3CQAA

Crystal structure of human fibroblast growth factor-1 with mutations glu81ala and lys101ala
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
140
structure length
140
Chain Sequence
b'HHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNAECLFLERLEENHYNTYISKAHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Engineering an improved crystal contact across a solvent-mediated interface of human fibroblast growth factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 35
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3cqaA00
1Z0HA 4F34A 1V6UA 3OJVA 3A07A 1DFQA 3Q7YA 4LO2C 3AKIA 4A7KA 1HWNB 1BFGA 4I6IA 1CE7B 2ESUA 3VT2A 3WINC 9ILBA 2BEAA 4J2XA 5BXRA 2FDBM 4P0KA 4I3NA 1V6WA 3H6QA 4I4VA 2Q3NB 3HOMA 2VLCA 3O4BA 4JQ0A 3CRHA 3EF2A 3QR5A 1DLLA 1PWAA 3O4OA 4EB2B 3CU1B 4I4OA 3AZWA 3UD8A 3CA1A 1R8NA 1QXMA 4ZA3B 2J3PA 4I4PA 2Y9XE 1NZKA 4I4UA 4LO3A 4QKRA 1XHBA 5F8SA 3W9TA 2R9KB 4D0ZA 3N7LA 1HWOB 1AVWB 3FFZA 4H9WA 4IONA 4R6UB 3UD9A 4DCKC 3ILAA 3CA6A 1QQLA 4F83A 1AF9A 2ERMA 4AN6A 5DUYA 4IZXA 1FWUA 1ISVA 1BLAA 1WD4A 4I96A 4L4HA 4I37A 1N4KA 3RSJA 4I4SA 3BAVA 4IHZA 3D7WB 4IY8A 4I0YA 3OGGA 2E4MC 4JP0A 3A22A 4I4XA 1XG6A 4I8MA 3WO4A 2HZ9A 2D1ZA 3IM6A 2BFHA 3FJ8A 4QD2B 1TOOA 1E0OA 2M49A 4GP3A 4I2SA 4JRAA 5FNWA 1G9BA 4G1RA 4IQPA 2Z48A 3BA7A 2NM1A 2DRYA 3H6RA 1G9DA 4GOYA 2KI4A 2NP0A 2XOAA 1Z4SA 2NVHA 3FJEA 2KI6B 4Q9PA 1WBCA 1AXMA 3RMXA 4FVVA 4EEEB 1DFCA 3O49A 4ISRA 4OUJA 1TP0A 4ZFUB 5I1BA 1S0CA 2UUSA 1K5VA 5D61A 2Q9XA 3FJAA 5F8WA 7I1BA 1EYLA 1FWVA 4J2SA 2VSAA 3HBWA 1A8DA 3UJ4A 3AJ6A 4G9NA 3JRRA 2VU9A 4OEGA 1PC8B 3MPPG 4G6MA 5EHAA 4TLPA 5G00A 4QC4A 1FV2A 1HKNA 3F1RA 2HWAA 1L2HA 3S8KA 3HALA 1RZOB 3OBRA 1GGPB 1DZDA 2Y9WC 1AVAC 4LO1A 3V0BB 4Q91A 4P0LA 3AKGA 3LLPA 4QD2C 4XKIA 1HCDA 3FUOA 4OWKA 5DVHA 2AXMA 1JTCA 2P39A 4GOVA 1II4A 5BOWA 3ZXDA 3BAHA 3CQAA 4X38A 1BFBA 1ILR1 4AN7B 3N7JA 2RSTA 4ENDA 6I1BA 2F8XC 4JKXB 2D22A 4HA2A 3H6RB 1V6XA 1QQKA 3BB2A 4ZFWB 2GZBA 4LO3C 4EFPA 2X2TA 2I1BA 3FJFA 4Z9WB 3HMYA 2D24A 1ISZA 3O4AA 2LIEA 3C9ZA 3WO2A 3O4CA 1FGAA 4HR6C 3ZC9A 4ZBVB 4XFTA 4D0TA 1MD6A 4EFQA 1KNMA 3IIRA 1S0DA 2NTDA 3VWCA 3KMVA 4J2YA 4EKXB 4OWJA 3WA1A 4Q9GA 5BQUC 4KEKA 4QALA 1IT0A 4I4QA 1AVXB 5HPZA 3N7MA 1IRPA 1Q1UA 1TIEA 1HCEA 1BLDA 1ISXA 2FFVA 1S0EA 3FJBA 2ZQNA 1ABRB 3O4DA 1V6VA 3CA3A 3WINA 3VSFA 5BP5A 2K4AB 1BFCA 3I2XA 5BXPA 1R8OA 1RG8A 1DQGA 5JMCA 2FGFA 3CRGA 1I1EA 1EV2A 1DIWA 3BRDA 4J23B 3CA4A 1JT3A 3NBEA 3CAHA 1TWMA 2AAIB 3FJIA 1FMMS 5FZZA 4ZKTB 2KH2A 3BADA 1IHKA 3AH4A 2F2FA 1ITBA 1SR4A 3AZVA 1RY7A 1G82A 1TTUA 2QN4A 4JKQA 2NZ9A 4LO0C 3UD7A 4II0A 1UPSA 3H6SE 1CVSA 3FJ9A 3PUBA 4OEFA 4Z8SB 4I4YA 3NBDA 2VSEA 2VUAA 1IRAX 3OJ2A 1AFCA 1J0SA 4IZEA 5JLVA 4LO7B 2ET2A 3RTJB 3AJ5A 4GAIA 3P53A 3V79C 1ISYA 4JAWA 2LIQA 31BIA 2DS0A 1W3FA 2BEBA 2DREA 3BAOA 3FGMA 2RG9B 1IJTA 4LO1C 3S8JA 1W3GA 1AVUA 2KKIA 3ZX7A 3V0AA 5B2HA 1K5UA 1IILA 3R4UA 4YOLA 4X39A 1WBAA 4OW4A 4KBBA 2VXTI 3NBCA 2L5XA 1Q03A 8I1BA 2D43A 3OGFA 3ZC8A 3WO3A 3A23A 1T4QA 1TWEA 4DEPA 3FJJA 1BA7A 3ZXGA 2D7RA 3SNVA 3FJKA 3I2AA 4H04A 1S0GA 2ZR1B 3Q7WA 2D7IA 5EC5A 3O44A 1TFMB 4D8HA 2RQ9A 4PC4A 4A7ZA 3WMUA 4ZOTA 3UDAA 3CA5A 4QKSA 1S0FA 4USPA 1S0BA 4KC3A 1I1BA 4QO3A 2VXRA 3HSMA 4LO7C 1HIBA 1M2TB 3JUTA 1S0LA 1PUUB 1YBIA 1YF8B 1OQLB 3R4SA 3MALA 3FJCA 3IM7A 2KLLA 3CA0A 1MC9A 3I29B 3TC2A 5BXTA 4EFRA 1DJSB 3AH1A 3O3QA 3RTIB 1JT5A 3F62B 5BP5C 3OJMA 1RMLA 5BXSA 1DZCA 5D62A 2K43A 1BASA 3HN1A 2HWMA 5F8YA 3IM5A 1FN0A 1NUNA 2P23A 3PG0A 4GP0A 4LO2A 1D0HA 1VCLA 3V0AB 5FNXA 4X37A 5FZUA 3T8SA 3FUQA 3WMVA 1EPWA 2D23A 1FQ9A 1JT7A 2NYYA 4G9MA 4WBCA 2MLLB 4IYBA 2IWTB 1YXWA 3CRIA 2F2FC 5GAQA 3K1XA 3BX1C 4QBCA 1SR4C 3E8LC 3N0KA 1BFFA 3Q7XA 2QYIB 3OBTA 3P6IA 5D63A 2ZQOA 4ZFYB 1JT4A 3FJDA 1G9CA 5BQUA 3AKFA 3BA4A 5DSSB 3IAGC 4OEEA 2Y9FA 5F90A 1HWPB 4I7IA 1PUMB 4XFUA 1JLYA 1JLXA 4LO8B 4L4IA 4ISQA 1W3AA 3NBNA 3BTAA 1Z2VA 3V0BA 2DRZA 2Y9GA 4HJJA 4ZLBB 2WRYA 3LTQA 3BA5A 3PHZA 3POKA 4I1EA 2FFUA 1WD3A 4ZGRB 4XFSA 5E24E 2GO2A 3BRGC 1EVTA 2MC2A 3N7KA 1G9AA 1YYNA 1XYFA 3NJ5A 1PZZA 1XZZA 3RMYA 4I4RA 2WBCA 4G6JA 1P63A 4CJMA 2MIBA 2E4MA 1JQZA 1JY0A 5DZUA 21BIA 3VT0A 3BAUA 1FV3A 1FMZA 5FZYA 4P0JA 1BARA 1T9FA 4OWLA 1SZ6B 4KEJA 4FGFA 5BVPI 4P6AA 1HWMB 4QBVA 4GAFA 3VEQA 4LO0A 2AFGA 3VSZA 4A7YA 41BIA 1F31A 4J2KA 1M16A 1Q04A 3PMEA 2D20A 3VUOA 3AH2A 1ISWA 1DQOA 3VT1A 2YUGA 3B9UA 2X2SA 4DENA 2Z49A 3O5WB 3BAQA 2AQZA 4I1BA 3BAGA 4IY9A 1YTOA 4USOA 3FJHA 2IHOA 2FO1A 2K8RA 2D44A 3QYDA 3AKHA 5EG6C 3BRFA 3UJ0A 2HW9A 3P6JA 1IOBA 4JPZA 4KEIA 4X3AA 1ONKB 3A21A
chains in the Genus database with same CATH superfamily
1Z0HA 4F34A 1V6UA 3OJVA 3A07A 1DFQA 3Q7YA 4LO2C 3AKIA 4A7KA 1HWNB 1BFGA 4I6IA 1CE7B 2ESUA 3VT2A 3WINC 9ILBA 2BEAA 4J2XA 5BXRA 2FDBM 4P0KA 4I3NA 1V6WA 3H6QA 4I4VA 2Q3NB 3HOMA 2VLCA 3O4BA 4JQ0A 3CRHA 3EF2A 3QR5A 1DLLA 1PWAA 3O4OA 4EB2B 3CU1B 4I4OA 3AZWA 3UD8A 3CA1A 1R8NA 1QXMA 4ZA3B 2J3PA 4I4PA 2Y9XE 1NZKA 4I4UA 4LO3A 4QKRA 1XHBA 5F8SA 3W9TA 2R9KB 4D0ZA 3N7LA 1HWOB 1AVWB 3FFZA 4H9WA 4IONA 4R6UB 3UD9A 4DCKC 3ILAA 3CA6A 1QQLA 4F83A 1AF9A 2ERMA 4AN6A 5DUYA 4IZXA 1FWUA 1ISVA 1BLAA 1WD4A 4I96A 4L4HA 4I37A 1N4KA 3RSJA 4I4SA 3BAVA 4IHZA 4MZFB 3D7WB 4IY8A 4I0YA 3OGGA 2E4MC 4JP0A 3A22A 4I4XA 1XG6A 4I8MA 3WO4A 2HZ9A 2D1ZA 3IM6A 2BFHA 3FJ8A 4QD2B 1TOOA 1E0OA 2M49A 4GP3A 4I2SA 4JRAA 5FNWA 1G9BA 4G1RA 4IQPA 2Z48A 3BA7A 2NM1A 2DRYA 3H6RA 1G9DA 4GOYA 2KI4A 2NP0A 2XOAA 1Z4SA 2NVHA 3FJEA 2KI6B 4Q9PA 1WBCA 1AXMA 3RMXA 4FVVA 4EEEB 1DFCA 3O49A 4ISRA 4OUJA 1TP0A 4ZFUB 5I1BA 1S0CA 2UUSA 1K5VA 5D61A 2Q9XA 3FJAA 5F8WA 7I1BA 1EYLA 1FWVA 4J2SA 2VSAA 3HBWA 1A8DA 3UJ4A 3AJ6A 4G9NA 3JRRA 2VU9A 4OEGA 1PC8B 3MPPG 4G6MA 5EHAA 4TLPA 5G00A 4QC4A 1FV2A 1HKNA 3F1RA 2HWAA 1L2HA 3S8KA 3HALA 1RZOB 3OBRA 1GGPB 1DZDA 2Y9WC 1AVAC 4LO1A 3V0BB 4Q91A 4P0LA 3AKGA 3LLPA 4QD2C 4XKIA 1HCDA 3FUOA 4OWKA 5DVHA 2AXMA 4H75A 1JTCA 2P39A 4GOVA 1II4A 5BOWA 3ZXDA 3BAHA 3CQAA 4X38A 1BFBA 1ILR1 4AN7B 3N7JA 2RSTA 4ENDA 6I1BA 2F8XC 4JKXB 2D22A 4HA2A 3H6RB 1V6XA 1QQKA 3BB2A 4ZFWB 2GZBA 4LO3C 4EFPA 2X2TA 2I1BA 3FJFA 4Z9WB 3HMYA 2D24A 1ISZA 3O4AA 2LIEA 3C9ZA 3WO2A 3O4CA 1FGAA 4HR6C 3ZC9A 4ZBVB 4XFTA 4D0TA 1MD6A 4EFQA 1KNMA 3IIRA 1S0DA 2NTDA 3VWCA 3KMVA 4J2YA 4EKXB 4OWJA 3WA1A 4Q9GA 5BQUC 4KEKA 4QALA 1IT0A 4I4QA 1AVXB 5HPZA 3N7MA 1IRPA 1Q1UA 1TIEA 1HCEA 1BLDA 1ISXA 2FFVA 1S0EA 3FJBA 2ZQNA 1ABRB 3O4DA 1V6VA 3CA3A 3WINA 3VSFA 5BP5A 2K4AB 1BFCA 3I2XA 5BXPA 1R8OA 1RG8A 1DQGA 5JMCA 2FGFA 3CRGA 1I1EA 1EV2A 1DIWA 3BRDA 4J23B 3CA4A 1JT3A 3NBEA 3CAHA 1TWMA 2AAIB 3FJIA 1FMMS 5FZZA 4ZKTB 2KH2A 3BADA 1IHKA 3AH4A 2F2FA 4MZGB 1ITBA 1SR4A 3AZVA 1RY7A 1G82A 1TTUA 2QN4A 4JKQA 2NZ9A 4LO0C 3UD7A 4II0A 1UPSA 3H6SE 1CVSA 3FJ9A 3PUBA 4OEFA 4Z8SB 4I4YA 3NBDA 2VSEA 2VUAA 1IRAX 3OJ2A 1AFCA 1J0SA 4IZEA 5JLVA 4LO7B 2ET2A 3RTJB 3AJ5A 4GAIA 3P53A 3V79C 1ISYA 4JAWA 2LIQA 31BIA 2DS0A 1W3FA 2BEBA 2DREA 3BAOA 3FGMA 2RG9B 1IJTA 4LO1C 3S8JA 1W3GA 1AVUA 2KKIA 3ZX7A 3V0AA 5B2HA 1K5UA 1IILA 3R4UA 4YOLA 4X39A 1WBAA 4OW4A 4KBBA 2VXTI 3NBCA 2L5XA 1Q03A 8I1BA 2D43A 3OGFA 3ZC8A 3WO3A 3A23A 1T4QA 1TWEA 4DEPA 3FJJA 1BA7A 3ZXGA 2D7RA 3SNVA 3FJKA 3I2AA 4H04A 1S0GA 2ZR1B 3Q7WA 2D7IA 5EC5A 3O44A 1TFMB 4D8HA 2RQ9A 4PC4A 4A7ZA 3WMUA 4ZOTA 3UDAA 3CA5A 4QKSA 1S0FA 4USPA 1S0BA 4KC3A 1I1BA 4QO3A 2VXRA 3HSMA 4LO7C 1HIBA 1M2TB 3JUTA 1S0LA 1PUUB 1YBIA 1YF8B 1OQLB 3R4SA 3MALA 3FJCA 3IM7A 4MZHA 2KLLA 3CA0A 1MC9A 3I29B 3TC2A 5BXTA 4EFRA 1DJSB 3AH1A 3O3QA 3RTIB 1JT5A 3F62B 5BP5C 3OJMA 1RMLA 5BXSA 1DZCA 5D62A 2K43A 1BASA 3HN1A 2HWMA 5F8YA 3IM5A 1FN0A 1NUNA 2P23A 3PG0A 4GP0A 4LO2A 1D0HA 1VCLA 3V0AB 5FNXA 4X37A 5FZUA 3T8SA 3FUQA 3WMVA 2NS2A 1EPWA 2D23A 1FQ9A 1JT7A 2NYYA 4G9MA 4WBCA 2MLLB 4IYBA 2IWTB 1YXWA 3CRIA 2F2FC 5GAQA 3K1XA 3BX1C 4QBCA 1SR4C 3E8LC 3N0KA 1BFFA 3Q7XA 2QYIB 3OBTA 3P6IA 5D63A 2ZQOA 4ZFYB 1JT4A 3FJDA 1G9CA 5BQUA 3AKFA 3BA4A 5DSSB 3IAGC 4OEEA 2Y9FA 5F90A 1HWPB 4I7IA 1PUMB 4XFUA 1JLYA 1JLXA 4LO8B 4L4IA 4ISQA 1W3AA 3NBNA 3BTAA 1Z2VA 3V0BA 2DRZA 2Y9GA 4HJJA 4ZLBB 2WRYA 3LTQA 3BA5A 3PHZA 3POKA 4I1EA 2FFUA 1WD3A 4ZGRB 4XFSA 5E24E 2GO2A 3BRGC 1EVTA 2MC2A 3N7KA 1G9AA 1YYNA 1XYFA 3NJ5A 1PZZA 1XZZA 3RMYA 4I4RA 2WBCA 4G6JA 1P63A 4CJMA 2MIBA 2E4MA 1JQZA 1JY0A 5DZUA 21BIA 3VT0A 3BAUA 1FV3A 1FMZA 5FZYA 4P0JA 4UY4A 1BARA 1T9FA 4OWLA 1SZ6B 4KEJA 4FGFA 5BVPI 4P6AA 1HWMB 4QBVA 4GAFA 3VEQA 4LO0A 2AFGA 3VSZA 4A7YA 41BIA 1F31A 4J2KA 1M16A 1Q04A 3PMEA 2D20A 3VUOA 3AH2A 1ISWA 1DQOA 3VT1A 2YUGA 3B9UA 2X2SA 4DENA 2Z49A 3O5WB 3BAQA 2AQZA 4I1BA 3BAGA 4IY9A 1YTOA 4USOA 3FJHA 2IHOA 2FO1A 2K8RA 2D44A 3QYDA 3AKHA 5EG6C 3BRFA 3UJ0A 2HW9A 3P6JA 1IOBA 4JPZA 4KEIA 4X3AA 1ONKB 3A21A
chains in the Genus database with same CATH topology
1Z0HA 4F34A 1V6UA 3OJVA 3A07A 1DFQA 3Q7YA 4LO2C 3AKIA 4A7KA 1HWNB 1BFGA 4I6IA 1CE7B 2ESUA 3VT2A 3WINC 9ILBA 2BEAA 4J2XA 5BXRA 2FDBM 4P0KA 4I3NA 1V6WA 3H6QA 4I4VA 2Q3NB 3HOMA 2VLCA 3O4BA 4JQ0A 3CRHA 3EF2A 3QR5A 1DLLA 1PWAA 3O4OA 4EB2B 3CU1B 4I4OA 3AZWA 3UD8A 3CA1A 1R8NA 1QXMA 4ZA3B 2J3PA 4I4PA 2Y9XE 1NZKA 4I4UA 4LO3A 4QKRA 1XHBA 5F8SA 3W9TA 2R9KB 4D0ZA 3N7LA 1HWOB 1AVWB 3FFZA 4H9WA 4IONA 4R6UB 3UD9A 4DCKC 3ILAA 3CA6A 1QQLA 4F83A 1AF9A 2ERMA 4AN6A 5DUYA 4IZXA 1FWUA 1ISVA 1BLAA 1WD4A 4I96A 4L4HA 4I37A 1N4KA 3RSJA 4I4SA 3BAVA 4IHZA 4MZFB 3D7WB 4IY8A 4I0YA 3OGGA 2E4MC 4JP0A 3A22A 4I4XA 1XG6A 4I8MA 3WO4A 2HZ9A 2D1ZA 3IM6A 2BFHA 3FJ8A 4QD2B 1TOOA 1E0OA 2M49A 4GP3A 4I2SA 4JRAA 5FNWA 1G9BA 4G1RA 4IQPA 2Z48A 3BA7A 2NM1A 2DRYA 3H6RA 1G9DA 4GOYA 2KI4A 2NP0A 2XOAA 1Z4SA 2NVHA 3FJEA 2KI6B 4Q9PA 1WBCA 1AXMA 3RMXA 4FVVA 4EEEB 1DFCA 3O49A 4ISRA 4OUJA 1TP0A 4ZFUB 5I1BA 1S0CA 2UUSA 1K5VA 5D61A 2Q9XA 3FJAA 5F8WA 7I1BA 1EYLA 1FWVA 4J2SA 2VSAA 3HBWA 1A8DA 3UJ4A 3AJ6A 4G9NA 3JRRA 2VU9A 4OEGA 1PC8B 3MPPG 4G6MA 5EHAA 4TLPA 5G00A 4QC4A 1FV2A 1HKNA 3F1RA 2HWAA 1L2HA 3S8KA 3HALA 1RZOB 3OBRA 1GGPB 1DZDA 2Y9WC 1AVAC 4LO1A 3V0BB 4Q91A 4P0LA 3AKGA 3LLPA 4QD2C 4XKIA 1HCDA 3FUOA 4OWKA 5DVHA 2AXMA 4H75A 1JTCA 2P39A 4GOVA 1II4A 5BOWA 3ZXDA 3BAHA 3CQAA 4X38A 1BFBA 1ILR1 4AN7B 3N7JA 2RSTA 4ENDA 6I1BA 2F8XC 4JKXB 2D22A 4HA2A 3H6RB 1V6XA 1QQKA 3BB2A 4ZFWB 2GZBA 4LO3C 4EFPA 2X2TA 2I1BA 3FJFA 4Z9WB 3HMYA 2D24A 1ISZA 3O4AA 2LIEA 3C9ZA 3WO2A 3O4CA 1FGAA 4HR6C 3ZC9A 4ZBVB 4XFTA 4D0TA 1MD6A 4EFQA 1KNMA 3IIRA 1S0DA 2NTDA 3VWCA 3KMVA 4J2YA 4EKXB 4OWJA 3WA1A 4Q9GA 5BQUC 4KEKA 4QALA 1IT0A 4I4QA 1AVXB 5HPZA 3N7MA 1IRPA 1Q1UA 1TIEA 1HCEA 1BLDA 1ISXA 2FFVA 1S0EA 3FJBA 2ZQNA 1ABRB 3O4DA 1V6VA 3CA3A 3WINA 3VSFA 5BP5A 2K4AB 1BFCA 3I2XA 5BXPA 1R8OA 1RG8A 1DQGA 5JMCA 2FGFA 3CRGA 1I1EA 1EV2A 1DIWA 3BRDA 4J23B 3CA4A 1JT3A 3NBEA 3CAHA 1TWMA 2AAIB 3FJIA 1FMMS 5FZZA 4ZKTB 2KH2A 3BADA 1IHKA 3AH4A 2F2FA 4MZGB 1ITBA 1SR4A 3AZVA 1RY7A 1G82A 1TTUA 2QN4A 4JKQA 2NZ9A 4LO0C 3UD7A 4II0A 1UPSA 3H6SE 1CVSA 3FJ9A 3PUBA 4OEFA 4Z8SB 4I4YA 3NBDA 2VSEA 2VUAA 1IRAX 3OJ2A 1AFCA 1J0SA 4IZEA 5JLVA 4LO7B 2ET2A 3RTJB 3AJ5A 4GAIA 3P53A 3V79C 1ISYA 4JAWA 2LIQA 31BIA 2DS0A 1W3FA 2BEBA 2DREA 3BAOA 3FGMA 2RG9B 1IJTA 4LO1C 3S8JA 1W3GA 1AVUA 2KKIA 3ZX7A 3V0AA 5B2HA 1K5UA 1IILA 3R4UA 4YOLA 4X39A 1WBAA 4OW4A 4KBBA 2VXTI 3NBCA 2L5XA 1Q03A 8I1BA 2D43A 3OGFA 3ZC8A 3WO3A 3A23A 1T4QA 1TWEA 4DEPA 3FJJA 1BA7A 3ZXGA 2D7RA 3SNVA 3FJKA 3I2AA 4H04A 1S0GA 2ZR1B 3Q7WA 2D7IA 5EC5A 3O44A 1TFMB 4D8HA 2RQ9A 4PC4A 4A7ZA 3WMUA 4ZOTA 3UDAA 3CA5A 4QKSA 1S0FA 4USPA 1S0BA 4KC3A 1I1BA 4QO3A 2VXRA 3HSMA 4LO7C 1HIBA 1M2TB 3JUTA 1S0LA 1PUUB 1YBIA 1YF8B 1OQLB 3R4SA 3MALA 3FJCA 3IM7A 4MZHA 2KLLA 3CA0A 1MC9A 3I29B 3TC2A 5BXTA 4EFRA 1DJSB 3AH1A 3O3QA 3RTIB 1JT5A 3F62B 5BP5C 3OJMA 1RMLA 5BXSA 1DZCA 5D62A 2K43A 1BASA 3HN1A 2HWMA 5F8YA 3IM5A 1FN0A 1NUNA 2P23A 3PG0A 4GP0A 4LO2A 1D0HA 1VCLA 3V0AB 5FNXA 4X37A 5FZUA 3T8SA 3FUQA 3WMVA 2NS2A 1EPWA 2D23A 1FQ9A 1JT7A 2NYYA 4G9MA 4WBCA 2MLLB 4IYBA 2IWTB 1YXWA 3CRIA 2F2FC 5GAQA 3K1XA 3BX1C 4QBCA 1SR4C 3E8LC 3N0KA 1BFFA 3Q7XA 2QYIB 3OBTA 3P6IA 5D63A 2ZQOA 4ZFYB 1JT4A 3FJDA 1G9CA 5BQUA 3AKFA 3BA4A 5DSSB 3IAGC 4OEEA 2Y9FA 5F90A 1HWPB 4I7IA 1PUMB 4XFUA 1JLYA 1JLXA 4LO8B 4L4IA 4ISQA 1W3AA 3NBNA 3BTAA 1Z2VA 3V0BA 2DRZA 2Y9GA 4HJJA 4ZLBB 2WRYA 3LTQA 3BA5A 3PHZA 3POKA 4I1EA 2FFUA 1WD3A 4ZGRB 4XFSA 5E24E 2GO2A 3BRGC 1EVTA 2MC2A 3N7KA 1G9AA 1YYNA 1XYFA 3NJ5A 1PZZA 1XZZA 3RMYA 4I4RA 2WBCA 4G6JA 1P63A 4CJMA 2MIBA 2E4MA 1JQZA 1JY0A 5DZUA 21BIA 3VT0A 3BAUA 1FV3A 1FMZA 5FZYA 4P0JA 4UY4A 1BARA 1T9FA 4OWLA 1SZ6B 4KEJA 4FGFA 5BVPI 4P6AA 1HWMB 4QBVA 4GAFA 3VEQA 4LO0A 2AFGA 3VSZA 4A7YA 41BIA 1F31A 4J2KA 1M16A 1Q04A 3PMEA 2D20A 3VUOA 3AH2A 1ISWA 1DQOA 3VT1A 2YUGA 3B9UA 2X2SA 4DENA 2Z49A 3O5WB 3BAQA 2AQZA 4I1BA 3BAGA 4IY9A 1YTOA 4USOA 3FJHA 2IHOA 2FO1A 2K8RA 2D44A 3QYDA 3AKHA 5EG6C 3BRFA 3UJ0A 2HW9A 3P6JA 1IOBA 4JPZA 4KEIA 4X3AA 1ONKB 3A21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0H A;  4F34 A;  1V6U A;  3OJV A;  3A07 A;  1DFQ A;  3Q7Y A;  4LO2 C;  3AKI A;  4A7K A;  1HWN B;  1BFG A;  4I6I A;  1CE7 B;  2ESU A;  3VT2 A;  3WIN C;  9ILB A;  2BEA A;  4J2X A;  5BXR A;  2FDB M;  4P0K A;  4I3N A;  1V6W A;  3H6Q A;  4I4V A;  2Q3N B;  3HOM A;  2VLC A;  3O4B A;  4JQ0 A;  3CRH A;  3EF2 A;  3QR5 A;  1DLL A;  1PWA A;  3O4O A;  4EB2 B;  3CU1 B;  4I4O A;  3AZW A;  3UD8 A;  3CA1 A;  1R8N A;  1QXM A;  4ZA3 B;  2J3P A;  4I4P A;  2Y9X E;  1NZK A;  4I4U A;  4LO3 A;  4QKR A;  1XHB A;  5F8S A;  3W9T A;  2R9K B;  4D0Z A;  3N7L A;  1HWO B;  1AVW B;  3FFZ A;  4H9W A;  4ION A;  4R6U B;  3UD9 A;  4DCK C;  3ILA A;  3CA6 A;  1QQL A;  4F83 A;  1AF9 A;  2ERM A;  4AN6 A;  5DUY A;  4IZX A;  1FWU A;  1ISV A;  1BLA A;  1WD4 A;  4I96 A;  4L4H A;  4I37 A;  1N4K A;  3RSJ A;  4I4S A;  3BAV A;  4IHZ A;  3D7W B;  4IY8 A;  4I0Y A;  3OGG A;  2E4M C;  4JP0 A;  3A22 A;  4I4X A;  1XG6 A;  4I8M A;  3WO4 A;  2HZ9 A;  2D1Z A;  3IM6 A;  2BFH A;  3FJ8 A;  4QD2 B;  1TOO A;  1E0O A;  2M49 A;  4GP3 A;  4I2S A;  4JRA A;  5FNW A;  1G9B A;  4G1R A;  4IQP A;  2Z48 A;  3BA7 A;  2NM1 A;  2DRY A;  3H6R A;  1G9D A;  4GOY A;  2KI4 A;  2NP0 A;  2XOA A;  1Z4S A;  2NVH A;  3FJE A;  2KI6 B;  4Q9P A;  1WBC A;  1AXM A;  3RMX A;  4FVV A;  4EEE B;  1DFC A;  3O49 A;  4ISR A;  4OUJ A;  1TP0 A;  4ZFU B;  5I1B A;  1S0C A;  2UUS A;  1K5V A;  5D61 A;  2Q9X A;  3FJA A;  5F8W A;  7I1B A;  1EYL A;  1FWV A;  4J2S A;  2VSA A;  3HBW A;  1A8D A;  3UJ4 A;  3AJ6 A;  4G9N A;  3JRR A;  2VU9 A;  4OEG A;  1PC8 B;  3MPP G;  4G6M A;  5EHA A;  4TLP A;  5G00 A;  4QC4 A;  1FV2 A;  1HKN A;  3F1R A;  2HWA A;  1L2H A;  3S8K A;  3HAL A;  1RZO B;  3OBR A;  1GGP B;  1DZD A;  2Y9W C;  1AVA C;  4LO1 A;  3V0B B;  4Q91 A;  4P0L A;  3AKG A;  3LLP A;  4QD2 C;  4XKI A;  1HCD A;  3FUO A;  4OWK A;  5DVH A;  2AXM A;  1JTC A;  2P39 A;  4GOV A;  1II4 A;  5BOW A;  3ZXD A;  3BAH A;  3CQA A;  4X38 A;  1BFB A;  1ILR 1;  4AN7 B;  3N7J A;  2RST A;  4END A;  6I1B A;  2F8X C;  4JKX B;  2D22 A;  4HA2 A;  3H6R B;  1V6X A;  1QQK A;  3BB2 A;  4ZFW B;  2GZB A;  4LO3 C;  4EFP A;  2X2T A;  2I1B A;  3FJF A;  4Z9W B;  3HMY A;  2D24 A;  1ISZ A;  3O4A A;  2LIE A;  3C9Z A;  3WO2 A;  3O4C A;  1FGA A;  4HR6 C;  3ZC9 A;  4ZBV B;  4XFT A;  4D0T A;  1MD6 A;  4EFQ A;  1KNM A;  3IIR A;  1S0D A;  2NTD A;  3VWC A;  3KMV A;  4J2Y A;  4EKX B;  4OWJ A;  3WA1 A;  4Q9G A;  5BQU C;  4KEK A;  4QAL A;  1IT0 A;  4I4Q A;  1AVX B;  5HPZ A;  3N7M A;  1IRP A;  1Q1U A;  1TIE A;  1HCE A;  1BLD A;  1ISX A;  2FFV A;  1S0E A;  3FJB A;  2ZQN A;  1ABR B;  3O4D A;  1V6V A;  3CA3 A;  3WIN A;  3VSF A;  5BP5 A;  2K4A B;  1BFC A;  3I2X A;  5BXP A;  1R8O A;  1RG8 A;  1DQG A;  5JMC A;  2FGF A;  3CRG A;  1I1E A;  1EV2 A;  1DIW A;  3BRD A;  4J23 B;  3CA4 A;  1JT3 A;  3NBE A;  3CAH A;  1TWM A;  2AAI B;  3FJI A;  1FMM S;  5FZZ A;  4ZKT B;  2KH2 A;  3BAD A;  1IHK A;  3AH4 A;  2F2F A;  1ITB A;  1SR4 A;  3AZV A;  1RY7 A;  1G82 A;  1TTU A;  2QN4 A;  4JKQ A;  2NZ9 A;  4LO0 C;  3UD7 A;  4II0 A;  1UPS A;  3H6S E;  1CVS A;  3FJ9 A;  3PUB A;  4OEF A;  4Z8S B;  4I4Y A;  3NBD A;  2VSE A;  2VUA A;  1IRA X;  3OJ2 A;  1AFC A;  1J0S A;  4IZE A;  5JLV A;  4LO7 B;  2ET2 A;  3RTJ B;  3AJ5 A;  4GAI A;  3P53 A;  3V79 C;  1ISY A;  4JAW A;  2LIQ A;  31BI A;  2DS0 A;  1W3F A;  2BEB A;  2DRE A;  3BAO A;  3FGM A;  2RG9 B;  1IJT A;  4LO1 C;  3S8J A;  1W3G A;  1AVU A;  2KKI A;  3ZX7 A;  3V0A A;  5B2H A;  1K5U A;  1IIL A;  3R4U A;  4YOL A;  4X39 A;  1WBA A;  4OW4 A;  4KBB A;  2VXT I;  3NBC A;  2L5X A;  1Q03 A;  8I1B A;  2D43 A;  3OGF A;  3ZC8 A;  3WO3 A;  3A23 A;  1T4Q A;  1TWE A;  4DEP A;  3FJJ A;  1BA7 A;  3ZXG A;  2D7R A;  3SNV A;  3FJK A;  3I2A A;  4H04 A;  1S0G A;  2ZR1 B;  3Q7W A;  2D7I A;  5EC5 A;  3O44 A;  1TFM B;  4D8H A;  2RQ9 A;  4PC4 A;  4A7Z A;  3WMU A;  4ZOT A;  3UDA A;  3CA5 A;  4QKS A;  1S0F A;  4USP A;  1S0B A;  4KC3 A;  1I1B A;  4QO3 A;  2VXR A;  3HSM A;  4LO7 C;  1HIB A;  1M2T B;  3JUT A;  1S0L A;  1PUU B;  1YBI A;  1YF8 B;  1OQL B;  3R4S A;  3MAL A;  3FJC A;  3IM7 A;  2KLL A;  3CA0 A;  1MC9 A;  3I29 B;  3TC2 A;  5BXT A;  4EFR A;  1DJS B;  3AH1 A;  3O3Q A;  3RTI B;  1JT5 A;  3F62 B;  5BP5 C;  3OJM A;  1RML A;  5BXS A;  1DZC A;  5D62 A;  2K43 A;  1BAS A;  3HN1 A;  2HWM A;  5F8Y A;  3IM5 A;  1FN0 A;  1NUN A;  2P23 A;  3PG0 A;  4GP0 A;  4LO2 A;  1D0H A;  1VCL A;  3V0A B;  5FNX A;  4X37 A;  5FZU A;  3T8S A;  3FUQ A;  3WMV A;  1EPW A;  2D23 A;  1FQ9 A;  1JT7 A;  2NYY A;  4G9M A;  4WBC A;  2MLL B;  4IYB A;  2IWT B;  1YXW A;  3CRI A;  2F2F C;  5GAQ A;  3K1X A;  3BX1 C;  4QBC A;  1SR4 C;  3E8L C;  3N0K A;  1BFF A;  3Q7X A;  2QYI B;  3OBT A;  3P6I A;  5D63 A;  2ZQO A;  4ZFY B;  1JT4 A;  3FJD A;  1G9C A;  5BQU A;  3AKF A;  3BA4 A;  5DSS B;  3IAG C;  4OEE A;  2Y9F A;  5F90 A;  1HWP B;  4I7I A;  1PUM B;  4XFU A;  1JLY A;  1JLX A;  4LO8 B;  4L4I A;  4ISQ A;  1W3A A;  3NBN A;  3BTA A;  1Z2V A;  3V0B A;  2DRZ A;  2Y9G A;  4HJJ A;  4ZLB B;  2WRY A;  3LTQ A;  3BA5 A;  3PHZ A;  3POK A;  4I1E A;  2FFU A;  1WD3 A;  4ZGR B;  4XFS A;  5E24 E;  2GO2 A;  3BRG C;  1EVT A;  2MC2 A;  3N7K A;  1G9A A;  1YYN A;  1XYF A;  3NJ5 A;  1PZZ A;  1XZZ A;  3RMY A;  4I4R A;  2WBC A;  4G6J A;  1P63 A;  4CJM A;  2MIB A;  2E4M A;  1JQZ A;  1JY0 A;  5DZU A;  21BI A;  3VT0 A;  3BAU A;  1FV3 A;  1FMZ A;  5FZY A;  4P0J A;  1BAR A;  1T9F A;  4OWL A;  1SZ6 B;  4KEJ A;  4FGF A;  5BVP I;  4P6A A;  1HWM B;  4QBV A;  4GAF A;  3VEQ A;  4LO0 A;  2AFG A;  3VSZ A;  4A7Y A;  41BI A;  1F31 A;  4J2K A;  1M16 A;  1Q04 A;  3PME A;  2D20 A;  3VUO A;  3AH2 A;  1ISW A;  1DQO A;  3VT1 A;  2YUG A;  3B9U A;  2X2S A;  4DEN A;  2Z49 A;  3O5W B;  3BAQ A;  2AQZ A;  4I1B A;  3BAG A;  4IY9 A;  1YTO A;  4USO A;  3FJH A;  2IHO A;  2FO1 A;  2K8R A;  2D44 A;  3QYD A;  3AKH A;  5EG6 C;  3BRF A;  3UJ0 A;  2HW9 A;  3P6J A;  1IOB A;  4JPZ A;  4KEI A;  4X3A A;  1ONK B;  3A21 A; 
#chains in the Genus database with same CATH topology
 1Z0H A;  4F34 A;  1V6U A;  3OJV A;  3A07 A;  1DFQ A;  3Q7Y A;  4LO2 C;  3AKI A;  4A7K A;  1HWN B;  1BFG A;  4I6I A;  1CE7 B;  2ESU A;  3VT2 A;  3WIN C;  9ILB A;  2BEA A;  4J2X A;  5BXR A;  2FDB M;  4P0K A;  4I3N A;  1V6W A;  3H6Q A;  4I4V A;  2Q3N B;  3HOM A;  2VLC A;  3O4B A;  4JQ0 A;  3CRH A;  3EF2 A;  3QR5 A;  1DLL A;  1PWA A;  3O4O A;  4EB2 B;  3CU1 B;  4I4O A;  3AZW A;  3UD8 A;  3CA1 A;  1R8N A;  1QXM A;  4ZA3 B;  2J3P A;  4I4P A;  2Y9X E;  1NZK A;  4I4U A;  4LO3 A;  4QKR A;  1XHB A;  5F8S A;  3W9T A;  2R9K B;  4D0Z A;  3N7L A;  1HWO B;  1AVW B;  3FFZ A;  4H9W A;  4ION A;  4R6U B;  3UD9 A;  4DCK C;  3ILA A;  3CA6 A;  1QQL A;  4F83 A;  1AF9 A;  2ERM A;  4AN6 A;  5DUY A;  4IZX A;  1FWU A;  1ISV A;  1BLA A;  1WD4 A;  4I96 A;  4L4H A;  4I37 A;  1N4K A;  3RSJ A;  4I4S A;  3BAV A;  4IHZ A;  4MZF B;  3D7W B;  4IY8 A;  4I0Y A;  3OGG A;  2E4M C;  4JP0 A;  3A22 A;  4I4X A;  1XG6 A;  4I8M A;  3WO4 A;  2HZ9 A;  2D1Z A;  3IM6 A;  2BFH A;  3FJ8 A;  4QD2 B;  1TOO A;  1E0O A;  2M49 A;  4GP3 A;  4I2S A;  4JRA A;  5FNW A;  1G9B A;  4G1R A;  4IQP A;  2Z48 A;  3BA7 A;  2NM1 A;  2DRY A;  3H6R A;  1G9D A;  4GOY A;  2KI4 A;  2NP0 A;  2XOA A;  1Z4S A;  2NVH A;  3FJE A;  2KI6 B;  4Q9P A;  1WBC A;  1AXM A;  3RMX A;  4FVV A;  4EEE B;  1DFC A;  3O49 A;  4ISR A;  4OUJ A;  1TP0 A;  4ZFU B;  5I1B A;  1S0C A;  2UUS A;  1K5V A;  5D61 A;  2Q9X A;  3FJA A;  5F8W A;  7I1B A;  1EYL A;  1FWV A;  4J2S A;  2VSA A;  3HBW A;  1A8D A;  3UJ4 A;  3AJ6 A;  4G9N A;  3JRR A;  2VU9 A;  4OEG A;  1PC8 B;  3MPP G;  4G6M A;  5EHA A;  4TLP A;  5G00 A;  4QC4 A;  1FV2 A;  1HKN A;  3F1R A;  2HWA A;  1L2H A;  3S8K A;  3HAL A;  1RZO B;  3OBR A;  1GGP B;  1DZD A;  2Y9W C;  1AVA C;  4LO1 A;  3V0B B;  4Q91 A;  4P0L A;  3AKG A;  3LLP A;  4QD2 C;  4XKI A;  1HCD A;  3FUO A;  4OWK A;  5DVH A;  2AXM A;  4H75 A;  1JTC A;  2P39 A;  4GOV A;  1II4 A;  5BOW A;  3ZXD A;  3BAH A;  3CQA A;  4X38 A;  1BFB A;  1ILR 1;  4AN7 B;  3N7J A;  2RST A;  4END A;  6I1B A;  2F8X C;  4JKX B;  2D22 A;  4HA2 A;  3H6R B;  1V6X A;  1QQK A;  3BB2 A;  4ZFW B;  2GZB A;  4LO3 C;  4EFP A;  2X2T A;  2I1B A;  3FJF A;  4Z9W B;  3HMY A;  2D24 A;  1ISZ A;  3O4A A;  2LIE A;  3C9Z A;  3WO2 A;  3O4C A;  1FGA A;  4HR6 C;  3ZC9 A;  4ZBV B;  4XFT A;  4D0T A;  1MD6 A;  4EFQ A;  1KNM A;  3IIR A;  1S0D A;  2NTD A;  3VWC A;  3KMV A;  4J2Y A;  4EKX B;  4OWJ A;  3WA1 A;  4Q9G A;  5BQU C;  4KEK A;  4QAL A;  1IT0 A;  4I4Q A;  1AVX B;  5HPZ A;  3N7M A;  1IRP A;  1Q1U A;  1TIE A;  1HCE A;  1BLD A;  1ISX A;  2FFV A;  1S0E A;  3FJB A;  2ZQN A;  1ABR B;  3O4D A;  1V6V A;  3CA3 A;  3WIN A;  3VSF A;  5BP5 A;  2K4A B;  1BFC A;  3I2X A;  5BXP A;  1R8O A;  1RG8 A;  1DQG A;  5JMC A;  2FGF A;  3CRG A;  1I1E A;  1EV2 A;  1DIW A;  3BRD A;  4J23 B;  3CA4 A;  1JT3 A;  3NBE A;  3CAH A;  1TWM A;  2AAI B;  3FJI A;  1FMM S;  5FZZ A;  4ZKT B;  2KH2 A;  3BAD A;  1IHK A;  3AH4 A;  2F2F A;  4MZG B;  1ITB A;  1SR4 A;  3AZV A;  1RY7 A;  1G82 A;  1TTU A;  2QN4 A;  4JKQ A;  2NZ9 A;  4LO0 C;  3UD7 A;  4II0 A;  1UPS A;  3H6S E;  1CVS A;  3FJ9 A;  3PUB A;  4OEF A;  4Z8S B;  4I4Y A;  3NBD A;  2VSE A;  2VUA A;  1IRA X;  3OJ2 A;  1AFC A;  1J0S A;  4IZE A;  5JLV A;  4LO7 B;  2ET2 A;  3RTJ B;  3AJ5 A;  4GAI A;  3P53 A;  3V79 C;  1ISY A;  4JAW A;  2LIQ A;  31BI A;  2DS0 A;  1W3F A;  2BEB A;  2DRE A;  3BAO A;  3FGM A;  2RG9 B;  1IJT A;  4LO1 C;  3S8J A;  1W3G A;  1AVU A;  2KKI A;  3ZX7 A;  3V0A A;  5B2H A;  1K5U A;  1IIL A;  3R4U A;  4YOL A;  4X39 A;  1WBA A;  4OW4 A;  4KBB A;  2VXT I;  3NBC A;  2L5X A;  1Q03 A;  8I1B A;  2D43 A;  3OGF A;  3ZC8 A;  3WO3 A;  3A23 A;  1T4Q A;  1TWE A;  4DEP A;  3FJJ A;  1BA7 A;  3ZXG A;  2D7R A;  3SNV A;  3FJK A;  3I2A A;  4H04 A;  1S0G A;  2ZR1 B;  3Q7W A;  2D7I A;  5EC5 A;  3O44 A;  1TFM B;  4D8H A;  2RQ9 A;  4PC4 A;  4A7Z A;  3WMU A;  4ZOT A;  3UDA A;  3CA5 A;  4QKS A;  1S0F A;  4USP A;  1S0B A;  4KC3 A;  1I1B A;  4QO3 A;  2VXR A;  3HSM A;  4LO7 C;  1HIB A;  1M2T B;  3JUT A;  1S0L A;  1PUU B;  1YBI A;  1YF8 B;  1OQL B;  3R4S A;  3MAL A;  3FJC A;  3IM7 A;  4MZH A;  2KLL A;  3CA0 A;  1MC9 A;  3I29 B;  3TC2 A;  5BXT A;  4EFR A;  1DJS B;  3AH1 A;  3O3Q A;  3RTI B;  1JT5 A;  3F62 B;  5BP5 C;  3OJM A;  1RML A;  5BXS A;  1DZC A;  5D62 A;  2K43 A;  1BAS A;  3HN1 A;  2HWM A;  5F8Y A;  3IM5 A;  1FN0 A;  1NUN A;  2P23 A;  3PG0 A;  4GP0 A;  4LO2 A;  1D0H A;  1VCL A;  3V0A B;  5FNX A;  4X37 A;  5FZU A;  3T8S A;  3FUQ A;  3WMV A;  2NS2 A;  1EPW A;  2D23 A;  1FQ9 A;  1JT7 A;  2NYY A;  4G9M A;  4WBC A;  2MLL B;  4IYB A;  2IWT B;  1YXW A;  3CRI A;  2F2F C;  5GAQ A;  3K1X A;  3BX1 C;  4QBC A;  1SR4 C;  3E8L C;  3N0K A;  1BFF A;  3Q7X A;  2QYI B;  3OBT A;  3P6I A;  5D63 A;  2ZQO A;  4ZFY B;  1JT4 A;  3FJD A;  1G9C A;  5BQU A;  3AKF A;  3BA4 A;  5DSS B;  3IAG C;  4OEE A;  2Y9F A;  5F90 A;  1HWP B;  4I7I A;  1PUM B;  4XFU A;  1JLY A;  1JLX A;  4LO8 B;  4L4I A;  4ISQ A;  1W3A A;  3NBN A;  3BTA A;  1Z2V A;  3V0B A;  2DRZ A;  2Y9G A;  4HJJ A;  4ZLB B;  2WRY A;  3LTQ A;  3BA5 A;  3PHZ A;  3POK A;  4I1E A;  2FFU A;  1WD3 A;  4ZGR B;  4XFS A;  5E24 E;  2GO2 A;  3BRG C;  1EVT A;  2MC2 A;  3N7K A;  1G9A A;  1YYN A;  1XYF A;  3NJ5 A;  1PZZ A;  1XZZ A;  3RMY A;  4I4R A;  2WBC A;  4G6J A;  1P63 A;  4CJM A;  2MIB A;  2E4M A;  1JQZ A;  1JY0 A;  5DZU A;  21BI A;  3VT0 A;  3BAU A;  1FV3 A;  1FMZ A;  5FZY A;  4P0J A;  4UY4 A;  1BAR A;  1T9F A;  4OWL A;  1SZ6 B;  4KEJ A;  4FGF A;  5BVP I;  4P6A A;  1HWM B;  4QBV A;  4GAF A;  3VEQ A;  4LO0 A;  2AFG A;  3VSZ A;  4A7Y A;  41BI A;  1F31 A;  4J2K A;  1M16 A;  1Q04 A;  3PME A;  2D20 A;  3VUO A;  3AH2 A;  1ISW A;  1DQO A;  3VT1 A;  2YUG A;  3B9U A;  2X2S A;  4DEN A;  2Z49 A;  3O5W B;  3BAQ A;  2AQZ A;  4I1B A;  3BAG A;  4IY9 A;  1YTO A;  4USO A;  3FJH A;  2IHO A;  2FO1 A;  2K8R A;  2D44 A;  3QYD A;  3AKH A;  5EG6 C;  3BRF A;  3UJ0 A;  2HW9 A;  3P6J A;  1IOB A;  4JPZ A;  4KEI A;  4X3A A;  1ONK B;  3A21 A; 
#chains in the Genus database with same CATH homology
 1Z0H A;  4F34 A;  1V6U A;  3OJV A;  3A07 A;  1DFQ A;  3Q7Y A;  4LO2 C;  3AKI A;  4A7K A;  1HWN B;  1BFG A;  4I6I A;  1CE7 B;  2ESU A;  3VT2 A;  3WIN C;  9ILB A;  2BEA A;  4J2X A;  5BXR A;  2FDB M;  4P0K A;  4I3N A;  1V6W A;  3H6Q A;  4I4V A;  2Q3N B;  3HOM A;  2VLC A;  3O4B A;  4JQ0 A;  3CRH A;  3EF2 A;  3QR5 A;  1DLL A;  1PWA A;  3O4O A;  4EB2 B;  3CU1 B;  4I4O A;  3AZW A;  3UD8 A;  3CA1 A;  1R8N A;  1QXM A;  4ZA3 B;  2J3P A;  4I4P A;  2Y9X E;  1NZK A;  4I4U A;  4LO3 A;  4QKR A;  1XHB A;  5F8S A;  3W9T A;  2R9K B;  4D0Z A;  3N7L A;  1HWO B;  1AVW B;  3FFZ A;  4H9W A;  4ION A;  4R6U B;  3UD9 A;  4DCK C;  3ILA A;  3CA6 A;  1QQL A;  4F83 A;  1AF9 A;  2ERM A;  4AN6 A;  5DUY A;  4IZX A;  1FWU A;  1ISV A;  1BLA A;  1WD4 A;  4I96 A;  4L4H A;  4I37 A;  1N4K A;  3RSJ A;  4I4S A;  3BAV A;  4IHZ A;  4MZF B;  3D7W B;  4IY8 A;  4I0Y A;  3OGG A;  2E4M C;  4JP0 A;  3A22 A;  4I4X A;  1XG6 A;  4I8M A;  3WO4 A;  2HZ9 A;  2D1Z A;  3IM6 A;  2BFH A;  3FJ8 A;  4QD2 B;  1TOO A;  1E0O A;  2M49 A;  4GP3 A;  4I2S A;  4JRA A;  5FNW A;  1G9B A;  4G1R A;  4IQP A;  2Z48 A;  3BA7 A;  2NM1 A;  2DRY A;  3H6R A;  1G9D A;  4GOY A;  2KI4 A;  2NP0 A;  2XOA A;  1Z4S A;  2NVH A;  3FJE A;  2KI6 B;  4Q9P A;  1WBC A;  1AXM A;  3RMX A;  4FVV A;  4EEE B;  1DFC A;  3O49 A;  4ISR A;  4OUJ A;  1TP0 A;  4ZFU B;  5I1B A;  1S0C A;  2UUS A;  1K5V A;  5D61 A;  2Q9X A;  3FJA A;  5F8W A;  7I1B A;  1EYL A;  1FWV A;  4J2S A;  2VSA A;  3HBW A;  1A8D A;  3UJ4 A;  3AJ6 A;  4G9N A;  3JRR A;  2VU9 A;  4OEG A;  1PC8 B;  3MPP G;  4G6M A;  5EHA A;  4TLP A;  5G00 A;  4QC4 A;  1FV2 A;  1HKN A;  3F1R A;  2HWA A;  1L2H A;  3S8K A;  3HAL A;  1RZO B;  3OBR A;  1GGP B;  1DZD A;  2Y9W C;  1AVA C;  4LO1 A;  3V0B B;  4Q91 A;  4P0L A;  3AKG A;  3LLP A;  4QD2 C;  4XKI A;  1HCD A;  3FUO A;  4OWK A;  5DVH A;  2AXM A;  4H75 A;  1JTC A;  2P39 A;  4GOV A;  1II4 A;  5BOW A;  3ZXD A;  3BAH A;  3CQA A;  4X38 A;  1BFB A;  1ILR 1;  4AN7 B;  3N7J A;  2RST A;  4END A;  6I1B A;  2F8X C;  4JKX B;  2D22 A;  4HA2 A;  3H6R B;  1V6X A;  1QQK A;  3BB2 A;  4ZFW B;  2GZB A;  4LO3 C;  4EFP A;  2X2T A;  2I1B A;  3FJF A;  4Z9W B;  3HMY A;  2D24 A;  1ISZ A;  3O4A A;  2LIE A;  3C9Z A;  3WO2 A;  3O4C A;  1FGA A;  4HR6 C;  3ZC9 A;  4ZBV B;  4XFT A;  4D0T A;  1MD6 A;  4EFQ A;  1KNM A;  3IIR A;  1S0D A;  2NTD A;  3VWC A;  3KMV A;  4J2Y A;  4EKX B;  4OWJ A;  3WA1 A;  4Q9G A;  5BQU C;  4KEK A;  4QAL A;  1IT0 A;  4I4Q A;  1AVX B;  5HPZ A;  3N7M A;  1IRP A;  1Q1U A;  1TIE A;  1HCE A;  1BLD A;  1ISX A;  2FFV A;  1S0E A;  3FJB A;  2ZQN A;  1ABR B;  3O4D A;  1V6V A;  3CA3 A;  3WIN A;  3VSF A;  5BP5 A;  2K4A B;  1BFC A;  3I2X A;  5BXP A;  1R8O A;  1RG8 A;  1DQG A;  5JMC A;  2FGF A;  3CRG A;  1I1E A;  1EV2 A;  1DIW A;  3BRD A;  4J23 B;  3CA4 A;  1JT3 A;  3NBE A;  3CAH A;  1TWM A;  2AAI B;  3FJI A;  1FMM S;  5FZZ A;  4ZKT B;  2KH2 A;  3BAD A;  1IHK A;  3AH4 A;  2F2F A;  4MZG B;  1ITB A;  1SR4 A;  3AZV A;  1RY7 A;  1G82 A;  1TTU A;  2QN4 A;  4JKQ A;  2NZ9 A;  4LO0 C;  3UD7 A;  4II0 A;  1UPS A;  3H6S E;  1CVS A;  3FJ9 A;  3PUB A;  4OEF A;  4Z8S B;  4I4Y A;  3NBD A;  2VSE A;  2VUA A;  1IRA X;  3OJ2 A;  1AFC A;  1J0S A;  4IZE A;  5JLV A;  4LO7 B;  2ET2 A;  3RTJ B;  3AJ5 A;  4GAI A;  3P53 A;  3V79 C;  1ISY A;  4JAW A;  2LIQ A;  31BI A;  2DS0 A;  1W3F A;  2BEB A;  2DRE A;  3BAO A;  3FGM A;  2RG9 B;  1IJT A;  4LO1 C;  3S8J A;  1W3G A;  1AVU A;  2KKI A;  3ZX7 A;  3V0A A;  5B2H A;  1K5U A;  1IIL A;  3R4U A;  4YOL A;  4X39 A;  1WBA A;  4OW4 A;  4KBB A;  2VXT I;  3NBC A;  2L5X A;  1Q03 A;  8I1B A;  2D43 A;  3OGF A;  3ZC8 A;  3WO3 A;  3A23 A;  1T4Q A;  1TWE A;  4DEP A;  3FJJ A;  1BA7 A;  3ZXG A;  2D7R A;  3SNV A;  3FJK A;  3I2A A;  4H04 A;  1S0G A;  2ZR1 B;  3Q7W A;  2D7I A;  5EC5 A;  3O44 A;  1TFM B;  4D8H A;  2RQ9 A;  4PC4 A;  4A7Z A;  3WMU A;  4ZOT A;  3UDA A;  3CA5 A;  4QKS A;  1S0F A;  4USP A;  1S0B A;  4KC3 A;  1I1B A;  4QO3 A;  2VXR A;  3HSM A;  4LO7 C;  1HIB A;  1M2T B;  3JUT A;  1S0L A;  1PUU B;  1YBI A;  1YF8 B;  1OQL B;  3R4S A;  3MAL A;  3FJC A;  3IM7 A;  4MZH A;  2KLL A;  3CA0 A;  1MC9 A;  3I29 B;  3TC2 A;  5BXT A;  4EFR A;  1DJS B;  3AH1 A;  3O3Q A;  3RTI B;  1JT5 A;  3F62 B;  5BP5 C;  3OJM A;  1RML A;  5BXS A;  1DZC A;  5D62 A;  2K43 A;  1BAS A;  3HN1 A;  2HWM A;  5F8Y A;  3IM5 A;  1FN0 A;  1NUN A;  2P23 A;  3PG0 A;  4GP0 A;  4LO2 A;  1D0H A;  1VCL A;  3V0A B;  5FNX A;  4X37 A;  5FZU A;  3T8S A;  3FUQ A;  3WMV A;  2NS2 A;  1EPW A;  2D23 A;  1FQ9 A;  1JT7 A;  2NYY A;  4G9M A;  4WBC A;  2MLL B;  4IYB A;  2IWT B;  1YXW A;  3CRI A;  2F2F C;  5GAQ A;  3K1X A;  3BX1 C;  4QBC A;  1SR4 C;  3E8L C;  3N0K A;  1BFF A;  3Q7X A;  2QYI B;  3OBT A;  3P6I A;  5D63 A;  2ZQO A;  4ZFY B;  1JT4 A;  3FJD A;  1G9C A;  5BQU A;  3AKF A;  3BA4 A;  5DSS B;  3IAG C;  4OEE A;  2Y9F A;  5F90 A;  1HWP B;  4I7I A;  1PUM B;  4XFU A;  1JLY A;  1JLX A;  4LO8 B;  4L4I A;  4ISQ A;  1W3A A;  3NBN A;  3BTA A;  1Z2V A;  3V0B A;  2DRZ A;  2Y9G A;  4HJJ A;  4ZLB B;  2WRY A;  3LTQ A;  3BA5 A;  3PHZ A;  3POK A;  4I1E A;  2FFU A;  1WD3 A;  4ZGR B;  4XFS A;  5E24 E;  2GO2 A;  3BRG C;  1EVT A;  2MC2 A;  3N7K A;  1G9A A;  1YYN A;  1XYF A;  3NJ5 A;  1PZZ A;  1XZZ A;  3RMY A;  4I4R A;  2WBC A;  4G6J A;  1P63 A;  4CJM A;  2MIB A;  2E4M A;  1JQZ A;  1JY0 A;  5DZU A;  21BI A;  3VT0 A;  3BAU A;  1FV3 A;  1FMZ A;  5FZY A;  4P0J A;  4UY4 A;  1BAR A;  1T9F A;  4OWL A;  1SZ6 B;  4KEJ A;  4FGF A;  5BVP I;  4P6A A;  1HWM B;  4QBV A;  4GAF A;  3VEQ A;  4LO0 A;  2AFG A;  3VSZ A;  4A7Y A;  41BI A;  1F31 A;  4J2K A;  1M16 A;  1Q04 A;  3PME A;  2D20 A;  3VUO A;  3AH2 A;  1ISW A;  1DQO A;  3VT1 A;  2YUG A;  3B9U A;  2X2S A;  4DEN A;  2Z49 A;  3O5W B;  3BAQ A;  2AQZ A;  4I1B A;  3BAG A;  4IY9 A;  1YTO A;  4USO A;  3FJH A;  2IHO A;  2FO1 A;  2K8R A;  2D44 A;  3QYD A;  3AKH A;  5EG6 C;  3BRF A;  3UJ0 A;  2HW9 A;  3P6J A;  1IOB A;  4JPZ A;  4KEI A;  4X3A A;  1ONK B;  3A21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...