1 A;  4DEP A;  3O44 A;  2GZB A;  1HWM B;  1JT3 A;  2KH2 A;  3BAO A;  3O4D A;  3AKH A;  1IRA X;  5EC5 A;  1MD6 A;  2LIE A;  4QBV A;  1QXM A;  1K5V A;  3VSF A;  4I4O A;  4J2S A;  2AQZ A;  2ZR1 B;  2VU9 A;  1BAS A;  5FZZ A;  4GOY A;  3CA5 A;  3PME A;  1XHB A;  4QO3 A;  3N7M A;  1ISX A;  4H04 A;  1ITB A;  4GAF A;  1G9A A;  2AXM A;  3CRG A;  4I4R A;  2X2S A;  3FJK A;  4I1B A;  1SZ6 B;  4ZKT B;  1ISZ A;  3CA3 A;  41BI A;  4I8M A;  4I7I A;  4LO3 C;  4XKI A;  4F83 A;  2Y9W C;  3WMV A;  4QD2 B;  4Q9G A;  4JKQ A;  3CRI A;  2MC2 A;  4I6I A;  1AXM A;  4X39 A;  3AH4 A;  1R8O A;  5BP5 A;  3AZV A;  1JT5 A;  4L4I A;  4X3A A;  3VWC A;  1TFM B;  3F62 B;  1XYF A;  1IHK A;  5BQU A;  4Q91 A;  4UY4 A;  2J3P A;  4G6J A;  4TLP A;  3NJ5 A;  2D7I A;  3SNV A;  2FO1 A;  3BRG C;  1Q03 A;  1FWV A;  3WO2 A;  2Y9G A;  3CA1 A;  1R8N A;  4IQP A;  1XZZ A;  1IT0 A;  3FJF A;  4D0Z A;  3HAL A;  2RG9 B;  3FJH A;  2P23 A;  4EEE B;  4I4Q A;  1S0B A;  1S0C A;  4GAI A;  1DIW A;  5DZU A;  2VSE A;  3O4O A;  2WBC A;  4LO7 B;  1W3F A;  1DQO A;  1HCE A;  1S0L A;  2IWT B;  4QD2 C;  5D63 A;  1JTC A;  1AFC A;  3CA6 A;  4FVV A;  2MIB A;  4G9N A;  3O49 A;  4JAW A;  2R9K B;  3JRR A;  3I2A A;  3CAH A;  5BOW A;  1W3G A;  3BAG A;  1J0S A;  4I4V A;  1FQ9 A;  3BAH A;  4YOL A;  3D7W B;  4II0 A;  3NBN A;  1FN0 A;  2HW9 A;  4G9M A;  3VSZ A;  4LO3 A;  4OWJ A;  1Q1U A;  3FJ8 A;  3ZC8 A;  2ZQN A;  4HA2 A;  1HKN A;  4END A;  5F8S A;  4D0T A;  1TWE A;  3K1X A;  1N4K A;  3BB2 A;  3F1R A;  4Z9W B;  3IIR A;  4USO A;  3HSM A;  1II4 A;  4OEE A;  3VT2 A;  1CE7 B;  3HBW A;  3FJI A;  5BQU C;  4ZFW B;  2KLL A;  4KBB A;  2BEB A;  4Q9P A;  5BXT A;  4HJJ A;  2IHO A;  3V0B A;  2KKI A;  5F90 A;  1M16 A;  2M49 A;  2ZQO A;  4LO7 C;  1MC9 A;  4HR6 C;  1FMM S;  2YUG A;  4EKX B;  8I1B A;  2D24 A;  2HWA A;  3I2X A;  4JP0 A;  3LLP A;  1VCL A;  1G9D A;  1PUM B;  4D8H A;  3FJE A;  3OBT A;  2AAI B;  1Q04 A;  1V6X A;  2L5X A;  1IRP A;  2GO2 A;  3CRH A;  3V0B B;  1V6W A;  1WD4 A;  1HIB A;  3IM7 A;  3BRD A;  3CA4 A;  2DRY A;  4GP0 A;  4I96 A;  2VXR A;  4I1E A;  3RTJ B;  1TWM A;  3H6S E;  3HOM A;  4A7Y A;  1DZD A;  1RML A;  3O3Q A;  3V0A A;  3OBR A;  3IM5 A;  3WA1 A;  1HWN B;  3ILA A;  1YTO A;  3AKI A;  1AVU A;  4OW4 A;  2UUS A;  2Y9F A;  4WBC A;  3UJ0 A;  1G9C A;  4I4P A;  1YXW A;  3H6Q A;  4ZBV B;  1FMZ A;  3BTA A;  2F2F A;  4I4X A;  4ZLB B;  3O4B A;  4JKX B;  2K4A B;  4QAL A;  4I37 A;  4A7K A;  1S0G A;  3N0K A;  1WD3 A;  4H75 A;  3V0A B;  4I0Y A;  4P0K A;  1BFF A;  2RST A;  4G1R A;  1EPW A;  3C9Z A;  4FGF A;  2P39 A;  4MZH A;  2Y9X E;  4P6A A;  3VUO A;  3O5W B;  3UD8 A;  4LO0 A;  1IIL A;  1SR4 A;  1DFQ A;  4IYB A;  2NP0 A;  5JMC A;  2D22 A;  3Q7X A;  4DEN A;  1HWP B;  1HWO B;  2E4M A;  4KEK A;  4J2X A;  5F8W A;  3RMY A;  3AJ6 A;  3P6I A;  2F8X C;  3PHZ A;  2Z49 A;  2HWM A;  5FNX A;  3T8S A;  1YF8 B;  2Q3N B;  2XOA A;  3S8J A;  4ZFU B;  2X2T A;  4A7Z A;  3PG0 A;  4OWK A;  3MAL A;  3OJV A;  1IJT A;  2DS0 A;  1FWU A;  3AH2 A;  4QKR A;  1KNM A;  2D20 A;  2KI4 A;  1ISY A;  1QQL A;  4F34 A;  5EHA A;  1F31 A;  1EVT A;  3OGG A;  4JRA A;  5FNW A;  1IOB A;  4EFQ A;  3ZX7 A;  3O4A A;  4KEI A;  1FV2 A;  1G82 A;  4PC4 A;  3UD7 A;  1RG8 A;  4I4Y A;  2FGF A;  2DRE A;  2F2F C;  4QKS A;  1AVW B;  5EG6 C;  3R4U A;  4H9W A;  2HZ9 A;  2VUA A;  3P6J A;  1YYN A;  4I3N A;  4P0J A;  3H6R A;  2D23 A;  3CA0 A;  1FGA A;  2FFV A;  2NYY A;  2NM1 A;  3AJ5 A;  3FGM A;  5F8Y A;  4LO1 C;  3AKF A;  2D44 A;  3Q7Y A;  3WO4 A;  1NZK A;  1NUN A;  1JQZ A;  2NTD A;  4QC4 A;  4LO0 C;  1SR4 C;  1S0D A;  3E8L C;  2BEA A;  3AH1 A;  3H6R B;  1BLA A;  3FJJ A;  1TIE A;  1Z2V A;  3CU1 B;  1BFC A;  2K8R A;  2E4M C;  1M2T B;  3B9U A;  4JQ0 A;  1BLD A;  1DLL A;  1G9B A;  4J2Y A;  1TOO A;  1RY7 A;  4ZOT A;  4IY8 A;  5D61 A;  3OGF A;  1P63 A;  3FJB A;  1RZO B;  1PZZ A;  9ILB A;  3NBE A;  7I1B A;  1PC8 B;  1QQK A;  31BI A;  1TTU A;  1DZC A;  4KEJ A;  3PUB A;  5BXR A;  5BVP I;  4GOV A;  5BXP A;  1ONK B;  4X38 A;  1V6V A;  1S0F A;  2DRZ A;  4Z8S B;  1T4Q A;  3ZC9 A;  4I4S A;  1ISV A;  5DUY A;  3UJ4 A;  3TC2 A;  3IM6 A;  2VXT I;  3A22 A;  1JT4 A;  1ABR B;  1ILR 1;  2FDB M;  5HPZ A;  1AVX B;  1HCD A;  1PWA A;  3FFZ A;  3QYD A;  3RMX A;  4LO2 A;  4P0L A;  3AZW A;  5B2H A;  3BRF A;  1W3A A;  2ESU A;  1WBA A;  5E24 E;  3P53 A;  2D43 A;  1DJS B;  4DCK C;  2VLC A;  3NBC A;  1TP0 A;  1WBC A;  2AFG A;  4OWL A;  4I2S A;  1BFB A;  1XG6 A;  3UD9 A;  1K5U A;  4XFT A;  4EFP A;  4XFS A;  1EYL A;  4LO1 A;  2LIQ A;  1I1E A;  3RTI B;  3FJ9 A;  3FUQ A;  5DSS B;  1I1B A;  2NS2 A;  1YBI A;  3MPP G;  2K43 A;  1Z0H A;  3A07 A;  1JLY A;  3QR5 A;  4J23 B;  4AN7 B;  1JY0 A;  1S0E A;  3A21 A;  4ZFY B;  5I1B A;  3WO3 A;  3KMV A;  3ZXG A;  2FFU A;  4EFR A;  3N7J A;  21BI A;  4OEF A;  4OEG A;  4I4U A;  4MZF B;  4X37 A;  3VT1 A;  1T9F A;  3RSJ A;  3BAV A;  1EV2 A;  3S8K A;  3WIN A;  2QYI B;  3ZXD A;  1DQG A;  3OJ2 A;  1Z4S A;  5DVH A;  4IZX A;  1OQL B;  2D7R A;  2RQ9 A;  3NBD A;  4LO8 B;  4USP A;  3OJM A;  4LO2 C;  3BX1 C;  4ISR A;  3POK A;  5GAQ A;  1PUU B;  1DFC A;  2ERM A;  3A23 A;  3BAD A;  2KI6 B;  3I29 B;  4AN6 A;  3EF2 A;  2Z48 A;  3VEQ A;  1AVA C;  4MZG B;  1GGP B;  1AF9 A;  3FUO A;  3WMU A;  5D62 A;  4ZA3 B;  1A8D A;  3LTQ A;  1E0O A;  1ISW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...