3CQAA

Crystal structure of human fibroblast growth factor-1 with mutations glu81ala and lys101ala
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
140
structure length
140
Chain Sequence
HHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNAECLFLERLEENHYNTYISKAHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Engineering an improved crystal contact across a solvent-mediated interface of human fibroblast growth factor 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 35
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3cqaA00
4GAFA 3AKFA 2QN4A 3WA1A 3F62B 1YBIA 3UJ0A 4I4SA 4Q9GA 4QBVA 1IHKA 2Q3NB 31BIA 2YUGA 3AKIA 1DZCA 4QALA 4OUJA 3WO2A 3CA3A 4F83A 4ZFYB 5DUYA 3MALA 3BRDA 3POKA 3OJ2A 4USPA 3CRIA 1RY7A 1FWUA 3O4OA 1SZ6B 4LO2A 1OQLB 3O5WB 1BARA 2MLLB 3FJJA 3AJ6A 3UD8A 3RMXA 3A23A 1ILR1 2HW9A 1PC8B 1S0GA 3HBWA 4JKXB 1FWVA 1BA7A 3BB2A 3RMYA 5D63A 3JUTA 1JT5A 4QD2C 2D22A 1K5VA 1CVSA 1WD4A 2Q9XA 1JY0A 4QC4A 3BAOA 2D24A 3FJEA 41BIA 4I4OA 4JRAA 1DFCA 9ILBA 1ITBA 4XKIA 1JT7A 5BQUA 3Q7WA 2Z48A 2RSTA 2HWMA 1TFMB 3N7LA 3IM7A 1AF9A 2NTDA 4H9WA 4G9NA 4I4UA 2DRYA 4J2YA 4GOYA 1BFBA 3UJ4A 1FMMS 3VSFA 3VWCA 3BRGC 2HZ9A 3O4BA 4I0YA 4IYBA 1DQOA 2D43A 3OBTA 5FZYA 3A07A 3BAGA 3AKHA 2VXRA 1AXMA 5E24E 4GP0A 5F8YA 3AJ5A 2AQZA 2FDBM 2KI4A 3ILAA 3RTIB 1HKNA 4I4XA 4ZA3B 3WINC 3ZC9A 3FJKA 1Q04A 2ERMA 4I1EA 2VSAA 5EC5A 4FGFA 4IHZA 2VU9A 1G9BA 4XFTA 3OBRA 1XG6A 3H6SE 1PWAA 1BLAA 2RG9B 1AVWB 1S0CA 1N4KA 3BA7A 4QBCA 3CQAA 4P6AA 2P39A 1AFCA 4EFQA 1BFFA 5JMCA 3F1RA 5FNXA 4J2XA 5BXRA 1MD6A 4DCKC 4CJMA 4FVVA 3PHZA 3N7MA 1R8OA 3O4DA 4P0JA 1EVTA 3ZX7A 4X37A 4ENDA 2E4MC 1VCLA 2NYYA 3MPPG 1JT4A 2LIQA 8I1BA 3V79C 1ISWA 5F8WA 3BAVA 4LO1C 1Q1UA 3VT2A 1BFCA 1YXWA 2F2FC 1HWPB 3HOMA 5FNWA 1ABRB 2ET2A 3O4AA 1HIBA 4G9MA 2AAIB 1V6WA 3O3QA 3OGGA 3BADA 3BAQA 4P0KA 4JKQA 1T9FA 3PUBA 1BLDA 4OW4A 2D23A 1UPSA 2WRYA 3AKGA 1DZDA 1PUMB 3RTJB 4OEFA 1JLYA 1HCDA 5JLVA 1IRPA 4JAWA 1TOOA 3LLPA 1ONKB 1PZZA 3CA0A 5B2HA 1M2TB 3FJCA 4G1RA 2D7IA 2KH2A 3D7WB 3N0KA 4OEEA 1HCEA 1RMLA 1XHBA 1WD3A 4A7KA 2ZQNA 4JP0A 4LO3A 3CRHA 2VLCA 4IQPA 3VUOA 2Z49A 4JPZA 5GAQA 1HWMB 2DS0A 1EV2A 3CU1B 2NP0A 3V0AB 4J2KA 4X38A 4ZKTB 5BXTA 3FUQA 3NBNA 3C9ZA 1TWMA 1NZKA 1IRAX 2KI6B 1FMZA 3Q7YA 4R6UB 1A8DA 4ZFWB 4D0TA 3CRGA 1QXMA 1QQLA 4L4IA 2KLLA 4KC3A 7I1BA 1P63A 1S0EA 1G9DA 1KNMA 5BVPI 1AVUA 3AZVA 3AH2A 3BA4A 3UDAA 4I4PA 3UD9A 5BP5A 4QKRA 4EB2B 1TP0A 3E8LC 4A7ZA 4LO2C 4LO7B 3IM5A 2NVHA 3FJAA 5F8SA 1EYLA 2Y9WC 4AN7B 3ZXDA 1IT0A 3A22A 3V0BB 1QQKA 4IY9A 4EKXB 2RQ9A 1ISZA 4HR6C 1NUNA 1R8NA 3AZWA 3EF2A 4IONA 2D1ZA 4DENA 1W3GA 4QO3A 2L5XA 1RZOB 1M16A 1IJTA 2DRZA 3AH4A 3BA5A 4ZOTA 2MC2A 2AFGA 1SR4A 3I2XA 2XOAA 4GAIA 3FFZA 3PG0A 3O4CA 4XFSA 5BQUC 3UD7A 3OJMA 3JRRA 2X2SA 2NM1A 3P6JA 2K43A 1BASA 1DFQA 4ZFUB 3T8SA 3KMVA 3P53A 1W3AA 1Z2VA 2GO2A 1IOBA 1WBAA 3WMUA 3QR5A 3FJFA 2NZ9A 4IY8A 2ZR1B 3I29B 2BEBA 1S0FA 1DJSB 5I1BA 4II0A 5BP5C 4KEJA 5D61A 5FZUA 4LO0A 3ZXGA 2J3PA 2K4AB 4IZXA 3HN1A 2FGFA 1JQZA 4A7YA 1W3FA 2VSEA 3WMVA 3AH1A 3FJBA 4QD2B 3CAHA 3QYDA 5F90A 4I4QA 4GP3A 3PMEA 4WBCA 3VSZA 1V6UA 1S0DA 1JT3A 3NBCA 4GOVA 1IILA 4TLPA 3VT1A 4I1BA 3H6RB 5DSSB 3H6RA 2ZQOA 4EEEB 1SR4C 3CA6A 4ZBVB 5DZUA 2X2TA 4KEKA 5FZZA 2F8XC 1FV3A 1GGPB 1BFGA 1I1BA 3O49A 4I2SA 4KEIA 5EG6C 3VT0A 1II4A 3FJIA 1Z0HA 3BTAA 2FFUA 2FFVA 3K1XA 3IIRA 4OWLA 1F31A 4X39A 4HA2A 3SNVA 3LTQA 2FO1A 1ISYA 3Q7XA 4D8HA 1CE7B 4AN6A 2MIBA 1AVXB 2HWAA 2KKIA 4LO8B 4I4RA 1EPWA 3A21A 3HMYA 2GZBA 4JQ0A 3H6QA 4IZEA 3HSMA 3R4SA 4I3NA 4YOLA 4Z8SB 1FQ9A 5DVHA 3V0AA 4LO0C 1DQGA 4OWKA 3BAUA 4EFPA 3WINA 3OGFA 3NBDA 2IWTB 1JLXA 21BIA 1V6VA 5D62A 4ZGRB 1I1EA 4ZLBB 4I4VA 4OWJA 1HWNB 3FJ8A 4J23B 2K8RA 3R4UA 2QYIB 5G00A 3IAGC 5BOWA 1AVAC 4I37A 3CA1A 3FUOA 4Q9PA 1L2HA 4EFRA 3IM6A 3WO3A 1G9CA 4HJJA 1G9AA 4X3AA 3WO4A 4I4YA 1HWOB 1G82A 4ISQA 2E4MA 5BXSA 3V0BA 4LO3C 2D7RA 1K5UA 3FJDA 4I8MA 1S0LA 2R9KB 1YF8B 3CA4A 3W9TA 3OJVA 4Q91A 1DIWA 1MC9A 4LO1A 5EHAA 2Y9GA 2P23A 2F2FA 1V6XA 1D0HA 4D0ZA 4L4HA 1XZZA 1J0SA 6I1BA 1FN0A 1DLLA 2UUSA 3O44A 2Y9XE 3FJ9A 1ISVA 2Y9FA 2D20A 1TIEA 2DREA 4PC4A 3ZC8A 3I2AA 5HPZA 2BFHA 2VXTI 4F34A 2M49A 3B9UA 3N7KA 2IHOA 1RG8A 4I6IA 1FV2A 3P6IA 4KBBA 3BRFA 3N7JA 4OEGA 4H04A 1XYFA 1T4QA 1YTOA 3HALA 1PUUB 3VEQA 3S8KA 2LIEA 1TWEA 2ESUA 1E0OA 3BX1C 1S0BA 4I7IA 4LO7C 1JTCA 4P0LA 2VUAA 4G6JA 3NJ5A 1WBCA 1Z4SA 1YYNA 3FGMA 4XFUA 2BEAA 4QKSA 5BXPA 4G6MA 1TTUA 3S8JA 4DEPA 1ISXA 2AXMA 4USOA 2WBCA 3CA5A 2I1BA 4ISRA 3NBEA 4J2SA 2D44A 1Q03A 3BAHA 3RSJA 4I96A 3TC2A 3FJHA 1FGAA 4Z9WB
chains in the Genus database with same CATH superfamily
4GAFA 3AKFA 2QN4A 3WA1A 3F62B 1YBIA 3UJ0A 4I4SA 4Q9GA 4QBVA 1IHKA 2Q3NB 31BIA 2YUGA 3AKIA 1DZCA 4QALA 4OUJA 3WO2A 3CA3A 4F83A 4ZFYB 5DUYA 3MALA 3BRDA 3POKA 3OJ2A 4USPA 3CRIA 1RY7A 1FWUA 3O4OA 1SZ6B 4LO2A 1OQLB 3O5WB 1BARA 2MLLB 3FJJA 3AJ6A 3UD8A 3RMXA 3A23A 1ILR1 2HW9A 1PC8B 1S0GA 3HBWA 4JKXB 1FWVA 1BA7A 3BB2A 3RMYA 5D63A 3JUTA 1JT5A 4QD2C 2D22A 1K5VA 1CVSA 1WD4A 2Q9XA 1JY0A 4QC4A 3BAOA 2D24A 3FJEA 41BIA 4I4OA 4JRAA 1DFCA 9ILBA 1ITBA 4XKIA 1JT7A 5BQUA 3Q7WA 2Z48A 2RSTA 2HWMA 1TFMB 3N7LA 3IM7A 1AF9A 2NTDA 4H9WA 4G9NA 4I4UA 2DRYA 4J2YA 4GOYA 1BFBA 3UJ4A 1FMMS 3VSFA 3VWCA 3BRGC 2HZ9A 3O4BA 4H75A 4I0YA 4IYBA 1DQOA 2D43A 3OBTA 5FZYA 3A07A 3BAGA 3AKHA 2VXRA 1AXMA 5E24E 4GP0A 5F8YA 3AJ5A 2AQZA 2FDBM 2KI4A 3ILAA 3RTIB 1HKNA 4I4XA 4ZA3B 3WINC 3ZC9A 3FJKA 1Q04A 2ERMA 4I1EA 2VSAA 5EC5A 4FGFA 4IHZA 2VU9A 1G9BA 4XFTA 3OBRA 1XG6A 4UY4A 3H6SE 1PWAA 1BLAA 2RG9B 1AVWB 1S0CA 1N4KA 2NS2A 3BA7A 3CQAA 4QBCA 4P6AA 2P39A 1AFCA 4EFQA 1BFFA 5JMCA 3F1RA 5FNXA 4J2XA 5BXRA 1MD6A 4DCKC 4CJMA 4FVVA 3PHZA 3N7MA 1R8OA 3O4DA 4P0JA 1EVTA 3ZX7A 4X37A 4MZGB 4ENDA 2E4MC 1VCLA 2NYYA 3MPPG 1JT4A 2LIQA 8I1BA 3V79C 1ISWA 5F8WA 3BAVA 4LO1C 1Q1UA 3VT2A 1BFCA 1YXWA 2F2FC 1HWPB 3HOMA 5FNWA 1ABRB 2ET2A 3O4AA 1HIBA 4G9MA 2AAIB 1V6WA 3O3QA 3OGGA 3BADA 3BAQA 4P0KA 4JKQA 1T9FA 3PUBA 1BLDA 4OW4A 2D23A 1UPSA 2WRYA 3AKGA 1DZDA 1PUMB 3RTJB 4OEFA 1JLYA 1HCDA 5JLVA 1IRPA 4JAWA 1TOOA 3LLPA 1ONKB 1PZZA 3CA0A 5B2HA 1M2TB 3FJCA 4G1RA 2D7IA 2KH2A 3D7WB 3N0KA 4OEEA 1HCEA 1RMLA 1XHBA 1WD3A 4A7KA 2ZQNA 4JP0A 4LO3A 3CRHA 2VLCA 4IQPA 3VUOA 2Z49A 4JPZA 5GAQA 1HWMB 2DS0A 1EV2A 3CU1B 2NP0A 3V0AB 4J2KA 4X38A 4ZKTB 5BXTA 3FUQA 3NBNA 3C9ZA 1TWMA 1NZKA 1IRAX 2KI6B 1FMZA 3Q7YA 4R6UB 1A8DA 4ZFWB 4D0TA 3CRGA 1QXMA 1QQLA 4L4IA 2KLLA 4KC3A 7I1BA 1P63A 1S0EA 1G9DA 1KNMA 5BVPI 1AVUA 3AZVA 3AH2A 3BA4A 3UDAA 4I4PA 3UD9A 5BP5A 4QKRA 4EB2B 1TP0A 3E8LC 4A7ZA 4LO2C 4LO7B 3IM5A 2NVHA 3FJAA 5F8SA 1EYLA 2Y9WC 4AN7B 3ZXDA 1IT0A 3A22A 3V0BB 1QQKA 4IY9A 4EKXB 2RQ9A 1ISZA 4HR6C 1NUNA 1R8NA 3AZWA 3EF2A 4IONA 2D1ZA 4DENA 1W3GA 4QO3A 2L5XA 1RZOB 1M16A 1IJTA 2DRZA 3AH4A 3BA5A 4ZOTA 2MC2A 2AFGA 1SR4A 3I2XA 2XOAA 4GAIA 3FFZA 3PG0A 3O4CA 4XFSA 5BQUC 3UD7A 3OJMA 3JRRA 4MZFB 2X2SA 2NM1A 3P6JA 2K43A 1BASA 1DFQA 4ZFUB 3T8SA 3KMVA 3P53A 1W3AA 1Z2VA 2GO2A 1IOBA 1WBAA 3WMUA 3QR5A 3FJFA 2NZ9A 4IY8A 2ZR1B 3I29B 2BEBA 1S0FA 1DJSB 5I1BA 4II0A 5BP5C 4KEJA 5D61A 5FZUA 4LO0A 3ZXGA 2J3PA 2K4AB 4IZXA 3HN1A 2FGFA 1JQZA 4A7YA 1W3FA 2VSEA 3WMVA 3AH1A 3FJBA 4QD2B 3CAHA 3QYDA 5F90A 4I4QA 4GP3A 3PMEA 4WBCA 3VSZA 1V6UA 1S0DA 1JT3A 3NBCA 4GOVA 1IILA 4TLPA 3VT1A 4I1BA 3H6RB 5DSSB 3H6RA 2ZQOA 4EEEB 1SR4C 3CA6A 4ZBVB 5DZUA 2X2TA 4KEKA 4MZHA 5FZZA 1FV3A 1GGPB 1BFGA 1I1BA 3O49A 4I2SA 4KEIA 5EG6C 3VT0A 1II4A 3FJIA 1Z0HA 3BTAA 2FFUA 2FFVA 3K1XA 3IIRA 4OWLA 1F31A 4X39A 4HA2A 3SNVA 3LTQA 2FO1A 1ISYA 3Q7XA 4D8HA 1CE7B 4AN6A 2MIBA 1AVXB 2HWAA 2KKIA 4LO8B 4I4RA 1EPWA 3A21A 3HMYA 2GZBA 4JQ0A 3H6QA 4IZEA 3HSMA 2F8XC 3R4SA 4I3NA 4YOLA 4Z8SB 1FQ9A 5DVHA 3V0AA 4LO0C 1DQGA 4OWKA 3BAUA 4EFPA 3WINA 3OGFA 3NBDA 2IWTB 1JLXA 21BIA 1V6VA 5D62A 4ZGRB 1I1EA 4ZLBB 4I4VA 4OWJA 1HWNB 3FJ8A 4J23B 2K8RA 3R4UA 2QYIB 5G00A 3IAGC 5BOWA 1AVAC 4I37A 3CA1A 3FUOA 4Q9PA 1L2HA 4EFRA 3IM6A 3WO3A 1G9CA 4HJJA 1G9AA 4X3AA 3WO4A 4I4YA 1HWOB 1G82A 4ISQA 2E4MA 5BXSA 3V0BA 4LO3C 2D7RA 1K5UA 3FJDA 4I8MA 1S0LA 2R9KB 1YF8B 3CA4A 3W9TA 3OJVA 4Q91A 1DIWA 1MC9A 4LO1A 5EHAA 2Y9GA 2P23A 2F2FA 1V6XA 1D0HA 4D0ZA 4L4HA 1XZZA 1J0SA 6I1BA 1FN0A 1DLLA 2UUSA 3O44A 2Y9XE 3FJ9A 1ISVA 2Y9FA 2D20A 1TIEA 2DREA 4PC4A 3ZC8A 3I2AA 5HPZA 2BFHA 2VXTI 4F34A 2M49A 3B9UA 3N7KA 2IHOA 1RG8A 4I6IA 1FV2A 3P6IA 4KBBA 3BRFA 3N7JA 4OEGA 4H04A 1XYFA 1T4QA 1YTOA 3HALA 1PUUB 3VEQA 3S8KA 2LIEA 1TWEA 2ESUA 1E0OA 3BX1C 1S0BA 4I7IA 4LO7C 1JTCA 4P0LA 2VUAA 4G6JA 3NJ5A 1WBCA 1Z4SA 1YYNA 3FGMA 4XFUA 2BEAA 4QKSA 5BXPA 4G6MA 1TTUA 3S8JA 4DEPA 1ISXA 2AXMA 4USOA 2WBCA 3CA5A 2I1BA 4ISRA 3NBEA 4J2SA 2D44A 1Q03A 3BAHA 3RSJA 4I96A 3TC2A 3FJHA 1FGAA 4Z9WB
chains in the Genus database with same CATH topology
4GAFA 3AKFA 2QN4A 3WA1A 3F62B 1YBIA 3UJ0A 4I4SA 4Q9GA 4QBVA 1IHKA 2Q3NB 31BIA 2YUGA 3AKIA 1DZCA 4QALA 4OUJA 3WO2A 3CA3A 4F83A 4ZFYB 5DUYA 3MALA 3BRDA 3POKA 3OJ2A 4USPA 3CRIA 1RY7A 1FWUA 3O4OA 1SZ6B 4LO2A 1OQLB 3O5WB 1BARA 2MLLB 3FJJA 3AJ6A 3UD8A 3RMXA 3A23A 1ILR1 2HW9A 1PC8B 1S0GA 3HBWA 4JKXB 1FWVA 1BA7A 3BB2A 3RMYA 5D63A 3JUTA 1JT5A 4QD2C 2D22A 1K5VA 1CVSA 1WD4A 2Q9XA 1JY0A 4QC4A 3BAOA 2D24A 3FJEA 41BIA 4I4OA 4JRAA 1DFCA 9ILBA 1ITBA 4XKIA 1JT7A 5BQUA 3Q7WA 2Z48A 2RSTA 2HWMA 1TFMB 3N7LA 3IM7A 1AF9A 2NTDA 4H9WA 4G9NA 4I4UA 2DRYA 4J2YA 4GOYA 1BFBA 3UJ4A 1FMMS 3VSFA 3VWCA 3BRGC 2HZ9A 3O4BA 4H75A 4I0YA 4IYBA 1DQOA 2D43A 3OBTA 5FZYA 3A07A 3BAGA 3AKHA 2VXRA 1AXMA 5E24E 4GP0A 5F8YA 3AJ5A 2AQZA 2FDBM 2KI4A 3ILAA 3RTIB 1HKNA 4I4XA 4ZA3B 3WINC 3ZC9A 3FJKA 1Q04A 2ERMA 4I1EA 2VSAA 5EC5A 4FGFA 4IHZA 2VU9A 1G9BA 4XFTA 3OBRA 1XG6A 4UY4A 3H6SE 1PWAA 1BLAA 2RG9B 1AVWB 1S0CA 1N4KA 2NS2A 3BA7A 3CQAA 4QBCA 4P6AA 2P39A 1AFCA 4EFQA 1BFFA 5JMCA 3F1RA 5FNXA 4J2XA 5BXRA 1MD6A 4DCKC 4CJMA 4FVVA 3PHZA 3N7MA 1R8OA 3O4DA 4P0JA 1EVTA 3ZX7A 4X37A 4MZGB 4ENDA 2E4MC 1VCLA 2NYYA 3MPPG 1JT4A 2LIQA 8I1BA 3V79C 1ISWA 5F8WA 3BAVA 4LO1C 1Q1UA 3VT2A 1BFCA 1YXWA 2F2FC 1HWPB 3HOMA 5FNWA 1ABRB 2ET2A 3O4AA 1HIBA 4G9MA 2AAIB 1V6WA 3O3QA 3OGGA 3BADA 3BAQA 4P0KA 4JKQA 1T9FA 3PUBA 1BLDA 4OW4A 2D23A 1UPSA 2WRYA 3AKGA 1DZDA 1PUMB 3RTJB 4OEFA 1JLYA 1HCDA 5JLVA 1IRPA 4JAWA 1TOOA 3LLPA 1ONKB 1PZZA 3CA0A 5B2HA 1M2TB 3FJCA 4G1RA 2D7IA 2KH2A 3D7WB 3N0KA 4OEEA 1HCEA 1RMLA 1XHBA 1WD3A 4A7KA 2ZQNA 4JP0A 4LO3A 3CRHA 2VLCA 4IQPA 3VUOA 2Z49A 4JPZA 5GAQA 1HWMB 2DS0A 1EV2A 3CU1B 2NP0A 3V0AB 4J2KA 4X38A 4ZKTB 5BXTA 3FUQA 3NBNA 3C9ZA 1TWMA 1NZKA 1IRAX 2KI6B 1FMZA 3Q7YA 4R6UB 1A8DA 4ZFWB 4D0TA 3CRGA 1QXMA 1QQLA 4L4IA 2KLLA 4KC3A 7I1BA 1P63A 1S0EA 1G9DA 1KNMA 5BVPI 1AVUA 3AZVA 3AH2A 3BA4A 3UDAA 4I4PA 3UD9A 5BP5A 4QKRA 4EB2B 1TP0A 3E8LC 4A7ZA 4LO2C 4LO7B 3IM5A 2NVHA 3FJAA 5F8SA 1EYLA 2Y9WC 4AN7B 3ZXDA 1IT0A 3A22A 3V0BB 1QQKA 4IY9A 4EKXB 2RQ9A 1ISZA 4HR6C 1NUNA 1R8NA 3AZWA 3EF2A 4IONA 2D1ZA 4DENA 1W3GA 4QO3A 2L5XA 1RZOB 1M16A 1IJTA 2DRZA 3AH4A 3BA5A 4ZOTA 2MC2A 2AFGA 1SR4A 3I2XA 2XOAA 4GAIA 3FFZA 3PG0A 3O4CA 4XFSA 5BQUC 3UD7A 3OJMA 3JRRA 4MZFB 2X2SA 2NM1A 3P6JA 2K43A 1BASA 1DFQA 4ZFUB 3T8SA 3KMVA 3P53A 1W3AA 1Z2VA 2GO2A 1IOBA 1WBAA 3WMUA 3QR5A 3FJFA 2NZ9A 4IY8A 2ZR1B 3I29B 2BEBA 1S0FA 1DJSB 5I1BA 4II0A 5BP5C 4KEJA 5D61A 5FZUA 4LO0A 3ZXGA 2J3PA 2K4AB 4IZXA 3HN1A 2FGFA 1JQZA 4A7YA 1W3FA 2VSEA 3WMVA 3AH1A 3FJBA 4QD2B 3CAHA 3QYDA 5F90A 4I4QA 4GP3A 3PMEA 4WBCA 3VSZA 1V6UA 1S0DA 1JT3A 3NBCA 4GOVA 1IILA 4TLPA 3VT1A 4I1BA 3H6RB 5DSSB 3H6RA 2ZQOA 4EEEB 1SR4C 3CA6A 4ZBVB 5DZUA 2X2TA 4KEKA 4MZHA 5FZZA 1FV3A 1GGPB 1BFGA 1I1BA 3O49A 4I2SA 4KEIA 5EG6C 3VT0A 1II4A 3FJIA 1Z0HA 3BTAA 2FFUA 2FFVA 3K1XA 3IIRA 4OWLA 1F31A 4X39A 4HA2A 3SNVA 3LTQA 2FO1A 1ISYA 3Q7XA 4D8HA 1CE7B 4AN6A 2MIBA 1AVXB 2HWAA 2KKIA 4LO8B 4I4RA 1EPWA 3A21A 3HMYA 2GZBA 4JQ0A 3H6QA 4IZEA 3HSMA 2F8XC 3R4SA 4I3NA 4YOLA 4Z8SB 1FQ9A 5DVHA 3V0AA 4LO0C 1DQGA 4OWKA 3BAUA 4EFPA 3WINA 3OGFA 3NBDA 2IWTB 1JLXA 21BIA 1V6VA 5D62A 4ZGRB 1I1EA 4ZLBB 4I4VA 4OWJA 1HWNB 3FJ8A 4J23B 2K8RA 3R4UA 2QYIB 5G00A 3IAGC 5BOWA 1AVAC 4I37A 3CA1A 3FUOA 4Q9PA 1L2HA 4EFRA 3IM6A 3WO3A 1G9CA 4HJJA 1G9AA 4X3AA 3WO4A 4I4YA 1HWOB 1G82A 4ISQA 2E4MA 5BXSA 3V0BA 4LO3C 2D7RA 1K5UA 3FJDA 4I8MA 1S0LA 2R9KB 1YF8B 3CA4A 3W9TA 3OJVA 4Q91A 1DIWA 1MC9A 4LO1A 5EHAA 2Y9GA 2P23A 2F2FA 1V6XA 1D0HA 4D0ZA 4L4HA 1XZZA 1J0SA 6I1BA 1FN0A 1DLLA 2UUSA 3O44A 2Y9XE 3FJ9A 1ISVA 2Y9FA 2D20A 1TIEA 2DREA 4PC4A 3ZC8A 3I2AA 5HPZA 2BFHA 2VXTI 4F34A 2M49A 3B9UA 3N7KA 2IHOA 1RG8A 4I6IA 1FV2A 3P6IA 4KBBA 3BRFA 3N7JA 4OEGA 4H04A 1XYFA 1T4QA 1YTOA 3HALA 1PUUB 3VEQA 3S8KA 2LIEA 1TWEA 2ESUA 1E0OA 3BX1C 1S0BA 4I7IA 4LO7C 1JTCA 4P0LA 2VUAA 4G6JA 3NJ5A 1WBCA 1Z4SA 1YYNA 3FGMA 4XFUA 2BEAA 4QKSA 5BXPA 4G6MA 1TTUA 3S8JA 4DEPA 1ISXA 2AXMA 4USOA 2WBCA 3CA5A 2I1BA 4ISRA 3NBEA 4J2SA 2D44A 1Q03A 3BAHA 3RSJA 4I96A 3TC2A 3FJHA 1FGAA 4Z9WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GAF A;  3AKF A;  2QN4 A;  3WA1 A;  3F62 B;  1YBI A;  3UJ0 A;  4I4S A;  4Q9G A;  4QBV A;  1IHK A;  2Q3N B;  31BI A;  2YUG A;  3AKI A;  1DZC A;  4QAL A;  4OUJ A;  3WO2 A;  3CA3 A;  4F83 A;  4ZFY B;  5DUY A;  3MAL A;  3BRD A;  3POK A;  3OJ2 A;  4USP A;  3CRI A;  1RY7 A;  1FWU A;  3O4O A;  1SZ6 B;  4LO2 A;  1OQL B;  3O5W B;  1BAR A;  2MLL B;  3FJJ A;  3AJ6 A;  3UD8 A;  3RMX A;  3A23 A;  1ILR 1;  2HW9 A;  1PC8 B;  1S0G A;  3HBW A;  4JKX B;  1FWV A;  1BA7 A;  3BB2 A;  3RMY A;  5D63 A;  3JUT A;  1JT5 A;  4QD2 C;  2D22 A;  1K5V A;  1CVS A;  1WD4 A;  2Q9X A;  1JY0 A;  4QC4 A;  3BAO A;  2D24 A;  3FJE A;  41BI A;  4I4O A;  4JRA A;  1DFC A;  9ILB A;  1ITB A;  4XKI A;  1JT7 A;  5BQU A;  3Q7W A;  2Z48 A;  2RST A;  2HWM A;  1TFM B;  3N7L A;  3IM7 A;  1AF9 A;  2NTD A;  4H9W A;  4G9N A;  4I4U A;  2DRY A;  4J2Y A;  4GOY A;  1BFB A;  3UJ4 A;  1FMM S;  3VSF A;  3VWC A;  3BRG C;  2HZ9 A;  3O4B A;  4I0Y A;  4IYB A;  1DQO A;  2D43 A;  3OBT A;  5FZY A;  3A07 A;  3BAG A;  3AKH A;  2VXR A;  1AXM A;  5E24 E;  4GP0 A;  5F8Y A;  3AJ5 A;  2AQZ A;  2FDB M;  2KI4 A;  3ILA A;  3RTI B;  1HKN A;  4I4X A;  4ZA3 B;  3WIN C;  3ZC9 A;  3FJK A;  1Q04 A;  2ERM A;  4I1E A;  2VSA A;  5EC5 A;  4FGF A;  4IHZ A;  2VU9 A;  1G9B A;  4XFT A;  3OBR A;  1XG6 A;  3H6S E;  1PWA A;  1BLA A;  2RG9 B;  1AVW B;  1S0C A;  1N4K A;  3BA7 A;  4QBC A;  3CQA A;  4P6A A;  2P39 A;  1AFC A;  4EFQ A;  1BFF A;  5JMC A;  3F1R A;  5FNX A;  4J2X A;  5BXR A;  1MD6 A;  4DCK C;  4CJM A;  4FVV A;  3PHZ A;  3N7M A;  1R8O A;  3O4D A;  4P0J A;  1EVT A;  3ZX7 A;  4X37 A;  4END A;  2E4M C;  1VCL A;  2NYY A;  3MPP G;  1JT4 A;  2LIQ A;  8I1B A;  3V79 C;  1ISW A;  5F8W A;  3BAV A;  4LO1 C;  1Q1U A;  3VT2 A;  1BFC A;  1YXW A;  2F2F C;  1HWP B;  3HOM A;  5FNW A;  1ABR B;  2ET2 A;  3O4A A;  1HIB A;  4G9M A;  2AAI B;  1V6W A;  3O3Q A;  3OGG A;  3BAD A;  3BAQ A;  4P0K A;  4JKQ A;  1T9F A;  3PUB A;  1BLD A;  4OW4 A;  2D23 A;  1UPS A;  2WRY A;  3AKG A;  1DZD A;  1PUM B;  3RTJ B;  4OEF A;  1JLY A;  1HCD A;  5JLV A;  1IRP A;  4JAW A;  1TOO A;  3LLP A;  1ONK B;  1PZZ A;  3CA0 A;  5B2H A;  1M2T B;  3FJC A;  4G1R A;  2D7I A;  2KH2 A;  3D7W B;  3N0K A;  4OEE A;  1HCE A;  1RML A;  1XHB A;  1WD3 A;  4A7K A;  2ZQN A;  4JP0 A;  4LO3 A;  3CRH A;  2VLC A;  4IQP A;  3VUO A;  2Z49 A;  4JPZ A;  5GAQ A;  1HWM B;  2DS0 A;  1EV2 A;  3CU1 B;  2NP0 A;  3V0A B;  4J2K A;  4X38 A;  4ZKT B;  5BXT A;  3FUQ A;  3NBN A;  3C9Z A;  1TWM A;  1NZK A;  1IRA X;  2KI6 B;  1FMZ A;  3Q7Y A;  4R6U B;  1A8D A;  4ZFW B;  4D0T A;  3CRG A;  1QXM A;  1QQL A;  4L4I A;  2KLL A;  4KC3 A;  7I1B A;  1P63 A;  1S0E A;  1G9D A;  1KNM A;  5BVP I;  1AVU A;  3AZV A;  3AH2 A;  3BA4 A;  3UDA A;  4I4P A;  3UD9 A;  5BP5 A;  4QKR A;  4EB2 B;  1TP0 A;  3E8L C;  4A7Z A;  4LO2 C;  4LO7 B;  3IM5 A;  2NVH A;  3FJA A;  5F8S A;  1EYL A;  2Y9W C;  4AN7 B;  3ZXD A;  1IT0 A;  3A22 A;  3V0B B;  1QQK A;  4IY9 A;  4EKX B;  2RQ9 A;  1ISZ A;  4HR6 C;  1NUN A;  1R8N A;  3AZW A;  3EF2 A;  4ION A;  2D1Z A;  4DEN A;  1W3G A;  4QO3 A;  2L5X A;  1RZO B;  1M16 A;  1IJT A;  2DRZ A;  3AH4 A;  3BA5 A;  4ZOT A;  2MC2 A;  2AFG A;  1SR4 A;  3I2X A;  2XOA A;  4GAI A;  3FFZ A;  3PG0 A;  3O4C A;  4XFS A;  5BQU C;  3UD7 A;  3OJM A;  3JRR A;  2X2S A;  2NM1 A;  3P6J A;  2K43 A;  1BAS A;  1DFQ A;  4ZFU B;  3T8S A;  3KMV A;  3P53 A;  1W3A A;  1Z2V A;  2GO2 A;  1IOB A;  1WBA A;  3WMU A;  3QR5 A;  3FJF A;  2NZ9 A;  4IY8 A;  2ZR1 B;  3I29 B;  2BEB A;  1S0F A;  1DJS B;  5I1B A;  4II0 A;  5BP5 C;  4KEJ A;  5D61 A;  5FZU A;  4LO0 A;  3ZXG A;  2J3P A;  2K4A B;  4IZX A;  3HN1 A;  2FGF A;  1JQZ A;  4A7Y A;  1W3F A;  2VSE A;  3WMV A;  3AH1 A;  3FJB A;  4QD2 B;  3CAH A;  3QYD A;  5F90 A;  4I4Q A;  4GP3 A;  3PME A;  4WBC A;  3VSZ A;  1V6U A;  1S0D A;  1JT3 A;  3NBC A;  4GOV A;  1IIL A;  4TLP A;  3VT1 A;  4I1B A;  3H6R B;  5DSS B;  3H6R A;  2ZQO A;  4EEE B;  1SR4 C;  3CA6 A;  4ZBV B;  5DZU A;  2X2T A;  4KEK A;  5FZZ A;  2F8X C;  1FV3 A;  1GGP B;  1BFG A;  1I1B A;  3O49 A;  4I2S A;  4KEI A;  5EG6 C;  3VT0 A;  1II4 A;  3FJI A;  1Z0H A;  3BTA A;  2FFU A;  2FFV A;  3K1X A;  3IIR A;  4OWL A;  1F31 A;  4X39 A;  4HA2 A;  3SNV A;  3LTQ A;  2FO1 A;  1ISY A;  3Q7X A;  4D8H A;  1CE7 B;  4AN6 A;  2MIB A;  1AVX B;  2HWA A;  2KKI A;  4LO8 B;  4I4R A;  1EPW A;  3A21 A;  3HMY A;  2GZB A;  4JQ0 A;  3H6Q A;  4IZE A;  3HSM A;  3R4S A;  4I3N A;  4YOL A;  4Z8S B;  1FQ9 A;  5DVH A;  3V0A A;  4LO0 C;  1DQG A;  4OWK A;  3BAU A;  4EFP A;  3WIN A;  3OGF A;  3NBD A;  2IWT B;  1JLX A;  21BI A;  1V6V A;  5D62 A;  4ZGR B;  1I1E A;  4ZLB B;  4I4V A;  4OWJ A;  1HWN B;  3FJ8 A;  4J23 B;  2K8R A;  3R4U A;  2QYI B;  5G00 A;  3IAG C;  5BOW A;  1AVA C;  4I37 A;  3CA1 A;  3FUO A;  4Q9P A;  1L2H A;  4EFR A;  3IM6 A;  3WO3 A;  1G9C A;  4HJJ A;  1G9A A;  4X3A A;  3WO4 A;  4I4Y A;  1HWO B;  1G82 A;  4ISQ A;  2E4M A;  5BXS A;  3V0B A;  4LO3 C;  2D7R A;  1K5U A;  3FJD A;  4I8M A;  1S0L A;  2R9K B;  1YF8 B;  3CA4 A;  3W9T A;  3OJV A;  4Q91 A;  1DIW A;  1MC9 A;  4LO1 A;  5EHA A;  2Y9G A;  2P23 A;  2F2F A;  1V6X A;  1D0H A;  4D0Z A;  4L4H A;  1XZZ A;  1J0S A;  6I1B A;  1FN0 A;  1DLL A;  2UUS A;  3O44 A;  2Y9X E;  3FJ9 A;  1ISV A;  2Y9F A;  2D20 A;  1TIE A;  2DRE A;  4PC4 A;  3ZC8 A;  3I2A A;  5HPZ A;  2BFH A;  2VXT I;  4F34 A;  2M49 A;  3B9U A;  3N7K A;  2IHO A;  1RG8 A;  4I6I A;  1FV2 A;  3P6I A;  4KBB A;  3BRF A;  3N7J A;  4OEG A;  4H04 A;  1XYF A;  1T4Q A;  1YTO A;  3HAL A;  1PUU B;  3VEQ A;  3S8K A;  2LIE A;  1TWE A;  2ESU A;  1E0O A;  3BX1 C;  1S0B A;  4I7I A;  4LO7 C;  1JTC A;  4P0L A;  2VUA A;  4G6J A;  3NJ5 A;  1WBC A;  1Z4S A;  1YYN A;  3FGM A;  4XFU A;  2BEA A;  4QKS A;  5BXP A;  4G6M A;  1TTU A;  3S8J A;  4DEP A;  1ISX A;  2AXM A;  4USO A;  2WBC A;  3CA5 A;  2I1B A;  4ISR A;  3NBE A;  4J2S A;  2D44 A;  1Q03 A;  3BAH A;  3RSJ A;  4I96 A;  3TC2 A;  3FJH A;  1FGA A;  4Z9W B; 
#chains in the Genus database with same CATH topology
 4GAF A;  3AKF A;  2QN4 A;  3WA1 A;  3F62 B;  1YBI A;  3UJ0 A;  4I4S A;  4Q9G A;  4QBV A;  1IHK A;  2Q3N B;  31BI A;  2YUG A;  3AKI A;  1DZC A;  4QAL A;  4OUJ A;  3WO2 A;  3CA3 A;  4F83 A;  4ZFY B;  5DUY A;  3MAL A;  3BRD A;  3POK A;  3OJ2 A;  4USP A;  3CRI A;  1RY7 A;  1FWU A;  3O4O A;  1SZ6 B;  4LO2 A;  1OQL B;  3O5W B;  1BAR A;  2MLL B;  3FJJ A;  3AJ6 A;  3UD8 A;  3RMX A;  3A23 A;  1ILR 1;  2HW9 A;  1PC8 B;  1S0G A;  3HBW A;  4JKX B;  1FWV A;  1BA7 A;  3BB2 A;  3RMY A;  5D63 A;  3JUT A;  1JT5 A;  4QD2 C;  2D22 A;  1K5V A;  1CVS A;  1WD4 A;  2Q9X A;  1JY0 A;  4QC4 A;  3BAO A;  2D24 A;  3FJE A;  41BI A;  4I4O A;  4JRA A;  1DFC A;  9ILB A;  1ITB A;  4XKI A;  1JT7 A;  5BQU A;  3Q7W A;  2Z48 A;  2RST A;  2HWM A;  1TFM B;  3N7L A;  3IM7 A;  1AF9 A;  2NTD A;  4H9W A;  4G9N A;  4I4U A;  2DRY A;  4J2Y A;  4GOY A;  1BFB A;  3UJ4 A;  1FMM S;  3VSF A;  3VWC A;  3BRG C;  2HZ9 A;  3O4B A;  4H75 A;  4I0Y A;  4IYB A;  1DQO A;  2D43 A;  3OBT A;  5FZY A;  3A07 A;  3BAG A;  3AKH A;  2VXR A;  1AXM A;  5E24 E;  4GP0 A;  5F8Y A;  3AJ5 A;  2AQZ A;  2FDB M;  2KI4 A;  3ILA A;  3RTI B;  1HKN A;  4I4X A;  4ZA3 B;  3WIN C;  3ZC9 A;  3FJK A;  1Q04 A;  2ERM A;  4I1E A;  2VSA A;  5EC5 A;  4FGF A;  4IHZ A;  2VU9 A;  1G9B A;  4XFT A;  3OBR A;  1XG6 A;  4UY4 A;  3H6S E;  1PWA A;  1BLA A;  2RG9 B;  1AVW B;  1S0C A;  1N4K A;  2NS2 A;  3BA7 A;  3CQA A;  4QBC A;  4P6A A;  2P39 A;  1AFC A;  4EFQ A;  1BFF A;  5JMC A;  3F1R A;  5FNX A;  4J2X A;  5BXR A;  1MD6 A;  4DCK C;  4CJM A;  4FVV A;  3PHZ A;  3N7M A;  1R8O A;  3O4D A;  4P0J A;  1EVT A;  3ZX7 A;  4X37 A;  4MZG B;  4END A;  2E4M C;  1VCL A;  2NYY A;  3MPP G;  1JT4 A;  2LIQ A;  8I1B A;  3V79 C;  1ISW A;  5F8W A;  3BAV A;  4LO1 C;  1Q1U A;  3VT2 A;  1BFC A;  1YXW A;  2F2F C;  1HWP B;  3HOM A;  5FNW A;  1ABR B;  2ET2 A;  3O4A A;  1HIB A;  4G9M A;  2AAI B;  1V6W A;  3O3Q A;  3OGG A;  3BAD A;  3BAQ A;  4P0K A;  4JKQ A;  1T9F A;  3PUB A;  1BLD A;  4OW4 A;  2D23 A;  1UPS A;  2WRY A;  3AKG A;  1DZD A;  1PUM B;  3RTJ B;  4OEF A;  1JLY A;  1HCD A;  5JLV A;  1IRP A;  4JAW A;  1TOO A;  3LLP A;  1ONK B;  1PZZ A;  3CA0 A;  5B2H A;  1M2T B;  3FJC A;  4G1R A;  2D7I A;  2KH2 A;  3D7W B;  3N0K A;  4OEE A;  1HCE A;  1RML A;  1XHB A;  1WD3 A;  4A7K A;  2ZQN A;  4JP0 A;  4LO3 A;  3CRH A;  2VLC A;  4IQP A;  3VUO A;  2Z49 A;  4JPZ A;  5GAQ A;  1HWM B;  2DS0 A;  1EV2 A;  3CU1 B;  2NP0 A;  3V0A B;  4J2K A;  4X38 A;  4ZKT B;  5BXT A;  3FUQ A;  3NBN A;  3C9Z A;  1TWM A;  1NZK A;  1IRA X;  2KI6 B;  1FMZ A;  3Q7Y A;  4R6U B;  1A8D A;  4ZFW B;  4D0T A;  3CRG A;  1QXM A;  1QQL A;  4L4I A;  2KLL A;  4KC3 A;  7I1B A;  1P63 A;  1S0E A;  1G9D A;  1KNM A;  5BVP I;  1AVU A;  3AZV A;  3AH2 A;  3BA4 A;  3UDA A;  4I4P A;  3UD9 A;  5BP5 A;  4QKR A;  4EB2 B;  1TP0 A;  3E8L C;  4A7Z A;  4LO2 C;  4LO7 B;  3IM5 A;  2NVH A;  3FJA A;  5F8S A;  1EYL A;  2Y9W C;  4AN7 B;  3ZXD A;  1IT0 A;  3A22 A;  3V0B B;  1QQK A;  4IY9 A;  4EKX B;  2RQ9 A;  1ISZ A;  4HR6 C;  1NUN A;  1R8N A;  3AZW A;  3EF2 A;  4ION A;  2D1Z A;  4DEN A;  1W3G A;  4QO3 A;  2L5X A;  1RZO B;  1M16 A;  1IJT A;  2DRZ A;  3AH4 A;  3BA5 A;  4ZOT A;  2MC2 A;  2AFG A;  1SR4 A;  3I2X A;  2XOA A;  4GAI A;  3FFZ A;  3PG0 A;  3O4C A;  4XFS A;  5BQU C;  3UD7 A;  3OJM A;  3JRR A;  4MZF B;  2X2S A;  2NM1 A;  3P6J A;  2K43 A;  1BAS A;  1DFQ A;  4ZFU B;  3T8S A;  3KMV A;  3P53 A;  1W3A A;  1Z2V A;  2GO2 A;  1IOB A;  1WBA A;  3WMU A;  3QR5 A;  3FJF A;  2NZ9 A;  4IY8 A;  2ZR1 B;  3I29 B;  2BEB A;  1S0F A;  1DJS B;  5I1B A;  4II0 A;  5BP5 C;  4KEJ A;  5D61 A;  5FZU A;  4LO0 A;  3ZXG A;  2J3P A;  2K4A B;  4IZX A;  3HN1 A;  2FGF A;  1JQZ A;  4A7Y A;  1W3F A;  2VSE A;  3WMV A;  3AH1 A;  3FJB A;  4QD2 B;  3CAH A;  3QYD A;  5F90 A;  4I4Q A;  4GP3 A;  3PME A;  4WBC A;  3VSZ A;  1V6U A;  1S0D A;  1JT3 A;  3NBC A;  4GOV A;  1IIL A;  4TLP A;  3VT1 A;  4I1B A;  3H6R B;  5DSS B;  3H6R A;  2ZQO A;  4EEE B;  1SR4 C;  3CA6 A;  4ZBV B;  5DZU A;  2X2T A;  4KEK A;  4MZH A;  5FZZ A;  1FV3 A;  1GGP B;  1BFG A;  1I1B A;  3O49 A;  4I2S A;  4KEI A;  5EG6 C;  3VT0 A;  1II4 A;  3FJI A;  1Z0H A;  3BTA A;  2FFU A;  2FFV A;  3K1X A;  3IIR A;  4OWL A;  1F31 A;  4X39 A;  4HA2 A;  3SNV A;  3LTQ A;  2FO1 A;  1ISY A;  3Q7X A;  4D8H A;  1CE7 B;  4AN6 A;  2MIB A;  1AVX B;  2HWA A;  2KKI A;  4LO8 B;  4I4R A;  1EPW A;  3A21 A;  3HMY A;  2GZB A;  4JQ0 A;  3H6Q A;  4IZE A;  3HSM A;  2F8X C;  3R4S A;  4I3N A;  4YOL A;  4Z8S B;  1FQ9 A;  5DVH A;  3V0A A;  4LO0 C;  1DQG A;  4OWK A;  3BAU A;  4EFP A;  3WIN A;  3OGF A;  3NBD A;  2IWT B;  1JLX A;  21BI A;  1V6V A;  5D62 A;  4ZGR B;  1I1E A;  4ZLB B;  4I4V A;  4OWJ A;  1HWN B;  3FJ8 A;  4J23 B;  2K8R A;  3R4U A;  2QYI B;  5G00 A;  3IAG C;  5BOW A;  1AVA C;  4I37 A;  3CA1 A;  3FUO A;  4Q9P A;  1L2H A;  4EFR A;  3IM6 A;  3WO3 A;  1G9C A;  4HJJ A;  1G9A A;  4X3A A;  3WO4 A;  4I4Y A;  1HWO B;  1G82 A;  4ISQ A;  2E4M A;  5BXS A;  3V0B A;  4LO3 C;  2D7R A;  1K5U A;  3FJD A;  4I8M A;  1S0L A;  2R9K B;  1YF8 B;  3CA4 A;  3W9T A;  3OJV A;  4Q91 A;  1DIW A;  1MC9 A;  4LO1 A;  5EHA A;  2Y9G A;  2P23 A;  2F2F A;  1V6X A;  1D0H A;  4D0Z A;  4L4H A;  1XZZ A;  1J0S A;  6I1B A;  1FN0 A;  1DLL A;  2UUS A;  3O44 A;  2Y9X E;  3FJ9 A;  1ISV A;  2Y9F A;  2D20 A;  1TIE A;  2DRE A;  4PC4 A;  3ZC8 A;  3I2A A;  5HPZ A;  2BFH A;  2VXT I;  4F34 A;  2M49 A;  3B9U A;  3N7K A;  2IHO A;  1RG8 A;  4I6I A;  1FV2 A;  3P6I A;  4KBB A;  3BRF A;  3N7J A;  4OEG A;  4H04 A;  1XYF A;  1T4Q A;  1YTO A;  3HAL A;  1PUU B;  3VEQ A;  3S8K A;  2LIE A;  1TWE A;  2ESU A;  1E0O A;  3BX1 C;  1S0B A;  4I7I A;  4LO7 C;  1JTC A;  4P0L A;  2VUA A;  4G6J A;  3NJ5 A;  1WBC A;  1Z4S A;  1YYN A;  3FGM A;  4XFU A;  2BEA A;  4QKS A;  5BXP A;  4G6M A;  1TTU A;  3S8J A;  4DEP A;  1ISX A;  2AXM A;  4USO A;  2WBC A;  3CA5 A;  2I1B A;  4ISR A;  3NBE A;  4J2S A;  2D44 A;  1Q03 A;  3BAH A;  3RSJ A;  4I96 A;  3TC2 A;  3FJH A;  1FGA A;  4Z9W B; 
#chains in the Genus database with same CATH homology
 4GAF A;  3AKF A;  2QN4 A;  3WA1 A;  3F62 B;  1YBI A;  3UJ0 A;  4I4S A;  4Q9G A;  4QBV A;  1IHK A;  2Q3N B;  31BI A;  2YUG A;  3AKI A;  1DZC A;  4QAL A;  4OUJ A;  3WO2 A;  3CA3 A;  4F83 A;  4ZFY B;  5DUY A;  3MAL A;  3BRD A;  3POK A;  3OJ2 A;  4USP A;  3CRI A;  1RY7 A;  1FWU A;  3O4O A;  1SZ6 B;  4LO2 A;  1OQL B;  3O5W B;  1BAR A;  2MLL B;  3FJJ A;  3AJ6 A;  3UD8 A;  3RMX A;  3A23 A;  1ILR 1;  2HW9 A;  1PC8 B;  1S0G A;  3HBW A;  4JKX B;  1FWV A;  1BA7 A;  3BB2 A;  3RMY A;  5D63 A;  3JUT A;  1JT5 A;  4QD2 C;  2D22 A;  1K5V A;  1CVS A;  1WD4 A;  2Q9X A;  1JY0 A;  4QC4 A;  3BAO A;  2D24 A;  3FJE A;  41BI A;  4I4O A;  4JRA A;  1DFC A;  9ILB A;  1ITB A;  4XKI A;  1JT7 A;  5BQU A;  3Q7W A;  2Z48 A;  2RST A;  2HWM A;  1TFM B;  3N7L A;  3IM7 A;  1AF9 A;  2NTD A;  4H9W A;  4G9N A;  4I4U A;  2DRY A;  4J2Y A;  4GOY A;  1BFB A;  3UJ4 A;  1FMM S;  3VSF A;  3VWC A;  3BRG C;  2HZ9 A;  3O4B A;  4H75 A;  4I0Y A;  4IYB A;  1DQO A;  2D43 A;  3OBT A;  5FZY A;  3A07 A;  3BAG A;  3AKH A;  2VXR A;  1AXM A;  5E24 E;  4GP0 A;  5F8Y A;  3AJ5 A;  2AQZ A;  2FDB M;  2KI4 A;  3ILA A;  3RTI B;  1HKN A;  4I4X A;  4ZA3 B;  3WIN C;  3ZC9 A;  3FJK A;  1Q04 A;  2ERM A;  4I1E A;  2VSA A;  5EC5 A;  4FGF A;  4IHZ A;  2VU9 A;  1G9B A;  4XFT A;  3OBR A;  1XG6 A;  4UY4 A;  3H6S E;  1PWA A;  1BLA A;  2RG9 B;  1AVW B;  1S0C A;  1N4K A;  2NS2 A;  3BA7 A;  3CQA A;  4QBC A;  4P6A A;  2P39 A;  1AFC A;  4EFQ A;  1BFF A;  5JMC A;  3F1R A;  5FNX A;  4J2X A;  5BXR A;  1MD6 A;  4DCK C;  4CJM A;  4FVV A;  3PHZ A;  3N7M A;  1R8O A;  3O4D A;  4P0J A;  1EVT A;  3ZX7 A;  4X37 A;  4MZG B;  4END A;  2E4M C;  1VCL A;  2NYY A;  3MPP G;  1JT4 A;  2LIQ A;  8I1B A;  3V79 C;  1ISW A;  5F8W A;  3BAV A;  4LO1 C;  1Q1U A;  3VT2 A;  1BFC A;  1YXW A;  2F2F C;  1HWP B;  3HOM A;  5FNW A;  1ABR B;  2ET2 A;  3O4A A;  1HIB A;  4G9M A;  2AAI B;  1V6W A;  3O3Q A;  3OGG A;  3BAD A;  3BAQ A;  4P0K A;  4JKQ A;  1T9F A;  3PUB A;  1BLD A;  4OW4 A;  2D23 A;  1UPS A;  2WRY A;  3AKG A;  1DZD A;  1PUM B;  3RTJ B;  4OEF A;  1JLY A;  1HCD A;  5JLV A;  1IRP A;  4JAW A;  1TOO A;  3LLP A;  1ONK B;  1PZZ A;  3CA0 A;  5B2H A;  1M2T B;  3FJC A;  4G1R A;  2D7I A;  2KH2 A;  3D7W B;  3N0K A;  4OEE A;  1HCE A;  1RML A;  1XHB A;  1WD3 A;  4A7K A;  2ZQN A;  4JP0 A;  4LO3 A;  3CRH A;  2VLC A;  4IQP A;  3VUO A;  2Z49 A;  4JPZ A;  5GAQ A;  1HWM B;  2DS0 A;  1EV2 A;  3CU1 B;  2NP0 A;  3V0A B;  4J2K A;  4X38 A;  4ZKT B;  5BXT A;  3FUQ A;  3NBN A;  3C9Z A;  1TWM A;  1NZK A;  1IRA X;  2KI6 B;  1FMZ A;  3Q7Y A;  4R6U B;  1A8D A;  4ZFW B;  4D0T A;  3CRG A;  1QXM A;  1QQL A;  4L4I A;  2KLL A;  4KC3 A;  7I1B A;  1P63 A;  1S0E A;  1G9D A;  1KNM A;  5BVP I;  1AVU A;  3AZV A;  3AH2 A;  3BA4 A;  3UDA A;  4I4P A;  3UD9 A;  5BP5 A;  4QKR A;  4EB2 B;  1TP0 A;  3E8L C;  4A7Z A;  4LO2 C;  4LO7 B;  3IM5 A;  2NVH A;  3FJA A;  5F8S A;  1EYL A;  2Y9W C;  4AN7 B;  3ZXD A;  1IT0 A;  3A22 A;  3V0B B;  1QQK A;  4IY9 A;  4EKX B;  2RQ9 A;  1ISZ A;  4HR6 C;  1NUN A;  1R8N A;  3AZW A;  3EF2 A;  4ION A;  2D1Z A;  4DEN A;  1W3G A;  4QO3 A;  2L5X A;  1RZO B;  1M16 A;  1IJT A;  2DRZ A;  3AH4 A;  3BA5 A;  4ZOT A;  2MC2 A;  2AFG A;  1SR4 A;  3I2X A;  2XOA A;  4GAI A;  3FFZ A;  3PG0 A;  3O4C A;  4XFS A;  5BQU C;  3UD7 A;  3OJM A;  3JRR A;  4MZF B;  2X2S A;  2NM1 A;  3P6J A;  2K43 A;  1BAS A;  1DFQ A;  4ZFU B;  3T8S A;  3KMV A;  3P53 A;  1W3A A;  1Z2V A;  2GO2 A;  1IOB A;  1WBA A;  3WMU A;  3QR5 A;  3FJF A;  2NZ9 A;  4IY8 A;  2ZR1 B;  3I29 B;  2BEB A;  1S0F A;  1DJS B;  5I1B A;  4II0 A;  5BP5 C;  4KEJ A;  5D61 A;  5FZU A;  4LO0 A;  3ZXG A;  2J3P A;  2K4A B;  4IZX A;  3HN1 A;  2FGF A;  1JQZ A;  4A7Y A;  1W3F A;  2VSE A;  3WMV A;  3AH1 A;  3FJB A;  4QD2 B;  3CAH A;  3QYD A;  5F90 A;  4I4Q A;  4GP3 A;  3PME A;  4WBC A;  3VSZ A;  1V6U A;  1S0D A;  1JT3 A;  3NBC A;  4GOV A;  1IIL A;  4TLP A;  3VT1 A;  4I1B A;  3H6R B;  5DSS B;  3H6R A;  2ZQO A;  4EEE B;  1SR4 C;  3CA6 A;  4ZBV B;  5DZU A;  2X2T A;  4KEK A;  4MZH A;  5FZZ A;  1FV3 A;  1GGP B;  1BFG A;  1I1B A;  3O49 A;  4I2S A;  4KEI A;  5EG6 C;  3VT0 A;  1II4 A;  3FJI A;  1Z0H A;  3BTA A;  2FFU A;  2FFV A;  3K1X A;  3IIR A;  4OWL A;  1F31 A;  4X39 A;  4HA2 A;  3SNV A;  3LTQ A;  2FO1 A;  1ISY A;  3Q7X A;  4D8H A;  1CE7 B;  4AN6 A;  2MIB A;  1AVX B;  2HWA A;  2KKI A;  4LO8 B;  4I4R A;  1EPW A;  3A21 A;  3HMY A;  2GZB A;  4JQ0 A;  3H6Q A;  4IZE A;  3HSM A;  2F8X C;  3R4S A;  4I3N A;  4YOL A;  4Z8S B;  1FQ9 A;  5DVH A;  3V0A A;  4LO0 C;  1DQG A;  4OWK A;  3BAU A;  4EFP A;  3WIN A;  3OGF A;  3NBD A;  2IWT B;  1JLX A;  21BI A;  1V6V A;  5D62 A;  4ZGR B;  1I1E A;  4ZLB B;  4I4V A;  4OWJ A;  1HWN B;  3FJ8 A;  4J23 B;  2K8R A;  3R4U A;  2QYI B;  5G00 A;  3IAG C;  5BOW A;  1AVA C;  4I37 A;  3CA1 A;  3FUO A;  4Q9P A;  1L2H A;  4EFR A;  3IM6 A;  3WO3 A;  1G9C A;  4HJJ A;  1G9A A;  4X3A A;  3WO4 A;  4I4Y A;  1HWO B;  1G82 A;  4ISQ A;  2E4M A;  5BXS A;  3V0B A;  4LO3 C;  2D7R A;  1K5U A;  3FJD A;  4I8M A;  1S0L A;  2R9K B;  1YF8 B;  3CA4 A;  3W9T A;  3OJV A;  4Q91 A;  1DIW A;  1MC9 A;  4LO1 A;  5EHA A;  2Y9G A;  2P23 A;  2F2F A;  1V6X A;  1D0H A;  4D0Z A;  4L4H A;  1XZZ A;  1J0S A;  6I1B A;  1FN0 A;  1DLL A;  2UUS A;  3O44 A;  2Y9X E;  3FJ9 A;  1ISV A;  2Y9F A;  2D20 A;  1TIE A;  2DRE A;  4PC4 A;  3ZC8 A;  3I2A A;  5HPZ A;  2BFH A;  2VXT I;  4F34 A;  2M49 A;  3B9U A;  3N7K A;  2IHO A;  1RG8 A;  4I6I A;  1FV2 A;  3P6I A;  4KBB A;  3BRF A;  3N7J A;  4OEG A;  4H04 A;  1XYF A;  1T4Q A;  1YTO A;  3HAL A;  1PUU B;  3VEQ A;  3S8K A;  2LIE A;  1TWE A;  2ESU A;  1E0O A;  3BX1 C;  1S0B A;  4I7I A;  4LO7 C;  1JTC A;  4P0L A;  2VUA A;  4G6J A;  3NJ5 A;  1WBC A;  1Z4S A;  1YYN A;  3FGM A;  4XFU A;  2BEA A;  4QKS A;  5BXP A;  4G6M A;  1TTU A;  3S8J A;  4DEP A;  1ISX A;  2AXM A;  4USO A;  2WBC A;  3CA5 A;  2I1B A;  4ISR A;  3NBE A;  4J2S A;  2D44 A;  1Q03 A;  3BAH A;  3RSJ A;  4I96 A;  3TC2 A;  3FJH A;  1FGA A;  4Z9W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...