2QYIB

Crystal structure of a binary complex between an engineered trypsin inhibitor and bovine trypsin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
175
structure length
175
Chain Sequence
b'DDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFRSLFIPRGSLVALGFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Crystal structure of a binary complex between an engineered trypsin inhibitor and Bovine trypsin
rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 27
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2qyiB00
1HWPB 4J2KA 1BFFA 1SZ6B 1OQLB 2RSTA 1II4A 2D24A 5BP5C 1XHBA 3WMUA 1TP0A 3VT2A 3PG0A 4I4SA 1XZZA 3BAUA 3QYDA 1J0SA 3VT0A 2Q3NB 2KI6B 2F2FA 4I2SA 1G9BA 4JP0A 2VXTI 1DZCA 1K5UA 1F31A 3F1RA 3BA5A 1RG8A 3IM5A 1YBIA 3O4AA 3WA1A 3CQAA 21BIA 5HPZA 2E4MC 5EC5A 3AKIA 2FDBM 4GOVA 5E24E 1DQOA 4DCKC 3IM6A 4KEJA 3SNVA 4LO3C 4ZOTA 1AVXB 3CA6A 4HA2A 2BFHA 4ZFWB 4ZBVB 1PC8B 5BXRA 3VEQA 3A21A 1DJSB 1S0DA 1ISVA 2NZ9A 4G6JA 2D20A 4QC4A 1ISXA 4I6IA 2QYIB 4L4IA 2BEAA 4Q9PA 1HIBA 3H6RB 1JT7A 2VXRA 3VSZA 1CVSA 1FMMS 1V6VA 1JLYA 4I8MA 1PUUB 4I1EA 4F83A 1DQGA 1MD6A 3CA0A 3IIRA 1DZDA 1SR4C 1JTCA 2AAIB 2Q9XA 2DRYA 3LLPA 3AH4A 3FJ9A 2K4AB 1T9FA 1TWEA 4ZFYB 4IZEA 3UJ4A 4JKQA 3WINA 2ZQNA 4I4PA 1IJTA 2MLLB 3B9UA 3BAOA 3H6RA 1K5VA 1Q1UA 2DRZA 4LO7C 4JRAA 4XKIA 5BP5A 3V79C 1S0GA 3HOMA 3O4OA 1BFBA 1QXMA 2Y9GA 2VSAA 2Y9FA 3UDAA 3FJCA 4J23B 2AFGA 4JAWA 3ZXDA 1IOBA 3BA4A 3OBRA 3BADA 1G82A 3HMYA 1GGPB 4LO2C 2MIBA 4USOA 4EFRA 3CA3A 3NBDA 3OJVA 2AXMA 4FVVA 4H04A 1AVUA 1Z2VA 5JMCA 4OEFA 3FUOA 3MPPG 1JLXA 3O49A 3I2AA 1I1EA 1QQLA 4IZXA 3UD8A 1AVWB 3ZC8A 3CRIA 1NUNA 4ENDA 5BQUA 3HBWA 1PUMB 4I0YA 2D22A 3ZXGA 1FQ9A 1DFQA 3NBEA 4GAFA 1YF8B 3AKHA 5BOWA 3ZC9A 5D63A 3BTAA 2QN4A 1TOOA 1BLDA 1TFMB 3NBNA 1AF9A 3CA5A 4LO7B 4XFUA 6I1BA 4G6MA 3UD9A 4QD2B 3D7WB 1FV2A 3CRGA 2HWAA 3VT1A 1ABRB 3FJFA 2ESUA 1SR4A 4I4QA 4H9WA 4EFPA 2HZ9A 1Q04A 3VSFA 4XFTA 3TC2A 3FJDA 4KEKA 3RTIB 4OUJA 1DFCA 3O4DA 3O44A 1BASA 4JPZA 2NYYA 4IHZA 2KH2A 2HW9A 2D1ZA 3Q7YA 1I1BA 3OGFA 5FNWA 1S0LA 3RMXA 5FZZA 2I1BA 3N7MA 2ET2A 3NBCA 5BQUC 3QR5A 4X37A 1YTOA 4I4UA 4II0A 1BA7A 4Q9GA 4ZA3B 3AZVA 4LO8B 3A22A 3R4UA 4WBCA 3O4CA 4LO2A 2DS0A 2KLLA 1PWAA 5F8WA 5G00A 1ISWA 1V6UA 4I1BA 2HWMA 1RMLA 2X2SA 1A8DA 1BLAA 3FJEA 4G9NA 5FZUA 1KNMA 1Z0HA 4ZGRB 4I37A 2NP0A 2M49A 2FFUA 31BIA 3CU1B 2YUGA 5GAQA 1ISZA 3VWCA 3WO3A 2Z48A 2Z49A 1S0EA 3PHZA 3FJIA 2GZBA 3CA1A 3N7KA 1T4QA 3P6JA 3AH1A 3AJ5A 5BXPA 1BFCA 3FJJA 4OWLA 1HCDA 4QD2C 1YXWA 3BRFA 5BVPI 4QALA 1NZKA 4D8HA 1TTUA 4G9MA 1WBCA 4I3NA 3W9TA 1IHKA 2MC2A 4USPA 1ILR1 4Z8SB 1R8NA 1HWMB 4Z9WB 4J2XA 2DREA 1M2TB 1AXMA 3A23A 4R6UB 1N4KA 3VUOA 4JKXB 1HCEA 3V0AB 2NM1A 2KKIA 3AKGA 4X39A 1Z4SA 1M16A 1ONKB 5F90A 5DZUA 1ITBA 2WRYA 1EVTA 1DIWA 4ZFUB 2RG9B 2VUAA 3BX1C 4IY9A 3BAQA 3ZX7A 3WMVA 5DUYA 3RTJB 1JY0A 2FFVA 4I7IA 3E8LC 3OBTA 2P39A 3OGGA 3CA4A 3S8KA 3BAVA 2D44A 4A7ZA 8I1BA 3FJ8A 4OEEA 4QO3A 3T8SA 5BXTA 1EYLA 3V0AA 1JT5A 3FJAA 3BRDA 1TWMA 3WO2A 1V6XA 2VSEA 3LTQA 3PUBA 5D62A 3OJ2A 4ZKTB 5BXSA 1E0OA 2K43A 1S0CA 3BAHA 4ISRA 4EFQA 4ISQA 41BIA 1BFGA 4EEEB 1AVAC 3V0BB 3BRGC 2UUSA 1EV2A 2D7RA 4FGFA 4QBVA 4DEPA 1WD4A 3A07A 4IYBA 4ZLBB 3UD7A 3RMYA 3N0KA 3N7LA 2LIQA 4CJMA 4GAIA 2J3PA 3FFZA 1WD3A 1V6WA 1D0HA 2D43A 1WBAA 3MALA 3WO4A 3FUQA 3F62B 3IAGC 2VLCA 4LO1C 3KMVA 4I4VA 4HJJA 4G1RA 2RQ9A 1UPSA 2D23A 4OWKA 4X38A 4OEGA 3V0BA 4IQPA 4KEIA 2IHOA 4IY8A 4P6AA 1W3AA 2AQZA 4TLPA 2Y9XE 3CRHA 4J2SA 1HWOB 4I96A 2KI4A 4IONA 1G9DA 3PMEA 1CE7B 3BB2A 2NVHA 2D7IA 1IRPA 4OW4A 4X3AA 3OJMA 7I1BA 1P63A 2VU9A 1FWUA 1W3GA 2LIEA 2FO1A 3RSJA 4QBCA 3HSMA 1BARA 3HN1A 4I4XA 4I4RA 1PZZA 2X2TA 4L4HA 1IT0A 2ZR1B 3AZWA 3CAHA 4KC3A 1JQZA 4F34A 3C9ZA 4GP3A 4P0JA 1YYNA 2Y9WC 4D0ZA 2P23A 2FGFA 2F8XC 3NJ5A 1FV3A 1ISYA 3R4SA 1XG6A 3EF2A 1FWVA 2R9KB 3JRRA 1W3FA 4EKXB 5I1BA 4OWJA 4YOLA 5DSSB 3O5WB 1JT3A 2F2FC 3N7JA 3O4BA 3K1XA 5FZYA 4LO0A 3S8JA 2XOAA 3POKA 1RZOB 1HKNA 1S0BA 4PC4A 1FN0A 3Q7WA 1MC9A 4QKRA 3AH2A 1EPWA 1IILA 1JT4A 3O3QA 3FJBA 4A7KA 1Q03A 1FGAA 4QKSA 1S0FA 1RY7A 2WBCA 1G9AA 3UJ0A 4HR6C 4A7YA 2L5XA 1DLLA 1AFCA 3BA7A 5DVHA 3JUTA 2ERMA 3Q7XA 4XFSA 1QQKA 4LO1A 1XYFA 3HALA 4AN7B 1HWNB 4P0LA 5EHAA 5D61A 3I2XA 3I29B 3ILAA 5F8SA 3H6QA 9ILBA 1R8OA 3BAGA 2BEBA 5EG6C 4J2YA 1VCLA 3H6SE 2NTDA 2E4MA 4I4YA 4EB2B 2K8RA 4JQ0A 1FMZA 5F8YA 4GP0A 2IWTB 1TIEA 4LO3A 4KBBA 2GO2A 1L2HA 3P6IA 5FNXA 3AJ6A 4GOYA 4AN6A 2ZQOA 4Q91A 4P0KA 3AKFA 4LO0C 5JLVA 3IM7A 1G9CA 3P53A 3WINC 4I4OA 4D0TA 3FJHA 5B2HA 1IRAX 3FJKA 4DENA 3FGMA
chains in the Genus database with same CATH superfamily
1HWPB 4J2KA 1BFFA 1SZ6B 1OQLB 2RSTA 1II4A 2D24A 4UY4A 5BP5C 1XHBA 3WMUA 1TP0A 3VT2A 3PG0A 4I4SA 1XZZA 3BAUA 3QYDA 1J0SA 3VT0A 2Q3NB 2KI6B 2F2FA 4I2SA 1G9BA 4JP0A 2VXTI 1DZCA 1K5UA 1F31A 3F1RA 3BA5A 1RG8A 3IM5A 1YBIA 3O4AA 3WA1A 3CQAA 21BIA 5HPZA 2E4MC 5EC5A 3AKIA 4MZFB 2FDBM 4GOVA 5E24E 1DQOA 4DCKC 3IM6A 4KEJA 3SNVA 4LO3C 4ZOTA 1AVXB 3CA6A 4HA2A 2BFHA 4ZFWB 4ZBVB 1PC8B 5BXRA 3VEQA 3A21A 1DJSB 1S0DA 1ISVA 2NZ9A 4G6JA 2D20A 4QC4A 1ISXA 4I6IA 2QYIB 4L4IA 2BEAA 4Q9PA 1HIBA 3H6RB 1JT7A 2VXRA 3VSZA 1CVSA 1FMMS 1V6VA 1JLYA 4I8MA 1PUUB 4I1EA 4F83A 1DQGA 1MD6A 3CA0A 3IIRA 1DZDA 1SR4C 1JTCA 2AAIB 2Q9XA 2DRYA 3LLPA 3AH4A 3FJ9A 2K4AB 1T9FA 1TWEA 4ZFYB 4IZEA 3UJ4A 4JKQA 3WINA 2ZQNA 4I4PA 1IJTA 2MLLB 3B9UA 3BAOA 3H6RA 1K5VA 1Q1UA 2DRZA 4LO7C 4JRAA 4XKIA 5BP5A 3V79C 1S0GA 3HOMA 3O4OA 1BFBA 1QXMA 2Y9GA 2VSAA 2Y9FA 3UDAA 3FJCA 4J23B 2AFGA 4JAWA 3ZXDA 1IOBA 3BA4A 3OBRA 3BADA 1G82A 3HMYA 1GGPB 4LO2C 2MIBA 4USOA 4EFRA 3CA3A 3NBDA 3OJVA 2AXMA 4FVVA 4H04A 1AVUA 1Z2VA 5JMCA 4OEFA 3FUOA 3MPPG 1JLXA 3O49A 3I2AA 1I1EA 1QQLA 4IZXA 3UD8A 1AVWB 3ZC8A 3CRIA 1NUNA 4ENDA 5BQUA 3HBWA 1PUMB 4I0YA 2D22A 3ZXGA 1FQ9A 1DFQA 3NBEA 4GAFA 1YF8B 3AKHA 5BOWA 3ZC9A 5D63A 3BTAA 2QN4A 1TOOA 1BLDA 1TFMB 3NBNA 1AF9A 3CA5A 4LO7B 4XFUA 6I1BA 4G6MA 3UD9A 4QD2B 3D7WB 1FV2A 3CRGA 2HWAA 3VT1A 1ABRB 3FJFA 2ESUA 1SR4A 4I4QA 4H9WA 4EFPA 2HZ9A 1Q04A 3VSFA 4XFTA 3TC2A 3FJDA 4KEKA 3RTIB 4OUJA 1DFCA 3O4DA 3O44A 1BASA 4JPZA 2NYYA 4IHZA 2KH2A 2HW9A 2D1ZA 3Q7YA 1I1BA 3OGFA 5FNWA 1S0LA 3RMXA 5FZZA 2I1BA 3N7MA 2ET2A 3NBCA 5BQUC 3QR5A 4X37A 1YTOA 4I4UA 4II0A 1BA7A 4Q9GA 4ZA3B 3AZVA 4LO8B 3A22A 3R4UA 4WBCA 3O4CA 4LO2A 2DS0A 2KLLA 1PWAA 5F8WA 5G00A 1ISWA 1V6UA 4I1BA 2HWMA 1RMLA 2X2SA 2NS2A 1A8DA 1BLAA 3FJEA 4G9NA 5FZUA 1KNMA 1Z0HA 4ZGRB 4I37A 2NP0A 2M49A 2FFUA 31BIA 3CU1B 2YUGA 5GAQA 1ISZA 3VWCA 3WO3A 2Z48A 2Z49A 1S0EA 3PHZA 3FJIA 2GZBA 3CA1A 3N7KA 1T4QA 3P6JA 3AH1A 3AJ5A 5BXPA 1BFCA 3FJJA 4OWLA 1HCDA 4QD2C 1YXWA 3BRFA 5BVPI 4QALA 1NZKA 4D8HA 1TTUA 4G9MA 1WBCA 4I3NA 3W9TA 1IHKA 2MC2A 4USPA 1ILR1 4Z8SB 1R8NA 1HWMB 4Z9WB 4J2XA 2DREA 1M2TB 1AXMA 3A23A 4R6UB 1N4KA 3VUOA 4JKXB 1HCEA 3V0AB 2NM1A 2KKIA 3AKGA 4X39A 1Z4SA 1M16A 1ONKB 5F90A 5DZUA 1ITBA 2WRYA 1EVTA 1DIWA 4ZFUB 2RG9B 2VUAA 3BX1C 4IY9A 3BAQA 3ZX7A 3WMVA 5DUYA 3RTJB 1JY0A 2FFVA 4I7IA 3E8LC 3OBTA 2P39A 3OGGA 3CA4A 3S8KA 3BAVA 2D44A 4A7ZA 8I1BA 3FJ8A 4OEEA 4QO3A 3T8SA 5BXTA 1EYLA 3V0AA 1JT5A 3FJAA 3BRDA 1TWMA 3WO2A 1V6XA 2VSEA 3LTQA 3PUBA 5D62A 3OJ2A 4ZKTB 5BXSA 1E0OA 2K43A 1S0CA 3BAHA 4ISRA 4EFQA 4ISQA 41BIA 1BFGA 4EEEB 1AVAC 3V0BB 3BRGC 2UUSA 1EV2A 2D7RA 4FGFA 4QBVA 4DEPA 1WD4A 3A07A 4IYBA 4ZLBB 3UD7A 3RMYA 3N0KA 3N7LA 2LIQA 4CJMA 4GAIA 2J3PA 3FFZA 1WD3A 1V6WA 1D0HA 2D43A 1WBAA 3MALA 3WO4A 3FUQA 4H75A 3F62B 3IAGC 2VLCA 4LO1C 3KMVA 4I4VA 4HJJA 4G1RA 2RQ9A 1UPSA 2D23A 4OWKA 4X38A 4OEGA 3V0BA 4IQPA 4KEIA 2IHOA 4IY8A 4P6AA 1W3AA 2AQZA 4TLPA 2Y9XE 3CRHA 4J2SA 1HWOB 4I96A 2KI4A 4IONA 1G9DA 3PMEA 1CE7B 3BB2A 2NVHA 2D7IA 1IRPA 4OW4A 4X3AA 3OJMA 7I1BA 1P63A 2VU9A 1FWUA 1W3GA 4MZHA 2LIEA 2FO1A 3RSJA 4QBCA 3HSMA 1BARA 3HN1A 4I4XA 4I4RA 1PZZA 2X2TA 4L4HA 1IT0A 2ZR1B 3AZWA 3CAHA 4KC3A 1JQZA 4F34A 3C9ZA 4GP3A 4P0JA 1YYNA 2Y9WC 4D0ZA 2P23A 2FGFA 2F8XC 3NJ5A 1FV3A 1ISYA 3R4SA 1XG6A 3EF2A 1FWVA 2R9KB 3JRRA 1W3FA 4EKXB 5I1BA 4OWJA 4YOLA 5DSSB 3O5WB 1JT3A 2F2FC 3N7JA 3O4BA 3K1XA 5FZYA 4LO0A 3S8JA 2XOAA 3POKA 1RZOB 1HKNA 1S0BA 4PC4A 1FN0A 3Q7WA 1MC9A 4QKRA 3AH2A 1EPWA 1IILA 1JT4A 3O3QA 3FJBA 4A7KA 1Q03A 1FGAA 4QKSA 1S0FA 1RY7A 4MZGB 2WBCA 1G9AA 3UJ0A 4HR6C 4A7YA 2L5XA 1DLLA 1AFCA 3BA7A 5DVHA 3JUTA 2ERMA 3Q7XA 4XFSA 1QQKA 4LO1A 1XYFA 3HALA 4AN7B 1HWNB 4P0LA 5EHAA 5D61A 3I2XA 3I29B 3ILAA 5F8SA 3H6QA 9ILBA 1R8OA 3BAGA 2BEBA 5EG6C 4J2YA 1VCLA 3H6SE 2NTDA 2E4MA 4I4YA 4EB2B 2K8RA 4JQ0A 1FMZA 5F8YA 4GP0A 2IWTB 1TIEA 4LO3A 4KBBA 2GO2A 1L2HA 3P6IA 5FNXA 3AJ6A 4GOYA 4AN6A 2ZQOA 4Q91A 4P0KA 3AKFA 4LO0C 5JLVA 3IM7A 1G9CA 3P53A 3WINC 4I4OA 4D0TA 3FJHA 5B2HA 1IRAX 3FJKA 4DENA 3FGMA
chains in the Genus database with same CATH topology
1HWPB 4J2KA 1BFFA 1SZ6B 1OQLB 2RSTA 1II4A 2D24A 4UY4A 5BP5C 1XHBA 3WMUA 1TP0A 3VT2A 3PG0A 4I4SA 1XZZA 3BAUA 3QYDA 1J0SA 3VT0A 2Q3NB 2KI6B 2F2FA 4I2SA 1G9BA 4JP0A 2VXTI 1DZCA 1K5UA 1F31A 3F1RA 3BA5A 1RG8A 3IM5A 1YBIA 3O4AA 3WA1A 3CQAA 21BIA 5HPZA 2E4MC 5EC5A 3AKIA 4MZFB 2FDBM 4GOVA 5E24E 1DQOA 4DCKC 3IM6A 4KEJA 3SNVA 4LO3C 4ZOTA 1AVXB 3CA6A 4HA2A 2BFHA 4ZFWB 4ZBVB 1PC8B 5BXRA 3VEQA 3A21A 1DJSB 1S0DA 1ISVA 2NZ9A 4G6JA 2D20A 4QC4A 1ISXA 4I6IA 2QYIB 4L4IA 2BEAA 4Q9PA 1HIBA 3H6RB 1JT7A 2VXRA 3VSZA 1CVSA 1FMMS 1V6VA 1JLYA 4I8MA 1PUUB 4I1EA 4F83A 1DQGA 1MD6A 3CA0A 3IIRA 1DZDA 1SR4C 1JTCA 2AAIB 2Q9XA 2DRYA 3LLPA 3AH4A 3FJ9A 2K4AB 1T9FA 1TWEA 4ZFYB 4IZEA 3UJ4A 4JKQA 3WINA 2ZQNA 4I4PA 1IJTA 2MLLB 3B9UA 3BAOA 3H6RA 1K5VA 1Q1UA 2DRZA 4LO7C 4JRAA 4XKIA 5BP5A 3V79C 1S0GA 3HOMA 3O4OA 1BFBA 1QXMA 2Y9GA 2VSAA 2Y9FA 3UDAA 3FJCA 4J23B 2AFGA 4JAWA 3ZXDA 1IOBA 3BA4A 3OBRA 3BADA 1G82A 3HMYA 1GGPB 4LO2C 2MIBA 4USOA 4EFRA 3CA3A 3NBDA 3OJVA 2AXMA 4FVVA 4H04A 1AVUA 1Z2VA 5JMCA 4OEFA 3FUOA 3MPPG 1JLXA 3O49A 3I2AA 1I1EA 1QQLA 4IZXA 3UD8A 1AVWB 3ZC8A 3CRIA 1NUNA 4ENDA 5BQUA 3HBWA 1PUMB 4I0YA 2D22A 3ZXGA 1FQ9A 1DFQA 3NBEA 4GAFA 1YF8B 3AKHA 5BOWA 3ZC9A 5D63A 3BTAA 2QN4A 1TOOA 1BLDA 1TFMB 3NBNA 1AF9A 3CA5A 4LO7B 4XFUA 6I1BA 4G6MA 3UD9A 4QD2B 3D7WB 1FV2A 3CRGA 2HWAA 3VT1A 1ABRB 3FJFA 2ESUA 1SR4A 4I4QA 4H9WA 4EFPA 2HZ9A 1Q04A 3VSFA 4XFTA 3TC2A 3FJDA 4KEKA 3RTIB 4OUJA 1DFCA 3O4DA 3O44A 1BASA 4JPZA 2NYYA 4IHZA 2KH2A 2HW9A 2D1ZA 3Q7YA 1I1BA 3OGFA 5FNWA 1S0LA 3RMXA 5FZZA 2I1BA 3N7MA 2ET2A 3NBCA 5BQUC 3QR5A 4X37A 1YTOA 4I4UA 4II0A 1BA7A 4Q9GA 4ZA3B 3AZVA 4LO8B 3A22A 3R4UA 4WBCA 3O4CA 4LO2A 2DS0A 2KLLA 1PWAA 5F8WA 5G00A 1ISWA 1V6UA 4I1BA 2HWMA 1RMLA 2X2SA 2NS2A 1A8DA 1BLAA 3FJEA 4G9NA 5FZUA 1KNMA 1Z0HA 4ZGRB 4I37A 2NP0A 2M49A 2FFUA 31BIA 3CU1B 2YUGA 5GAQA 1ISZA 3VWCA 3WO3A 2Z48A 2Z49A 1S0EA 3PHZA 3FJIA 2GZBA 3CA1A 3N7KA 1T4QA 3P6JA 3AH1A 3AJ5A 5BXPA 1BFCA 3FJJA 4OWLA 1HCDA 4QD2C 1YXWA 3BRFA 5BVPI 4QALA 1NZKA 4D8HA 1TTUA 4G9MA 1WBCA 4I3NA 3W9TA 1IHKA 2MC2A 4USPA 1ILR1 4Z8SB 1R8NA 1HWMB 4Z9WB 4J2XA 2DREA 1M2TB 1AXMA 3A23A 4R6UB 1N4KA 3VUOA 4JKXB 1HCEA 3V0AB 2NM1A 2KKIA 3AKGA 4X39A 1Z4SA 1M16A 1ONKB 5F90A 5DZUA 1ITBA 2WRYA 1EVTA 1DIWA 4ZFUB 2RG9B 2VUAA 3BX1C 4IY9A 3BAQA 3ZX7A 3WMVA 5DUYA 3RTJB 1JY0A 2FFVA 4I7IA 3E8LC 3OBTA 2P39A 3OGGA 3CA4A 3S8KA 3BAVA 2D44A 4A7ZA 8I1BA 3FJ8A 4OEEA 4QO3A 3T8SA 5BXTA 1EYLA 3V0AA 1JT5A 3FJAA 3BRDA 1TWMA 3WO2A 1V6XA 2VSEA 3LTQA 3PUBA 5D62A 3OJ2A 4ZKTB 5BXSA 1E0OA 2K43A 1S0CA 3BAHA 4ISRA 4EFQA 4ISQA 41BIA 1BFGA 4EEEB 1AVAC 3V0BB 3BRGC 2UUSA 1EV2A 2D7RA 4FGFA 4QBVA 4DEPA 1WD4A 3A07A 4IYBA 4ZLBB 3UD7A 3RMYA 3N0KA 3N7LA 2LIQA 4CJMA 4GAIA 2J3PA 3FFZA 1WD3A 1V6WA 1D0HA 2D43A 1WBAA 3MALA 3WO4A 3FUQA 4H75A 3F62B 3IAGC 2VLCA 4LO1C 3KMVA 4I4VA 4HJJA 4G1RA 2RQ9A 1UPSA 2D23A 4OWKA 4X38A 4OEGA 3V0BA 4IQPA 4KEIA 2IHOA 4IY8A 4P6AA 1W3AA 2AQZA 4TLPA 2Y9XE 3CRHA 4J2SA 1HWOB 4I96A 2KI4A 4IONA 1G9DA 3PMEA 1CE7B 3BB2A 2NVHA 2D7IA 1IRPA 4OW4A 4X3AA 3OJMA 7I1BA 1P63A 2VU9A 1FWUA 1W3GA 4MZHA 2LIEA 2FO1A 3RSJA 4QBCA 3HSMA 1BARA 3HN1A 4I4XA 4I4RA 1PZZA 2X2TA 4L4HA 1IT0A 2ZR1B 3AZWA 3CAHA 4KC3A 1JQZA 4F34A 3C9ZA 4GP3A 4P0JA 1YYNA 2Y9WC 4D0ZA 2P23A 2FGFA 2F8XC 3NJ5A 1FV3A 1ISYA 3R4SA 1XG6A 3EF2A 1FWVA 2R9KB 3JRRA 1W3FA 4EKXB 5I1BA 4OWJA 4YOLA 5DSSB 3O5WB 1JT3A 2F2FC 3N7JA 3O4BA 3K1XA 5FZYA 4LO0A 3S8JA 2XOAA 3POKA 1RZOB 1HKNA 1S0BA 4PC4A 1FN0A 3Q7WA 1MC9A 4QKRA 3AH2A 1EPWA 1IILA 1JT4A 3O3QA 3FJBA 4A7KA 1Q03A 1FGAA 4QKSA 1S0FA 1RY7A 4MZGB 2WBCA 1G9AA 3UJ0A 4HR6C 4A7YA 2L5XA 1DLLA 1AFCA 3BA7A 5DVHA 3JUTA 2ERMA 3Q7XA 4XFSA 1QQKA 4LO1A 1XYFA 3HALA 4AN7B 1HWNB 4P0LA 5EHAA 5D61A 3I2XA 3I29B 3ILAA 5F8SA 3H6QA 9ILBA 1R8OA 3BAGA 2BEBA 5EG6C 4J2YA 1VCLA 3H6SE 2NTDA 2E4MA 4I4YA 4EB2B 2K8RA 4JQ0A 1FMZA 5F8YA 4GP0A 2IWTB 1TIEA 4LO3A 4KBBA 2GO2A 1L2HA 3P6IA 5FNXA 3AJ6A 4GOYA 4AN6A 2ZQOA 4Q91A 4P0KA 3AKFA 4LO0C 5JLVA 3IM7A 1G9CA 3P53A 3WINC 4I4OA 4D0TA 3FJHA 5B2HA 1IRAX 3FJKA 4DENA 3FGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HWP B;  4J2K A;  1BFF A;  1SZ6 B;  1OQL B;  2RST A;  1II4 A;  2D24 A;  5BP5 C;  1XHB A;  3WMU A;  1TP0 A;  3VT2 A;  3PG0 A;  4I4S A;  1XZZ A;  3BAU A;  3QYD A;  1J0S A;  3VT0 A;  2Q3N B;  2KI6 B;  2F2F A;  4I2S A;  1G9B A;  4JP0 A;  2VXT I;  1DZC A;  1K5U A;  1F31 A;  3F1R A;  3BA5 A;  1RG8 A;  3IM5 A;  1YBI A;  3O4A A;  3WA1 A;  3CQA A;  21BI A;  5HPZ A;  2E4M C;  5EC5 A;  3AKI A;  2FDB M;  4GOV A;  5E24 E;  1DQO A;  4DCK C;  3IM6 A;  4KEJ A;  3SNV A;  4LO3 C;  4ZOT A;  1AVX B;  3CA6 A;  4HA2 A;  2BFH A;  4ZFW B;  4ZBV B;  1PC8 B;  5BXR A;  3VEQ A;  3A21 A;  1DJS B;  1S0D A;  1ISV A;  2NZ9 A;  4G6J A;  2D20 A;  4QC4 A;  1ISX A;  4I6I A;  2QYI B;  4L4I A;  2BEA A;  4Q9P A;  1HIB A;  3H6R B;  1JT7 A;  2VXR A;  3VSZ A;  1CVS A;  1FMM S;  1V6V A;  1JLY A;  4I8M A;  1PUU B;  4I1E A;  4F83 A;  1DQG A;  1MD6 A;  3CA0 A;  3IIR A;  1DZD A;  1SR4 C;  1JTC A;  2AAI B;  2Q9X A;  2DRY A;  3LLP A;  3AH4 A;  3FJ9 A;  2K4A B;  1T9F A;  1TWE A;  4ZFY B;  4IZE A;  3UJ4 A;  4JKQ A;  3WIN A;  2ZQN A;  4I4P A;  1IJT A;  2MLL B;  3B9U A;  3BAO A;  3H6R A;  1K5V A;  1Q1U A;  2DRZ A;  4LO7 C;  4JRA A;  4XKI A;  5BP5 A;  3V79 C;  1S0G A;  3HOM A;  3O4O A;  1BFB A;  1QXM A;  2Y9G A;  2VSA A;  2Y9F A;  3UDA A;  3FJC A;  4J23 B;  2AFG A;  4JAW A;  3ZXD A;  1IOB A;  3BA4 A;  3OBR A;  3BAD A;  1G82 A;  3HMY A;  1GGP B;  4LO2 C;  2MIB A;  4USO A;  4EFR A;  3CA3 A;  3NBD A;  3OJV A;  2AXM A;  4FVV A;  4H04 A;  1AVU A;  1Z2V A;  5JMC A;  4OEF A;  3FUO A;  3MPP G;  1JLX A;  3O49 A;  3I2A A;  1I1E A;  1QQL A;  4IZX A;  3UD8 A;  1AVW B;  3ZC8 A;  3CRI A;  1NUN A;  4END A;  5BQU A;  3HBW A;  1PUM B;  4I0Y A;  2D22 A;  3ZXG A;  1FQ9 A;  1DFQ A;  3NBE A;  4GAF A;  1YF8 B;  3AKH A;  5BOW A;  3ZC9 A;  5D63 A;  3BTA A;  2QN4 A;  1TOO A;  1BLD A;  1TFM B;  3NBN A;  1AF9 A;  3CA5 A;  4LO7 B;  4XFU A;  6I1B A;  4G6M A;  3UD9 A;  4QD2 B;  3D7W B;  1FV2 A;  3CRG A;  2HWA A;  3VT1 A;  1ABR B;  3FJF A;  2ESU A;  1SR4 A;  4I4Q A;  4H9W A;  4EFP A;  2HZ9 A;  1Q04 A;  3VSF A;  4XFT A;  3TC2 A;  3FJD A;  4KEK A;  3RTI B;  4OUJ A;  1DFC A;  3O4D A;  3O44 A;  1BAS A;  4JPZ A;  2NYY A;  4IHZ A;  2KH2 A;  2HW9 A;  2D1Z A;  3Q7Y A;  1I1B A;  3OGF A;  5FNW A;  1S0L A;  3RMX A;  5FZZ A;  2I1B A;  3N7M A;  2ET2 A;  3NBC A;  5BQU C;  3QR5 A;  4X37 A;  1YTO A;  4I4U A;  4II0 A;  1BA7 A;  4Q9G A;  4ZA3 B;  3AZV A;  4LO8 B;  3A22 A;  3R4U A;  4WBC A;  3O4C A;  4LO2 A;  2DS0 A;  2KLL A;  1PWA A;  5F8W A;  5G00 A;  1ISW A;  1V6U A;  4I1B A;  2HWM A;  1RML A;  2X2S A;  1A8D A;  1BLA A;  3FJE A;  4G9N A;  5FZU A;  1KNM A;  1Z0H A;  4ZGR B;  4I37 A;  2NP0 A;  2M49 A;  2FFU A;  31BI A;  3CU1 B;  2YUG A;  5GAQ A;  1ISZ A;  3VWC A;  3WO3 A;  2Z48 A;  2Z49 A;  1S0E A;  3PHZ A;  3FJI A;  2GZB A;  3CA1 A;  3N7K A;  1T4Q A;  3P6J A;  3AH1 A;  3AJ5 A;  5BXP A;  1BFC A;  3FJJ A;  4OWL A;  1HCD A;  4QD2 C;  1YXW A;  3BRF A;  5BVP I;  4QAL A;  1NZK A;  4D8H A;  1TTU A;  4G9M A;  1WBC A;  4I3N A;  3W9T A;  1IHK A;  2MC2 A;  4USP A;  1ILR 1;  4Z8S B;  1R8N A;  1HWM B;  4Z9W B;  4J2X A;  2DRE A;  1M2T B;  1AXM A;  3A23 A;  4R6U B;  1N4K A;  3VUO A;  4JKX B;  1HCE A;  3V0A B;  2NM1 A;  2KKI A;  3AKG A;  4X39 A;  1Z4S A;  1M16 A;  1ONK B;  5F90 A;  5DZU A;  1ITB A;  2WRY A;  1EVT A;  1DIW A;  4ZFU B;  2RG9 B;  2VUA A;  3BX1 C;  4IY9 A;  3BAQ A;  3ZX7 A;  3WMV A;  5DUY A;  3RTJ B;  1JY0 A;  2FFV A;  4I7I A;  3E8L C;  3OBT A;  2P39 A;  3OGG A;  3CA4 A;  3S8K A;  3BAV A;  2D44 A;  4A7Z A;  8I1B A;  3FJ8 A;  4OEE A;  4QO3 A;  3T8S A;  5BXT A;  1EYL A;  3V0A A;  1JT5 A;  3FJA A;  3BRD A;  1TWM A;  3WO2 A;  1V6X A;  2VSE A;  3LTQ A;  3PUB A;  5D62 A;  3OJ2 A;  4ZKT B;  5BXS A;  1E0O A;  2K43 A;  1S0C A;  3BAH A;  4ISR A;  4EFQ A;  4ISQ A;  41BI A;  1BFG A;  4EEE B;  1AVA C;  3V0B B;  3BRG C;  2UUS A;  1EV2 A;  2D7R A;  4FGF A;  4QBV A;  4DEP A;  1WD4 A;  3A07 A;  4IYB A;  4ZLB B;  3UD7 A;  3RMY A;  3N0K A;  3N7L A;  2LIQ A;  4CJM A;  4GAI A;  2J3P A;  3FFZ A;  1WD3 A;  1V6W A;  1D0H A;  2D43 A;  1WBA A;  3MAL A;  3WO4 A;  3FUQ A;  3F62 B;  3IAG C;  2VLC A;  4LO1 C;  3KMV A;  4I4V A;  4HJJ A;  4G1R A;  2RQ9 A;  1UPS A;  2D23 A;  4OWK A;  4X38 A;  4OEG A;  3V0B A;  4IQP A;  4KEI A;  2IHO A;  4IY8 A;  4P6A A;  1W3A A;  2AQZ A;  4TLP A;  2Y9X E;  3CRH A;  4J2S A;  1HWO B;  4I96 A;  2KI4 A;  4ION A;  1G9D A;  3PME A;  1CE7 B;  3BB2 A;  2NVH A;  2D7I A;  1IRP A;  4OW4 A;  4X3A A;  3OJM A;  7I1B A;  1P63 A;  2VU9 A;  1FWU A;  1W3G A;  2LIE A;  2FO1 A;  3RSJ A;  4QBC A;  3HSM A;  1BAR A;  3HN1 A;  4I4X A;  4I4R A;  1PZZ A;  2X2T A;  4L4H A;  1IT0 A;  2ZR1 B;  3AZW A;  3CAH A;  4KC3 A;  1JQZ A;  4F34 A;  3C9Z A;  4GP3 A;  4P0J A;  1YYN A;  2Y9W C;  4D0Z A;  2P23 A;  2FGF A;  2F8X C;  3NJ5 A;  1FV3 A;  1ISY A;  3R4S A;  1XG6 A;  3EF2 A;  1FWV A;  2R9K B;  3JRR A;  1W3F A;  4EKX B;  5I1B A;  4OWJ A;  4YOL A;  5DSS B;  3O5W B;  1JT3 A;  2F2F C;  3N7J A;  3O4B A;  3K1X A;  5FZY A;  4LO0 A;  3S8J A;  2XOA A;  3POK A;  1RZO B;  1HKN A;  1S0B A;  4PC4 A;  1FN0 A;  3Q7W A;  1MC9 A;  4QKR A;  3AH2 A;  1EPW A;  1IIL A;  1JT4 A;  3O3Q A;  3FJB A;  4A7K A;  1Q03 A;  1FGA A;  4QKS A;  1S0F A;  1RY7 A;  2WBC A;  1G9A A;  3UJ0 A;  4HR6 C;  4A7Y A;  2L5X A;  1DLL A;  1AFC A;  3BA7 A;  5DVH A;  3JUT A;  2ERM A;  3Q7X A;  4XFS A;  1QQK A;  4LO1 A;  1XYF A;  3HAL A;  4AN7 B;  1HWN B;  4P0L A;  5EHA A;  5D61 A;  3I2X A;  3I29 B;  3ILA A;  5F8S A;  3H6Q A;  9ILB A;  1R8O A;  3BAG A;  2BEB A;  5EG6 C;  4J2Y A;  1VCL A;  3H6S E;  2NTD A;  2E4M A;  4I4Y A;  4EB2 B;  2K8R A;  4JQ0 A;  1FMZ A;  5F8Y A;  4GP0 A;  2IWT B;  1TIE A;  4LO3 A;  4KBB A;  2GO2 A;  1L2H A;  3P6I A;  5FNX A;  3AJ6 A;  4GOY A;  4AN6 A;  2ZQO A;  4Q91 A;  4P0K A;  3AKF A;  4LO0 C;  5JLV A;  3IM7 A;  1G9C A;  3P53 A;  3WIN C;  4I4O A;  4D0T A;  3FJH A;  5B2H A;  1IRA X;  3FJK A;  4DEN A;  3FGM A; 
#chains in the Genus database with same CATH topology
 1HWP B;  4J2K A;  1BFF A;  1SZ6 B;  1OQL B;  2RST A;  1II4 A;  2D24 A;  4UY4 A;  5BP5 C;  1XHB A;  3WMU A;  1TP0 A;  3VT2 A;  3PG0 A;  4I4S A;  1XZZ A;  3BAU A;  3QYD A;  1J0S A;  3VT0 A;  2Q3N B;  2KI6 B;  2F2F A;  4I2S A;  1G9B A;  4JP0 A;  2VXT I;  1DZC A;  1K5U A;  1F31 A;  3F1R A;  3BA5 A;  1RG8 A;  3IM5 A;  1YBI A;  3O4A A;  3WA1 A;  3CQA A;  21BI A;  5HPZ A;  2E4M C;  5EC5 A;  3AKI A;  4MZF B;  2FDB M;  4GOV A;  5E24 E;  1DQO A;  4DCK C;  3IM6 A;  4KEJ A;  3SNV A;  4LO3 C;  4ZOT A;  1AVX B;  3CA6 A;  4HA2 A;  2BFH A;  4ZFW B;  4ZBV B;  1PC8 B;  5BXR A;  3VEQ A;  3A21 A;  1DJS B;  1S0D A;  1ISV A;  2NZ9 A;  4G6J A;  2D20 A;  4QC4 A;  1ISX A;  4I6I A;  2QYI B;  4L4I A;  2BEA A;  4Q9P A;  1HIB A;  3H6R B;  1JT7 A;  2VXR A;  3VSZ A;  1CVS A;  1FMM S;  1V6V A;  1JLY A;  4I8M A;  1PUU B;  4I1E A;  4F83 A;  1DQG A;  1MD6 A;  3CA0 A;  3IIR A;  1DZD A;  1SR4 C;  1JTC A;  2AAI B;  2Q9X A;  2DRY A;  3LLP A;  3AH4 A;  3FJ9 A;  2K4A B;  1T9F A;  1TWE A;  4ZFY B;  4IZE A;  3UJ4 A;  4JKQ A;  3WIN A;  2ZQN A;  4I4P A;  1IJT A;  2MLL B;  3B9U A;  3BAO A;  3H6R A;  1K5V A;  1Q1U A;  2DRZ A;  4LO7 C;  4JRA A;  4XKI A;  5BP5 A;  3V79 C;  1S0G A;  3HOM A;  3O4O A;  1BFB A;  1QXM A;  2Y9G A;  2VSA A;  2Y9F A;  3UDA A;  3FJC A;  4J23 B;  2AFG A;  4JAW A;  3ZXD A;  1IOB A;  3BA4 A;  3OBR A;  3BAD A;  1G82 A;  3HMY A;  1GGP B;  4LO2 C;  2MIB A;  4USO A;  4EFR A;  3CA3 A;  3NBD A;  3OJV A;  2AXM A;  4FVV A;  4H04 A;  1AVU A;  1Z2V A;  5JMC A;  4OEF A;  3FUO A;  3MPP G;  1JLX A;  3O49 A;  3I2A A;  1I1E A;  1QQL A;  4IZX A;  3UD8 A;  1AVW B;  3ZC8 A;  3CRI A;  1NUN A;  4END A;  5BQU A;  3HBW A;  1PUM B;  4I0Y A;  2D22 A;  3ZXG A;  1FQ9 A;  1DFQ A;  3NBE A;  4GAF A;  1YF8 B;  3AKH A;  5BOW A;  3ZC9 A;  5D63 A;  3BTA A;  2QN4 A;  1TOO A;  1BLD A;  1TFM B;  3NBN A;  1AF9 A;  3CA5 A;  4LO7 B;  4XFU A;  6I1B A;  4G6M A;  3UD9 A;  4QD2 B;  3D7W B;  1FV2 A;  3CRG A;  2HWA A;  3VT1 A;  1ABR B;  3FJF A;  2ESU A;  1SR4 A;  4I4Q A;  4H9W A;  4EFP A;  2HZ9 A;  1Q04 A;  3VSF A;  4XFT A;  3TC2 A;  3FJD A;  4KEK A;  3RTI B;  4OUJ A;  1DFC A;  3O4D A;  3O44 A;  1BAS A;  4JPZ A;  2NYY A;  4IHZ A;  2KH2 A;  2HW9 A;  2D1Z A;  3Q7Y A;  1I1B A;  3OGF A;  5FNW A;  1S0L A;  3RMX A;  5FZZ A;  2I1B A;  3N7M A;  2ET2 A;  3NBC A;  5BQU C;  3QR5 A;  4X37 A;  1YTO A;  4I4U A;  4II0 A;  1BA7 A;  4Q9G A;  4ZA3 B;  3AZV A;  4LO8 B;  3A22 A;  3R4U A;  4WBC A;  3O4C A;  4LO2 A;  2DS0 A;  2KLL A;  1PWA A;  5F8W A;  5G00 A;  1ISW A;  1V6U A;  4I1B A;  2HWM A;  1RML A;  2X2S A;  2NS2 A;  1A8D A;  1BLA A;  3FJE A;  4G9N A;  5FZU A;  1KNM A;  1Z0H A;  4ZGR B;  4I37 A;  2NP0 A;  2M49 A;  2FFU A;  31BI A;  3CU1 B;  2YUG A;  5GAQ A;  1ISZ A;  3VWC A;  3WO3 A;  2Z48 A;  2Z49 A;  1S0E A;  3PHZ A;  3FJI A;  2GZB A;  3CA1 A;  3N7K A;  1T4Q A;  3P6J A;  3AH1 A;  3AJ5 A;  5BXP A;  1BFC A;  3FJJ A;  4OWL A;  1HCD A;  4QD2 C;  1YXW A;  3BRF A;  5BVP I;  4QAL A;  1NZK A;  4D8H A;  1TTU A;  4G9M A;  1WBC A;  4I3N A;  3W9T A;  1IHK A;  2MC2 A;  4USP A;  1ILR 1;  4Z8S B;  1R8N A;  1HWM B;  4Z9W B;  4J2X A;  2DRE A;  1M2T B;  1AXM A;  3A23 A;  4R6U B;  1N4K A;  3VUO A;  4JKX B;  1HCE A;  3V0A B;  2NM1 A;  2KKI A;  3AKG A;  4X39 A;  1Z4S A;  1M16 A;  1ONK B;  5F90 A;  5DZU A;  1ITB A;  2WRY A;  1EVT A;  1DIW A;  4ZFU B;  2RG9 B;  2VUA A;  3BX1 C;  4IY9 A;  3BAQ A;  3ZX7 A;  3WMV A;  5DUY A;  3RTJ B;  1JY0 A;  2FFV A;  4I7I A;  3E8L C;  3OBT A;  2P39 A;  3OGG A;  3CA4 A;  3S8K A;  3BAV A;  2D44 A;  4A7Z A;  8I1B A;  3FJ8 A;  4OEE A;  4QO3 A;  3T8S A;  5BXT A;  1EYL A;  3V0A A;  1JT5 A;  3FJA A;  3BRD A;  1TWM A;  3WO2 A;  1V6X A;  2VSE A;  3LTQ A;  3PUB A;  5D62 A;  3OJ2 A;  4ZKT B;  5BXS A;  1E0O A;  2K43 A;  1S0C A;  3BAH A;  4ISR A;  4EFQ A;  4ISQ A;  41BI A;  1BFG A;  4EEE B;  1AVA C;  3V0B B;  3BRG C;  2UUS A;  1EV2 A;  2D7R A;  4FGF A;  4QBV A;  4DEP A;  1WD4 A;  3A07 A;  4IYB A;  4ZLB B;  3UD7 A;  3RMY A;  3N0K A;  3N7L A;  2LIQ A;  4CJM A;  4GAI A;  2J3P A;  3FFZ A;  1WD3 A;  1V6W A;  1D0H A;  2D43 A;  1WBA A;  3MAL A;  3WO4 A;  3FUQ A;  4H75 A;  3F62 B;  3IAG C;  2VLC A;  4LO1 C;  3KMV A;  4I4V A;  4HJJ A;  4G1R A;  2RQ9 A;  1UPS A;  2D23 A;  4OWK A;  4X38 A;  4OEG A;  3V0B A;  4IQP A;  4KEI A;  2IHO A;  4IY8 A;  4P6A A;  1W3A A;  2AQZ A;  4TLP A;  2Y9X E;  3CRH A;  4J2S A;  1HWO B;  4I96 A;  2KI4 A;  4ION A;  1G9D A;  3PME A;  1CE7 B;  3BB2 A;  2NVH A;  2D7I A;  1IRP A;  4OW4 A;  4X3A A;  3OJM A;  7I1B A;  1P63 A;  2VU9 A;  1FWU A;  1W3G A;  4MZH A;  2LIE A;  2FO1 A;  3RSJ A;  4QBC A;  3HSM A;  1BAR A;  3HN1 A;  4I4X A;  4I4R A;  1PZZ A;  2X2T A;  4L4H A;  1IT0 A;  2ZR1 B;  3AZW A;  3CAH A;  4KC3 A;  1JQZ A;  4F34 A;  3C9Z A;  4GP3 A;  4P0J A;  1YYN A;  2Y9W C;  4D0Z A;  2P23 A;  2FGF A;  2F8X C;  3NJ5 A;  1FV3 A;  1ISY A;  3R4S A;  1XG6 A;  3EF2 A;  1FWV A;  2R9K B;  3JRR A;  1W3F A;  4EKX B;  5I1B A;  4OWJ A;  4YOL A;  5DSS B;  3O5W B;  1JT3 A;  2F2F C;  3N7J A;  3O4B A;  3K1X A;  5FZY A;  4LO0 A;  3S8J A;  2XOA A;  3POK A;  1RZO B;  1HKN A;  1S0B A;  4PC4 A;  1FN0 A;  3Q7W A;  1MC9 A;  4QKR A;  3AH2 A;  1EPW A;  1IIL A;  1JT4 A;  3O3Q A;  3FJB A;  4A7K A;  1Q03 A;  1FGA A;  4QKS A;  1S0F A;  1RY7 A;  4MZG B;  2WBC A;  1G9A A;  3UJ0 A;  4HR6 C;  4A7Y A;  2L5X A;  1DLL A;  1AFC A;  3BA7 A;  5DVH A;  3JUT A;  2ERM A;  3Q7X A;  4XFS A;  1QQK A;  4LO1 A;  1XYF A;  3HAL A;  4AN7 B;  1HWN B;  4P0L A;  5EHA A;  5D61 A;  3I2X A;  3I29 B;  3ILA A;  5F8S A;  3H6Q A;  9ILB A;  1R8O A;  3BAG A;  2BEB A;  5EG6 C;  4J2Y A;  1VCL A;  3H6S E;  2NTD A;  2E4M A;  4I4Y A;  4EB2 B;  2K8R A;  4JQ0 A;  1FMZ A;  5F8Y A;  4GP0 A;  2IWT B;  1TIE A;  4LO3 A;  4KBB A;  2GO2 A;  1L2H A;  3P6I A;  5FNX A;  3AJ6 A;  4GOY A;  4AN6 A;  2ZQO A;  4Q91 A;  4P0K A;  3AKF A;  4LO0 C;  5JLV A;  3IM7 A;  1G9C A;  3P53 A;  3WIN C;  4I4O A;  4D0T A;  3FJH A;  5B2H A;  1IRA X;  3FJK A;  4DEN A;  3FGM A; 
#chains in the Genus database with same CATH homology
 1HWP B;  4J2K A;  1BFF A;  1SZ6 B;  1OQL B;  2RST A;  1II4 A;  2D24 A;  4UY4 A;  5BP5 C;  1XHB A;  3WMU A;  1TP0 A;  3VT2 A;  3PG0 A;  4I4S A;  1XZZ A;  3BAU A;  3QYD A;  1J0S A;  3VT0 A;  2Q3N B;  2KI6 B;  2F2F A;  4I2S A;  1G9B A;  4JP0 A;  2VXT I;  1DZC A;  1K5U A;  1F31 A;  3F1R A;  3BA5 A;  1RG8 A;  3IM5 A;  1YBI A;  3O4A A;  3WA1 A;  3CQA A;  21BI A;  5HPZ A;  2E4M C;  5EC5 A;  3AKI A;  4MZF B;  2FDB M;  4GOV A;  5E24 E;  1DQO A;  4DCK C;  3IM6 A;  4KEJ A;  3SNV A;  4LO3 C;  4ZOT A;  1AVX B;  3CA6 A;  4HA2 A;  2BFH A;  4ZFW B;  4ZBV B;  1PC8 B;  5BXR A;  3VEQ A;  3A21 A;  1DJS B;  1S0D A;  1ISV A;  2NZ9 A;  4G6J A;  2D20 A;  4QC4 A;  1ISX A;  4I6I A;  2QYI B;  4L4I A;  2BEA A;  4Q9P A;  1HIB A;  3H6R B;  1JT7 A;  2VXR A;  3VSZ A;  1CVS A;  1FMM S;  1V6V A;  1JLY A;  4I8M A;  1PUU B;  4I1E A;  4F83 A;  1DQG A;  1MD6 A;  3CA0 A;  3IIR A;  1DZD A;  1SR4 C;  1JTC A;  2AAI B;  2Q9X A;  2DRY A;  3LLP A;  3AH4 A;  3FJ9 A;  2K4A B;  1T9F A;  1TWE A;  4ZFY B;  4IZE A;  3UJ4 A;  4JKQ A;  3WIN A;  2ZQN A;  4I4P A;  1IJT A;  2MLL B;  3B9U A;  3BAO A;  3H6R A;  1K5V A;  1Q1U A;  2DRZ A;  4LO7 C;  4JRA A;  4XKI A;  5BP5 A;  3V79 C;  1S0G A;  3HOM A;  3O4O A;  1BFB A;  1QXM A;  2Y9G A;  2VSA A;  2Y9F A;  3UDA A;  3FJC A;  4J23 B;  2AFG A;  4JAW A;  3ZXD A;  1IOB A;  3BA4 A;  3OBR A;  3BAD A;  1G82 A;  3HMY A;  1GGP B;  4LO2 C;  2MIB A;  4USO A;  4EFR A;  3CA3 A;  3NBD A;  3OJV A;  2AXM A;  4FVV A;  4H04 A;  1AVU A;  1Z2V A;  5JMC A;  4OEF A;  3FUO A;  3MPP G;  1JLX A;  3O49 A;  3I2A A;  1I1E A;  1QQL A;  4IZX A;  3UD8 A;  1AVW B;  3ZC8 A;  3CRI A;  1NUN A;  4END A;  5BQU A;  3HBW A;  1PUM B;  4I0Y A;  2D22 A;  3ZXG A;  1FQ9 A;  1DFQ A;  3NBE A;  4GAF A;  1YF8 B;  3AKH A;  5BOW A;  3ZC9 A;  5D63 A;  3BTA A;  2QN4 A;  1TOO A;  1BLD A;  1TFM B;  3NBN A;  1AF9 A;  3CA5 A;  4LO7 B;  4XFU A;  6I1B A;  4G6M A;  3UD9 A;  4QD2 B;  3D7W B;  1FV2 A;  3CRG A;  2HWA A;  3VT1 A;  1ABR B;  3FJF A;  2ESU A;  1SR4 A;  4I4Q A;  4H9W A;  4EFP A;  2HZ9 A;  1Q04 A;  3VSF A;  4XFT A;  3TC2 A;  3FJD A;  4KEK A;  3RTI B;  4OUJ A;  1DFC A;  3O4D A;  3O44 A;  1BAS A;  4JPZ A;  2NYY A;  4IHZ A;  2KH2 A;  2HW9 A;  2D1Z A;  3Q7Y A;  1I1B A;  3OGF A;  5FNW A;  1S0L A;  3RMX A;  5FZZ A;  2I1B A;  3N7M A;  2ET2 A;  3NBC A;  5BQU C;  3QR5 A;  4X37 A;  1YTO A;  4I4U A;  4II0 A;  1BA7 A;  4Q9G A;  4ZA3 B;  3AZV A;  4LO8 B;  3A22 A;  3R4U A;  4WBC A;  3O4C A;  4LO2 A;  2DS0 A;  2KLL A;  1PWA A;  5F8W A;  5G00 A;  1ISW A;  1V6U A;  4I1B A;  2HWM A;  1RML A;  2X2S A;  2NS2 A;  1A8D A;  1BLA A;  3FJE A;  4G9N A;  5FZU A;  1KNM A;  1Z0H A;  4ZGR B;  4I37 A;  2NP0 A;  2M49 A;  2FFU A;  31BI A;  3CU1 B;  2YUG A;  5GAQ A;  1ISZ A;  3VWC A;  3WO3 A;  2Z48 A;  2Z49 A;  1S0E A;  3PHZ A;  3FJI A;  2GZB A;  3CA1 A;  3N7K A;  1T4Q A;  3P6J A;  3AH1 A;  3AJ5 A;  5BXP A;  1BFC A;  3FJJ A;  4OWL A;  1HCD A;  4QD2 C;  1YXW A;  3BRF A;  5BVP I;  4QAL A;  1NZK A;  4D8H A;  1TTU A;  4G9M A;  1WBC A;  4I3N A;  3W9T A;  1IHK A;  2MC2 A;  4USP A;  1ILR 1;  4Z8S B;  1R8N A;  1HWM B;  4Z9W B;  4J2X A;  2DRE A;  1M2T B;  1AXM A;  3A23 A;  4R6U B;  1N4K A;  3VUO A;  4JKX B;  1HCE A;  3V0A B;  2NM1 A;  2KKI A;  3AKG A;  4X39 A;  1Z4S A;  1M16 A;  1ONK B;  5F90 A;  5DZU A;  1ITB A;  2WRY A;  1EVT A;  1DIW A;  4ZFU B;  2RG9 B;  2VUA A;  3BX1 C;  4IY9 A;  3BAQ A;  3ZX7 A;  3WMV A;  5DUY A;  3RTJ B;  1JY0 A;  2FFV A;  4I7I A;  3E8L C;  3OBT A;  2P39 A;  3OGG A;  3CA4 A;  3S8K A;  3BAV A;  2D44 A;  4A7Z A;  8I1B A;  3FJ8 A;  4OEE A;  4QO3 A;  3T8S A;  5BXT A;  1EYL A;  3V0A A;  1JT5 A;  3FJA A;  3BRD A;  1TWM A;  3WO2 A;  1V6X A;  2VSE A;  3LTQ A;  3PUB A;  5D62 A;  3OJ2 A;  4ZKT B;  5BXS A;  1E0O A;  2K43 A;  1S0C A;  3BAH A;  4ISR A;  4EFQ A;  4ISQ A;  41BI A;  1BFG A;  4EEE B;  1AVA C;  3V0B B;  3BRG C;  2UUS A;  1EV2 A;  2D7R A;  4FGF A;  4QBV A;  4DEP A;  1WD4 A;  3A07 A;  4IYB A;  4ZLB B;  3UD7 A;  3RMY A;  3N0K A;  3N7L A;  2LIQ A;  4CJM A;  4GAI A;  2J3P A;  3FFZ A;  1WD3 A;  1V6W A;  1D0H A;  2D43 A;  1WBA A;  3MAL A;  3WO4 A;  3FUQ A;  4H75 A;  3F62 B;  3IAG C;  2VLC A;  4LO1 C;  3KMV A;  4I4V A;  4HJJ A;  4G1R A;  2RQ9 A;  1UPS A;  2D23 A;  4OWK A;  4X38 A;  4OEG A;  3V0B A;  4IQP A;  4KEI A;  2IHO A;  4IY8 A;  4P6A A;  1W3A A;  2AQZ A;  4TLP A;  2Y9X E;  3CRH A;  4J2S A;  1HWO B;  4I96 A;  2KI4 A;  4ION A;  1G9D A;  3PME A;  1CE7 B;  3BB2 A;  2NVH A;  2D7I A;  1IRP A;  4OW4 A;  4X3A A;  3OJM A;  7I1B A;  1P63 A;  2VU9 A;  1FWU A;  1W3G A;  4MZH A;  2LIE A;  2FO1 A;  3RSJ A;  4QBC A;  3HSM A;  1BAR A;  3HN1 A;  4I4X A;  4I4R A;  1PZZ A;  2X2T A;  4L4H A;  1IT0 A;  2ZR1 B;  3AZW A;  3CAH A;  4KC3 A;  1JQZ A;  4F34 A;  3C9Z A;  4GP3 A;  4P0J A;  1YYN A;  2Y9W C;  4D0Z A;  2P23 A;  2FGF A;  2F8X C;  3NJ5 A;  1FV3 A;  1ISY A;  3R4S A;  1XG6 A;  3EF2 A;  1FWV A;  2R9K B;  3JRR A;  1W3F A;  4EKX B;  5I1B A;  4OWJ A;  4YOL A;  5DSS B;  3O5W B;  1JT3 A;  2F2F C;  3N7J A;  3O4B A;  3K1X A;  5FZY A;  4LO0 A;  3S8J A;  2XOA A;  3POK A;  1RZO B;  1HKN A;  1S0B A;  4PC4 A;  1FN0 A;  3Q7W A;  1MC9 A;  4QKR A;  3AH2 A;  1EPW A;  1IIL A;  1JT4 A;  3O3Q A;  3FJB A;  4A7K A;  1Q03 A;  1FGA A;  4QKS A;  1S0F A;  1RY7 A;  4MZG B;  2WBC A;  1G9A A;  3UJ0 A;  4HR6 C;  4A7Y A;  2L5X A;  1DLL A;  1AFC A;  3BA7 A;  5DVH A;  3JUT A;  2ERM A;  3Q7X A;  4XFS A;  1QQK A;  4LO1 A;  1XYF A;  3HAL A;  4AN7 B;  1HWN B;  4P0L A;  5EHA A;  5D61 A;  3I2X A;  3I29 B;  3ILA A;  5F8S A;  3H6Q A;  9ILB A;  1R8O A;  3BAG A;  2BEB A;  5EG6 C;  4J2Y A;  1VCL A;  3H6S E;  2NTD A;  2E4M A;  4I4Y A;  4EB2 B;  2K8R A;  4JQ0 A;  1FMZ A;  5F8Y A;  4GP0 A;  2IWT B;  1TIE A;  4LO3 A;  4KBB A;  2GO2 A;  1L2H A;  3P6I A;  5FNX A;  3AJ6 A;  4GOY A;  4AN6 A;  2ZQO A;  4Q91 A;  4P0K A;  3AKF A;  4LO0 C;  5JLV A;  3IM7 A;  1G9C A;  3P53 A;  3WIN C;  4I4O A;  4D0T A;  3FJH A;  5B2H A;  1IRA X;  3FJK A;  4DEN A;  3FGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...