2ERMA

Solution structure of a biologically active human fgf-1 monomer, complexed to a hexasaccharide heparin-analogue
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
133
structure length
133
Chain Sequence
b'YKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Solution NMR structure of a human FGF-1 monomer, activated by a hexasaccharide heparin-analogue.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2005-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ermA00
2D22A 2NTDA 1CE7B 1L2HA 2KI6B 1Z0HA 3HBWA 1XYFA 3UJ4A 1BLAA 4QKSA 4I4QA 1W3GA 4ZFWB 3ZXGA 2Y9XE 1IOBA 4GAIA 3K1XA 3Q7XA 4EFPA 2HW9A 5BXPA 3FJFA 3CAHA 1PWAA 3FJJA 4OWKA 5F90A 3PG0A 4ISQA 4IY8A 3WO2A 2DRZA 3S8KA 3RTJB 3BAUA 1TIEA 1JTCA 2E4MC 1I1BA 3B9UA 3I2AA 4I6IA 3O4BA 1V6WA 3VT2A 3UD7A 3E8LC 3CA1A 1I1EA 2P39A 1MD6A 3N7MA 4EEEB 4ZA3B 41BIA 5E24E 1ILR1 4LO1C 1AVUA 3FUQA 3FJ9A 2ZR1B 2R9KB 3OGFA 5JLVA 3FJHA 3Q7YA 4IONA 3AKFA 4G6MA 4G1RA 4TLPA 1HWOB 2VUAA 1G9CA 3C9ZA 3H6RB 4L4HA 1KNMA 2VSAA 4X37A 4I4UA 2VXTI 5F8YA 2VU9A 4FGFA 1XG6A 4II0A 2Q3NB 4I4OA 1UPSA 4H04A 3FJBA 2D20A 5BQUC 3AKIA 4LO8B 1TP0A 3UJ0A 1QQLA 1WBCA 3N7JA 3FJKA 3HMYA 3VSFA 3WMUA 4X3AA 5DVHA 2Y9WC 4EFQA 3W9TA 3MALA 1HCDA 4OEFA 1DLLA 4GAFA 5BXSA 5BXTA 4FVVA 3V79C 3O4DA 4ISRA 3WA1A 4J2KA 1MC9A 2E4MA 2Z49A 4YOLA 2K4AB 1K5UA 2HZ9A 2WBCA 2FDBM 1TOOA 4OWJA 4ENDA 3N7LA 3CA6A 4GP0A 5F8SA 1WBAA 4IY9A 3V0AA 2KKIA 1J0SA 1S0GA 1FV2A 3FJAA 1P63A 1DFCA 1DQGA 4XKIA 1PZZA 1IRAX 1QQKA 4QO3A 2Q9XA 3BAHA 4I3NA 4LO0A 4HA2A 4OWLA 5FZZA 2FFUA 4QC4A 7I1BA 1HWPB 1DQOA 3NJ5A 2LIQA 3N7KA 1Q04A 3WO3A 1G9BA 4F83A 3PHZA 4I96A 1G82A 2ERMA 4OEEA 4ZBVB 1BFBA 4P0JA 4J2XA 2NZ9A 2D44A 3UDAA 2AQZA 1DIWA 3UD9A 1YTOA 3AH2A 5G00A 4JPZA 3CRIA 1WD4A 1XZZA 2X2TA 1ONKB 1Z4SA 2MIBA 2FGFA 8I1BA 4I37A 1EVTA 1JT7A 4HR6C 1ITBA 4ZFUB 4I1BA 3ILAA 4JP0A 3BA7A 3VSZA 1CVSA 1G9AA 3O4AA 2NYYA 4JKQA 4A7YA 5FZUA 4XFTA 1AFCA 5EC5A 2UUSA 4I4SA 3V0AB 1S0LA 3CU1B 3OJMA 1S0BA 2NM1A 1V6XA 3H6QA 1FWVA 1II4A 4ZFYB 3BRFA 3F1RA 2AXMA 3ZX7A 4G6JA 4Q91A 1DZCA 5F8WA 1XHBA 4USOA 3BAVA 3T8SA 2F2FA 3JUTA 4D8HA 3HN1A 2M49A 1ISYA 3HALA 3F62B 4LO0C 3UD8A 3FGMA 1T9FA 4Q9GA 4JQ0A 1BASA 4LO2C 4QD2C 2ZQNA 1NUNA 2AFGA 5JMCA 4F34A 5D62A 3CRGA 3OJ2A 1D0HA 4Z8SB 3BAOA 3Q7WA 2RSTA 1EYLA 2IWTB 6I1BA 4DENA 1DJSB 4AN6A 2BEBA 5EHAA 3QYDA 4X38A 4GOYA 4IZEA 4JRAA 4ZLBB 1NZKA 2VXRA 3FJEA 1ISVA 4KEIA 5DSSB 3BA4A 3BRGC 1R8OA 2D7RA 2Y9GA 1AVXB 1IJTA 2RQ9A 3V0BA 2IHOA 4QALA 3ZC9A 2L5XA 3O5WB 5BP5A 2D23A 2D24A 4WBCA 3O4CA 4XFSA 4XFUA 4ZKTB 1FWUA 1HCEA 3JRRA 5FZYA 2AAIB 1BFGA 1BFCA 2KI4A 1W3AA 3WMVA 3BAGA 3AJ6A 3P6IA 3BB2A 1JLYA 4J23B 4KEJA 2Z48A 2MLLB 3EF2A 2NVHA 4I4YA 5D61A 3VT1A 2ET2A 3O4OA 5DZUA 1WD3A 4I1EA 4KC3A 5GAQA 3HSMA 2QYIB 2F8XC 2NP0A 5FNXA 4ZOTA 1K5VA 4LO2A 1PC8B 1E0OA 3ZXDA 1A8DA 2F2FC 4H9WA 3OJVA 1S0EA 1F31A 3IM6A 3POKA 5DUYA 3RTIB 2FO1A 4A7ZA 3FJCA 2KH2A 3CA3A 2RG9B 3AZWA 1BA7A 2BFHA 1EPWA 3QR5A 4KBBA 1TFMB 3FUOA 3VUOA 3P53A 3I2XA 2BEAA 1SR4A 4I4PA 4PC4A 4IYBA 5BOWA 1S0DA 3BADA 1V6VA 4G9NA 1FMMS 1OQLB 3H6SE 1PUUB 5D63A 1N4KA 3IIRA 4ZGRB 1IHKA 1RG8A 2D7IA 3IM7A 2J3PA 3OGGA 3PMEA 3A22A 1JLXA 4D0ZA 1FQ9A 4HJJA 3H6RA 4DEPA 2K8RA 1ISWA 2P23A 3AZVA 2DREA 4AN7B 4J2SA 4L4IA 3FFZA 5BP5C 4I8MA 4P0KA 2K43A 3D7WB 1ISZA 3O3QA 1ISXA 3R4SA 3WINA 4LO7B 1S0CA 1FGAA 2VLCA 3CA4A 3MPPG 1YXWA 2KLLA 3OBTA 1YYNA 1IILA 4GOVA 3RMYA 3FJIA 3O49A 4QD2B 4IHZA 2DRYA 3BA5A 3CRHA 4EB2B 1G9DA 1BLDA 1FV3A 1IRPA 4J2YA 1EV2A 4LO7C 2FFVA 5FNWA 31BIA 1HWMB 2DS0A 3PUBA 5HPZA 3BAQA 3BX1C 4I0YA 3VWCA 3A07A 1JY0A 3LLPA 2D43A 1HWNB 1JT3A 1Q03A 3VEQA 3IM5A 1M16A 4OEGA 3BTAA 2HWAA 2XOAA 1S0FA 4I7IA 4CJMA 4OW4A 2ZQOA 1Z2VA 4P0LA 4OUJA 3WO4A 1Q1UA 1T4QA 3FJDA 4GP3A 1AVWB 4I2SA 2X2SA 3VT0A 1FMZA 1DFQA 4LO3A 2Y9FA 1SR4C 4KEKA 3BRDA 3A21A 3ZC8A 9ILBA 4EFRA 2GZBA 3AJ5A 1VCLA 1FN0A 4I4XA 1TWEA 1DZDA 1HKNA 1W3FA 3NBNA 4Z9WB 3RMXA 2QN4A 3KMVA 3TC2A 1YBIA 4R6UB 1TTUA 1AF9A 4IQPA 1YF8B 3SNVA 1RZOB 1R8NA 3HOMA 4JAWA 3IAGC 4Q9PA 5I1BA 3LTQA 3NBEA 3WINC 4IZXA 3O44A 4QKRA 2ESUA 3AH4A 1IT0A 3P6JA 1M2TB 2HWMA 2LIEA 3AKHA 1V6UA 1SZ6B 3CQAA 4LO1A 1JT5A 1ABRB 5EG6C 4I4VA 2YUGA 4JKXB 1TWMA 4I4RA 1BARA 3AKGA 3AH1A 5BVPI 4A7KA 4P6AA 3NBCA 4QBVA 1PUMB 4QBCA 5B2HA 4X39A 1JT4A 3A23A 1RY7A 2VSEA 4USPA 3S8JA 4DCKC 3R4UA 3V0BB 1RMLA 2I1BA 2D1ZA 3OBRA 3RSJA 4G9MA 1HIBA 2MC2A 3CA5A 5BXRA 1BFFA 3FJ8A 3I29B 3N0KA 5BQUA 4EKXB 4LO3C 4D0TA 2WRYA 1AVAC 3CA0A 1GGPB 1QXMA 3NBDA 1AXMA 1JQZA 21BIA 2GO2A
chains in the Genus database with same CATH superfamily
2D22A 2NTDA 1CE7B 1L2HA 2KI6B 1Z0HA 3HBWA 1XYFA 3UJ4A 1BLAA 4QKSA 4I4QA 1W3GA 4ZFWB 3ZXGA 2Y9XE 1IOBA 4GAIA 3K1XA 3Q7XA 4EFPA 2HW9A 5BXPA 3FJFA 3CAHA 1PWAA 3FJJA 4OWKA 5F90A 3PG0A 4ISQA 4IY8A 3WO2A 2DRZA 3S8KA 3RTJB 3BAUA 1TIEA 1JTCA 2E4MC 1I1BA 3B9UA 3I2AA 4I6IA 3O4BA 1V6WA 3VT2A 3UD7A 3E8LC 3CA1A 1I1EA 2P39A 1MD6A 3N7MA 4EEEB 4ZA3B 41BIA 5E24E 1ILR1 4LO1C 1AVUA 3FUQA 3FJ9A 2ZR1B 2R9KB 3OGFA 5JLVA 3FJHA 3Q7YA 4IONA 3AKFA 4G6MA 4G1RA 4TLPA 1HWOB 2VUAA 1G9CA 3C9ZA 3H6RB 4L4HA 1KNMA 2VSAA 4X37A 4I4UA 2VXTI 5F8YA 2VU9A 4FGFA 1XG6A 4II0A 2Q3NB 4I4OA 1UPSA 4H04A 3FJBA 2D20A 5BQUC 3AKIA 4LO8B 1TP0A 3UJ0A 1QQLA 1WBCA 3N7JA 3FJKA 3HMYA 3VSFA 3WMUA 4X3AA 5DVHA 2Y9WC 4EFQA 3W9TA 3MALA 1HCDA 4OEFA 1DLLA 4GAFA 5BXSA 5BXTA 4FVVA 3V79C 3O4DA 4ISRA 3WA1A 4J2KA 1MC9A 2E4MA 2Z49A 4YOLA 2K4AB 1K5UA 2HZ9A 2WBCA 2FDBM 1TOOA 4OWJA 4ENDA 4UY4A 3N7LA 3CA6A 4GP0A 5F8SA 1WBAA 4IY9A 3V0AA 2KKIA 1J0SA 1S0GA 1FV2A 3FJAA 1P63A 1DFCA 1DQGA 4XKIA 1PZZA 1IRAX 1QQKA 4QO3A 2Q9XA 3BAHA 4I3NA 4LO0A 4HA2A 4OWLA 5FZZA 2FFUA 4QC4A 7I1BA 1HWPB 1DQOA 3NJ5A 2LIQA 3N7KA 1Q04A 3WO3A 1G9BA 4F83A 3PHZA 4I96A 1G82A 2ERMA 4OEEA 4ZBVB 1BFBA 4P0JA 4J2XA 2NZ9A 2D44A 3UDAA 2AQZA 1DIWA 3UD9A 1YTOA 3AH2A 5G00A 4JPZA 3CRIA 1WD4A 1XZZA 2X2TA 1ONKB 1Z4SA 2MIBA 2FGFA 8I1BA 4I37A 1EVTA 1JT7A 4HR6C 1ITBA 4ZFUB 4I1BA 3ILAA 4JP0A 3BA7A 3VSZA 1CVSA 1G9AA 3O4AA 2NYYA 4JKQA 4A7YA 5FZUA 4XFTA 1AFCA 5EC5A 2UUSA 4I4SA 3V0AB 1S0LA 3CU1B 3OJMA 1S0BA 2NM1A 1V6XA 3H6QA 1FWVA 1II4A 4ZFYB 3BRFA 3F1RA 2AXMA 3ZX7A 4G6JA 4Q91A 1DZCA 5F8WA 1XHBA 4USOA 3BAVA 3T8SA 2F2FA 3JUTA 4D8HA 3HN1A 2M49A 1ISYA 3HALA 3F62B 4LO0C 3UD8A 3FGMA 1T9FA 4Q9GA 4JQ0A 1BASA 4LO2C 4MZHA 4QD2C 2ZQNA 1NUNA 2AFGA 5JMCA 4F34A 5D62A 3CRGA 3OJ2A 1D0HA 4Z8SB 3BAOA 3Q7WA 2RSTA 1EYLA 2IWTB 6I1BA 4DENA 1DJSB 4AN6A 2BEBA 5EHAA 3QYDA 4X38A 4GOYA 4IZEA 4JRAA 4ZLBB 1NZKA 2VXRA 3FJEA 1ISVA 4KEIA 5DSSB 3BA4A 3BRGC 1R8OA 2D7RA 2Y9GA 1AVXB 1IJTA 2RQ9A 3V0BA 2IHOA 4QALA 3ZC9A 2L5XA 3O5WB 5BP5A 2D23A 2D24A 4WBCA 3O4CA 4XFSA 4XFUA 4ZKTB 1FWUA 1HCEA 3JRRA 5FZYA 2AAIB 1BFGA 1BFCA 2KI4A 1W3AA 3WMVA 3BAGA 3AJ6A 3P6IA 3BB2A 1JLYA 4J23B 4KEJA 2Z48A 2MLLB 3EF2A 2NVHA 4I4YA 5D61A 3VT1A 2ET2A 3O4OA 5DZUA 1WD3A 4I1EA 4KC3A 5GAQA 3HSMA 2QYIB 2F8XC 2NP0A 5FNXA 4ZOTA 1K5VA 4LO2A 1PC8B 1E0OA 3ZXDA 1A8DA 2F2FC 4H9WA 3OJVA 1S0EA 1F31A 3IM6A 3POKA 5DUYA 3RTIB 2FO1A 4A7ZA 3FJCA 2KH2A 3CA3A 2RG9B 3AZWA 1BA7A 2BFHA 1EPWA 3QR5A 4KBBA 1TFMB 3FUOA 3VUOA 3P53A 3I2XA 2BEAA 1SR4A 4I4PA 4PC4A 4IYBA 5BOWA 1S0DA 3BADA 1V6VA 4G9NA 1FMMS 1OQLB 3H6SE 1PUUB 5D63A 1N4KA 3IIRA 4ZGRB 1IHKA 1RG8A 2D7IA 3IM7A 2J3PA 3OGGA 3PMEA 3A22A 1JLXA 4D0ZA 1FQ9A 4HJJA 3H6RA 4DEPA 2K8RA 1ISWA 2P23A 3AZVA 2DREA 4AN7B 4J2SA 4L4IA 3FFZA 5BP5C 4I8MA 4P0KA 2K43A 3D7WB 1ISZA 3O3QA 1ISXA 3R4SA 3WINA 4LO7B 1S0CA 1FGAA 2VLCA 3CA4A 3MPPG 1YXWA 2KLLA 3OBTA 1YYNA 1IILA 4GOVA 3RMYA 3FJIA 3O49A 4QD2B 4IHZA 2DRYA 3BA5A 3CRHA 4EB2B 1G9DA 1BLDA 1FV3A 1IRPA 4J2YA 1EV2A 4LO7C 2FFVA 5FNWA 31BIA 1HWMB 2DS0A 3PUBA 4MZFB 5HPZA 3BAQA 3BX1C 4I0YA 3VWCA 3A07A 1JY0A 3LLPA 2D43A 1HWNB 1JT3A 1Q03A 3VEQA 3IM5A 1M16A 4OEGA 3BTAA 2HWAA 2XOAA 1S0FA 4I7IA 4CJMA 4OW4A 2ZQOA 1Z2VA 4P0LA 4OUJA 3WO4A 1Q1UA 1T4QA 3FJDA 4GP3A 1AVWB 4I2SA 2X2SA 3VT0A 1FMZA 1DFQA 4LO3A 2Y9FA 1SR4C 4KEKA 3BRDA 3A21A 3ZC8A 9ILBA 4EFRA 2GZBA 3AJ5A 1VCLA 1FN0A 4I4XA 1TWEA 1DZDA 1HKNA 1W3FA 3NBNA 4Z9WB 3RMXA 2QN4A 3KMVA 3TC2A 1YBIA 4R6UB 1TTUA 1AF9A 4IQPA 1YF8B 3SNVA 1RZOB 1R8NA 3HOMA 4JAWA 3IAGC 4Q9PA 5I1BA 3LTQA 3NBEA 3WINC 4IZXA 3O44A 4QKRA 2ESUA 3AH4A 1IT0A 3P6JA 1M2TB 2HWMA 2LIEA 3AKHA 1V6UA 1SZ6B 3CQAA 4LO1A 1JT5A 4MZGB 1ABRB 5EG6C 4I4VA 2YUGA 4JKXB 4H75A 1TWMA 4I4RA 1BARA 3AKGA 3AH1A 5BVPI 4A7KA 2NS2A 4P6AA 3NBCA 4QBVA 1PUMB 4QBCA 5B2HA 4X39A 1JT4A 3A23A 1RY7A 2VSEA 4USPA 3S8JA 4DCKC 3R4UA 3V0BB 1RMLA 2I1BA 2D1ZA 3OBRA 3RSJA 4G9MA 1HIBA 2MC2A 3CA5A 5BXRA 1BFFA 3FJ8A 3I29B 3N0KA 5BQUA 4EKXB 4LO3C 4D0TA 2WRYA 1AVAC 3CA0A 1GGPB 1QXMA 3NBDA 1AXMA 1JQZA 21BIA 2GO2A
chains in the Genus database with same CATH topology
2D22A 2NTDA 1CE7B 1L2HA 2KI6B 1Z0HA 3HBWA 1XYFA 3UJ4A 1BLAA 4QKSA 4I4QA 1W3GA 4ZFWB 3ZXGA 2Y9XE 1IOBA 4GAIA 3K1XA 3Q7XA 4EFPA 2HW9A 5BXPA 3FJFA 3CAHA 1PWAA 3FJJA 4OWKA 5F90A 3PG0A 4ISQA 4IY8A 3WO2A 2DRZA 3S8KA 3RTJB 3BAUA 1TIEA 1JTCA 2E4MC 1I1BA 3B9UA 3I2AA 4I6IA 3O4BA 1V6WA 3VT2A 3UD7A 3E8LC 3CA1A 1I1EA 2P39A 1MD6A 3N7MA 4EEEB 4ZA3B 41BIA 5E24E 1ILR1 4LO1C 1AVUA 3FUQA 3FJ9A 2ZR1B 2R9KB 3OGFA 5JLVA 3FJHA 3Q7YA 4IONA 3AKFA 4G6MA 4G1RA 4TLPA 1HWOB 2VUAA 1G9CA 3C9ZA 3H6RB 4L4HA 1KNMA 2VSAA 4X37A 4I4UA 2VXTI 5F8YA 2VU9A 4FGFA 1XG6A 4II0A 2Q3NB 4I4OA 1UPSA 4H04A 3FJBA 2D20A 5BQUC 3AKIA 4LO8B 1TP0A 3UJ0A 1QQLA 1WBCA 3N7JA 3FJKA 3HMYA 3VSFA 3WMUA 4X3AA 5DVHA 2Y9WC 4EFQA 3W9TA 3MALA 1HCDA 4OEFA 1DLLA 4GAFA 5BXSA 5BXTA 4FVVA 3V79C 3O4DA 4ISRA 3WA1A 4J2KA 1MC9A 2E4MA 2Z49A 4YOLA 2K4AB 1K5UA 2HZ9A 2WBCA 2FDBM 1TOOA 4OWJA 4ENDA 4UY4A 3N7LA 3CA6A 4GP0A 5F8SA 1WBAA 4IY9A 3V0AA 2KKIA 1J0SA 1S0GA 1FV2A 3FJAA 1P63A 1DFCA 1DQGA 4XKIA 1PZZA 1IRAX 1QQKA 4QO3A 2Q9XA 3BAHA 4I3NA 4LO0A 4HA2A 4OWLA 5FZZA 2FFUA 4QC4A 7I1BA 1HWPB 1DQOA 3NJ5A 2LIQA 3N7KA 1Q04A 3WO3A 1G9BA 4F83A 3PHZA 4I96A 1G82A 2ERMA 4OEEA 4ZBVB 1BFBA 4P0JA 4J2XA 2NZ9A 2D44A 3UDAA 2AQZA 1DIWA 3UD9A 1YTOA 3AH2A 5G00A 4JPZA 3CRIA 1WD4A 1XZZA 2X2TA 1ONKB 1Z4SA 2MIBA 2FGFA 8I1BA 4I37A 1EVTA 1JT7A 4HR6C 1ITBA 4ZFUB 4I1BA 3ILAA 4JP0A 3BA7A 3VSZA 1CVSA 1G9AA 3O4AA 2NYYA 4JKQA 4A7YA 5FZUA 4XFTA 1AFCA 5EC5A 2UUSA 4I4SA 3V0AB 1S0LA 3CU1B 3OJMA 1S0BA 2NM1A 1V6XA 3H6QA 1FWVA 1II4A 4ZFYB 3BRFA 3F1RA 2AXMA 3ZX7A 4G6JA 4Q91A 1DZCA 5F8WA 1XHBA 4USOA 3BAVA 3T8SA 2F2FA 3JUTA 4D8HA 3HN1A 2M49A 1ISYA 3HALA 3F62B 4LO0C 3UD8A 3FGMA 1T9FA 4Q9GA 4JQ0A 1BASA 4LO2C 4MZHA 4QD2C 2ZQNA 1NUNA 2AFGA 5JMCA 4F34A 5D62A 3CRGA 3OJ2A 1D0HA 4Z8SB 3BAOA 3Q7WA 2RSTA 1EYLA 2IWTB 6I1BA 4DENA 1DJSB 4AN6A 2BEBA 5EHAA 3QYDA 4X38A 4GOYA 4IZEA 4JRAA 4ZLBB 1NZKA 2VXRA 3FJEA 1ISVA 4KEIA 5DSSB 3BA4A 3BRGC 1R8OA 2D7RA 2Y9GA 1AVXB 1IJTA 2RQ9A 3V0BA 2IHOA 4QALA 3ZC9A 2L5XA 3O5WB 5BP5A 2D23A 2D24A 4WBCA 3O4CA 4XFSA 4XFUA 4ZKTB 1FWUA 1HCEA 3JRRA 5FZYA 2AAIB 1BFGA 1BFCA 2KI4A 1W3AA 3WMVA 3BAGA 3AJ6A 3P6IA 3BB2A 1JLYA 4J23B 4KEJA 2Z48A 2MLLB 3EF2A 2NVHA 4I4YA 5D61A 3VT1A 2ET2A 3O4OA 5DZUA 1WD3A 4I1EA 4KC3A 5GAQA 3HSMA 2QYIB 2F8XC 2NP0A 5FNXA 4ZOTA 1K5VA 4LO2A 1PC8B 1E0OA 3ZXDA 1A8DA 2F2FC 4H9WA 3OJVA 1S0EA 1F31A 3IM6A 3POKA 5DUYA 3RTIB 2FO1A 4A7ZA 3FJCA 2KH2A 3CA3A 2RG9B 3AZWA 1BA7A 2BFHA 1EPWA 3QR5A 4KBBA 1TFMB 3FUOA 3VUOA 3P53A 3I2XA 2BEAA 1SR4A 4I4PA 4PC4A 4IYBA 5BOWA 1S0DA 3BADA 1V6VA 4G9NA 1FMMS 1OQLB 3H6SE 1PUUB 5D63A 1N4KA 3IIRA 4ZGRB 1IHKA 1RG8A 2D7IA 3IM7A 2J3PA 3OGGA 3PMEA 3A22A 1JLXA 4D0ZA 1FQ9A 4HJJA 3H6RA 4DEPA 2K8RA 1ISWA 2P23A 3AZVA 2DREA 4AN7B 4J2SA 4L4IA 3FFZA 5BP5C 4I8MA 4P0KA 2K43A 3D7WB 1ISZA 3O3QA 1ISXA 3R4SA 3WINA 4LO7B 1S0CA 1FGAA 2VLCA 3CA4A 3MPPG 1YXWA 2KLLA 3OBTA 1YYNA 1IILA 4GOVA 3RMYA 3FJIA 3O49A 4QD2B 4IHZA 2DRYA 3BA5A 3CRHA 4EB2B 1G9DA 1BLDA 1FV3A 1IRPA 4J2YA 1EV2A 4LO7C 2FFVA 5FNWA 31BIA 1HWMB 2DS0A 3PUBA 4MZFB 5HPZA 3BAQA 3BX1C 4I0YA 3VWCA 3A07A 1JY0A 3LLPA 2D43A 1HWNB 1JT3A 1Q03A 3VEQA 3IM5A 1M16A 4OEGA 3BTAA 2HWAA 2XOAA 1S0FA 4I7IA 4CJMA 4OW4A 2ZQOA 1Z2VA 4P0LA 4OUJA 3WO4A 1Q1UA 1T4QA 3FJDA 4GP3A 1AVWB 4I2SA 2X2SA 3VT0A 1FMZA 1DFQA 4LO3A 2Y9FA 1SR4C 4KEKA 3BRDA 3A21A 3ZC8A 9ILBA 4EFRA 2GZBA 3AJ5A 1VCLA 1FN0A 4I4XA 1TWEA 1DZDA 1HKNA 1W3FA 3NBNA 4Z9WB 3RMXA 2QN4A 3KMVA 3TC2A 1YBIA 4R6UB 1TTUA 1AF9A 4IQPA 1YF8B 3SNVA 1RZOB 1R8NA 3HOMA 4JAWA 3IAGC 4Q9PA 5I1BA 3LTQA 3NBEA 3WINC 4IZXA 3O44A 4QKRA 2ESUA 3AH4A 1IT0A 3P6JA 1M2TB 2HWMA 2LIEA 3AKHA 1V6UA 1SZ6B 3CQAA 4LO1A 1JT5A 4MZGB 1ABRB 5EG6C 4I4VA 2YUGA 4JKXB 4H75A 1TWMA 4I4RA 1BARA 3AKGA 3AH1A 5BVPI 4A7KA 2NS2A 4P6AA 3NBCA 4QBVA 1PUMB 4QBCA 5B2HA 4X39A 1JT4A 3A23A 1RY7A 2VSEA 4USPA 3S8JA 4DCKC 3R4UA 3V0BB 1RMLA 2I1BA 2D1ZA 3OBRA 3RSJA 4G9MA 1HIBA 2MC2A 3CA5A 5BXRA 1BFFA 3FJ8A 3I29B 3N0KA 5BQUA 4EKXB 4LO3C 4D0TA 2WRYA 1AVAC 3CA0A 1GGPB 1QXMA 3NBDA 1AXMA 1JQZA 21BIA 2GO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D22 A;  2NTD A;  1CE7 B;  1L2H A;  2KI6 B;  1Z0H A;  3HBW A;  1XYF A;  3UJ4 A;  1BLA A;  4QKS A;  4I4Q A;  1W3G A;  4ZFW B;  3ZXG A;  2Y9X E;  1IOB A;  4GAI A;  3K1X A;  3Q7X A;  4EFP A;  2HW9 A;  5BXP A;  3FJF A;  3CAH A;  1PWA A;  3FJJ A;  4OWK A;  5F90 A;  3PG0 A;  4ISQ A;  4IY8 A;  3WO2 A;  2DRZ A;  3S8K A;  3RTJ B;  3BAU A;  1TIE A;  1JTC A;  2E4M C;  1I1B A;  3B9U A;  3I2A A;  4I6I A;  3O4B A;  1V6W A;  3VT2 A;  3UD7 A;  3E8L C;  3CA1 A;  1I1E A;  2P39 A;  1MD6 A;  3N7M A;  4EEE B;  4ZA3 B;  41BI A;  5E24 E;  1ILR 1;  4LO1 C;  1AVU A;  3FUQ A;  3FJ9 A;  2ZR1 B;  2R9K B;  3OGF A;  5JLV A;  3FJH A;  3Q7Y A;  4ION A;  3AKF A;  4G6M A;  4G1R A;  4TLP A;  1HWO B;  2VUA A;  1G9C A;  3C9Z A;  3H6R B;  4L4H A;  1KNM A;  2VSA A;  4X37 A;  4I4U A;  2VXT I;  5F8Y A;  2VU9 A;  4FGF A;  1XG6 A;  4II0 A;  2Q3N B;  4I4O A;  1UPS A;  4H04 A;  3FJB A;  2D20 A;  5BQU C;  3AKI A;  4LO8 B;  1TP0 A;  3UJ0 A;  1QQL A;  1WBC A;  3N7J A;  3FJK A;  3HMY A;  3VSF A;  3WMU A;  4X3A A;  5DVH A;  2Y9W C;  4EFQ A;  3W9T A;  3MAL A;  1HCD A;  4OEF A;  1DLL A;  4GAF A;  5BXS A;  5BXT A;  4FVV A;  3V79 C;  3O4D A;  4ISR A;  3WA1 A;  4J2K A;  1MC9 A;  2E4M A;  2Z49 A;  4YOL A;  2K4A B;  1K5U A;  2HZ9 A;  2WBC A;  2FDB M;  1TOO A;  4OWJ A;  4END A;  3N7L A;  3CA6 A;  4GP0 A;  5F8S A;  1WBA A;  4IY9 A;  3V0A A;  2KKI A;  1J0S A;  1S0G A;  1FV2 A;  3FJA A;  1P63 A;  1DFC A;  1DQG A;  4XKI A;  1PZZ A;  1IRA X;  1QQK A;  4QO3 A;  2Q9X A;  3BAH A;  4I3N A;  4LO0 A;  4HA2 A;  4OWL A;  5FZZ A;  2FFU A;  4QC4 A;  7I1B A;  1HWP B;  1DQO A;  3NJ5 A;  2LIQ A;  3N7K A;  1Q04 A;  3WO3 A;  1G9B A;  4F83 A;  3PHZ A;  4I96 A;  1G82 A;  2ERM A;  4OEE A;  4ZBV B;  1BFB A;  4P0J A;  4J2X A;  2NZ9 A;  2D44 A;  3UDA A;  2AQZ A;  1DIW A;  3UD9 A;  1YTO A;  3AH2 A;  5G00 A;  4JPZ A;  3CRI A;  1WD4 A;  1XZZ A;  2X2T A;  1ONK B;  1Z4S A;  2MIB A;  2FGF A;  8I1B A;  4I37 A;  1EVT A;  1JT7 A;  4HR6 C;  1ITB A;  4ZFU B;  4I1B A;  3ILA A;  4JP0 A;  3BA7 A;  3VSZ A;  1CVS A;  1G9A A;  3O4A A;  2NYY A;  4JKQ A;  4A7Y A;  5FZU A;  4XFT A;  1AFC A;  5EC5 A;  2UUS A;  4I4S A;  3V0A B;  1S0L A;  3CU1 B;  3OJM A;  1S0B A;  2NM1 A;  1V6X A;  3H6Q A;  1FWV A;  1II4 A;  4ZFY B;  3BRF A;  3F1R A;  2AXM A;  3ZX7 A;  4G6J A;  4Q91 A;  1DZC A;  5F8W A;  1XHB A;  4USO A;  3BAV A;  3T8S A;  2F2F A;  3JUT A;  4D8H A;  3HN1 A;  2M49 A;  1ISY A;  3HAL A;  3F62 B;  4LO0 C;  3UD8 A;  3FGM A;  1T9F A;  4Q9G A;  4JQ0 A;  1BAS A;  4LO2 C;  4QD2 C;  2ZQN A;  1NUN A;  2AFG A;  5JMC A;  4F34 A;  5D62 A;  3CRG A;  3OJ2 A;  1D0H A;  4Z8S B;  3BAO A;  3Q7W A;  2RST A;  1EYL A;  2IWT B;  6I1B A;  4DEN A;  1DJS B;  4AN6 A;  2BEB A;  5EHA A;  3QYD A;  4X38 A;  4GOY A;  4IZE A;  4JRA A;  4ZLB B;  1NZK A;  2VXR A;  3FJE A;  1ISV A;  4KEI A;  5DSS B;  3BA4 A;  3BRG C;  1R8O A;  2D7R A;  2Y9G A;  1AVX B;  1IJT A;  2RQ9 A;  3V0B A;  2IHO A;  4QAL A;  3ZC9 A;  2L5X A;  3O5W B;  5BP5 A;  2D23 A;  2D24 A;  4WBC A;  3O4C A;  4XFS A;  4XFU A;  4ZKT B;  1FWU A;  1HCE A;  3JRR A;  5FZY A;  2AAI B;  1BFG A;  1BFC A;  2KI4 A;  1W3A A;  3WMV A;  3BAG A;  3AJ6 A;  3P6I A;  3BB2 A;  1JLY A;  4J23 B;  4KEJ A;  2Z48 A;  2MLL B;  3EF2 A;  2NVH A;  4I4Y A;  5D61 A;  3VT1 A;  2ET2 A;  3O4O A;  5DZU A;  1WD3 A;  4I1E A;  4KC3 A;  5GAQ A;  3HSM A;  2QYI B;  2F8X C;  2NP0 A;  5FNX A;  4ZOT A;  1K5V A;  4LO2 A;  1PC8 B;  1E0O A;  3ZXD A;  1A8D A;  2F2F C;  4H9W A;  3OJV A;  1S0E A;  1F31 A;  3IM6 A;  3POK A;  5DUY A;  3RTI B;  2FO1 A;  4A7Z A;  3FJC A;  2KH2 A;  3CA3 A;  2RG9 B;  3AZW A;  1BA7 A;  2BFH A;  1EPW A;  3QR5 A;  4KBB A;  1TFM B;  3FUO A;  3VUO A;  3P53 A;  3I2X A;  2BEA A;  1SR4 A;  4I4P A;  4PC4 A;  4IYB A;  5BOW A;  1S0D A;  3BAD A;  1V6V A;  4G9N A;  1FMM S;  1OQL B;  3H6S E;  1PUU B;  5D63 A;  1N4K A;  3IIR A;  4ZGR B;  1IHK A;  1RG8 A;  2D7I A;  3IM7 A;  2J3P A;  3OGG A;  3PME A;  3A22 A;  1JLX A;  4D0Z A;  1FQ9 A;  4HJJ A;  3H6R A;  4DEP A;  2K8R A;  1ISW A;  2P23 A;  3AZV A;  2DRE A;  4AN7 B;  4J2S A;  4L4I A;  3FFZ A;  5BP5 C;  4I8M A;  4P0K A;  2K43 A;  3D7W B;  1ISZ A;  3O3Q A;  1ISX A;  3R4S A;  3WIN A;  4LO7 B;  1S0C A;  1FGA A;  2VLC A;  3CA4 A;  3MPP G;  1YXW A;  2KLL A;  3OBT A;  1YYN A;  1IIL A;  4GOV A;  3RMY A;  3FJI A;  3O49 A;  4QD2 B;  4IHZ A;  2DRY A;  3BA5 A;  3CRH A;  4EB2 B;  1G9D A;  1BLD A;  1FV3 A;  1IRP A;  4J2Y A;  1EV2 A;  4LO7 C;  2FFV A;  5FNW A;  31BI A;  1HWM B;  2DS0 A;  3PUB A;  5HPZ A;  3BAQ A;  3BX1 C;  4I0Y A;  3VWC A;  3A07 A;  1JY0 A;  3LLP A;  2D43 A;  1HWN B;  1JT3 A;  1Q03 A;  3VEQ A;  3IM5 A;  1M16 A;  4OEG A;  3BTA A;  2HWA A;  2XOA A;  1S0F A;  4I7I A;  4CJM A;  4OW4 A;  2ZQO A;  1Z2V A;  4P0L A;  4OUJ A;  3WO4 A;  1Q1U A;  1T4Q A;  3FJD A;  4GP3 A;  1AVW B;  4I2S A;  2X2S A;  3VT0 A;  1FMZ A;  1DFQ A;  4LO3 A;  2Y9F A;  1SR4 C;  4KEK A;  3BRD A;  3A21 A;  3ZC8 A;  9ILB A;  4EFR A;  2GZB A;  3AJ5 A;  1VCL A;  1FN0 A;  4I4X A;  1TWE A;  1DZD A;  1HKN A;  1W3F A;  3NBN A;  4Z9W B;  3RMX A;  2QN4 A;  3KMV A;  3TC2 A;  1YBI A;  4R6U B;  1TTU A;  1AF9 A;  4IQP A;  1YF8 B;  3SNV A;  1RZO B;  1R8N A;  3HOM A;  4JAW A;  3IAG C;  4Q9P A;  5I1B A;  3LTQ A;  3NBE A;  3WIN C;  4IZX A;  3O44 A;  4QKR A;  2ESU A;  3AH4 A;  1IT0 A;  3P6J A;  1M2T B;  2HWM A;  2LIE A;  3AKH A;  1V6U A;  1SZ6 B;  3CQA A;  4LO1 A;  1JT5 A;  1ABR B;  5EG6 C;  4I4V A;  2YUG A;  4JKX B;  1TWM A;  4I4R A;  1BAR A;  3AKG A;  3AH1 A;  5BVP I;  4A7K A;  4P6A A;  3NBC A;  4QBV A;  1PUM B;  4QBC A;  5B2H A;  4X39 A;  1JT4 A;  3A23 A;  1RY7 A;  2VSE A;  4USP A;  3S8J A;  4DCK C;  3R4U A;  3V0B B;  1RML A;  2I1B A;  2D1Z A;  3OBR A;  3RSJ A;  4G9M A;  1HIB A;  2MC2 A;  3CA5 A;  5BXR A;  1BFF A;  3FJ8 A;  3I29 B;  3N0K A;  5BQU A;  4EKX B;  4LO3 C;  4D0T A;  2WRY A;  1AVA C;  3CA0 A;  1GGP B;  1QXM A;  3NBD A;  1AXM A;  1JQZ A;  21BI A;  2GO2 A; 
#chains in the Genus database with same CATH topology
 2D22 A;  2NTD A;  1CE7 B;  1L2H A;  2KI6 B;  1Z0H A;  3HBW A;  1XYF A;  3UJ4 A;  1BLA A;  4QKS A;  4I4Q A;  1W3G A;  4ZFW B;  3ZXG A;  2Y9X E;  1IOB A;  4GAI A;  3K1X A;  3Q7X A;  4EFP A;  2HW9 A;  5BXP A;  3FJF A;  3CAH A;  1PWA A;  3FJJ A;  4OWK A;  5F90 A;  3PG0 A;  4ISQ A;  4IY8 A;  3WO2 A;  2DRZ A;  3S8K A;  3RTJ B;  3BAU A;  1TIE A;  1JTC A;  2E4M C;  1I1B A;  3B9U A;  3I2A A;  4I6I A;  3O4B A;  1V6W A;  3VT2 A;  3UD7 A;  3E8L C;  3CA1 A;  1I1E A;  2P39 A;  1MD6 A;  3N7M A;  4EEE B;  4ZA3 B;  41BI A;  5E24 E;  1ILR 1;  4LO1 C;  1AVU A;  3FUQ A;  3FJ9 A;  2ZR1 B;  2R9K B;  3OGF A;  5JLV A;  3FJH A;  3Q7Y A;  4ION A;  3AKF A;  4G6M A;  4G1R A;  4TLP A;  1HWO B;  2VUA A;  1G9C A;  3C9Z A;  3H6R B;  4L4H A;  1KNM A;  2VSA A;  4X37 A;  4I4U A;  2VXT I;  5F8Y A;  2VU9 A;  4FGF A;  1XG6 A;  4II0 A;  2Q3N B;  4I4O A;  1UPS A;  4H04 A;  3FJB A;  2D20 A;  5BQU C;  3AKI A;  4LO8 B;  1TP0 A;  3UJ0 A;  1QQL A;  1WBC A;  3N7J A;  3FJK A;  3HMY A;  3VSF A;  3WMU A;  4X3A A;  5DVH A;  2Y9W C;  4EFQ A;  3W9T A;  3MAL A;  1HCD A;  4OEF A;  1DLL A;  4GAF A;  5BXS A;  5BXT A;  4FVV A;  3V79 C;  3O4D A;  4ISR A;  3WA1 A;  4J2K A;  1MC9 A;  2E4M A;  2Z49 A;  4YOL A;  2K4A B;  1K5U A;  2HZ9 A;  2WBC A;  2FDB M;  1TOO A;  4OWJ A;  4END A;  4UY4 A;  3N7L A;  3CA6 A;  4GP0 A;  5F8S A;  1WBA A;  4IY9 A;  3V0A A;  2KKI A;  1J0S A;  1S0G A;  1FV2 A;  3FJA A;  1P63 A;  1DFC A;  1DQG A;  4XKI A;  1PZZ A;  1IRA X;  1QQK A;  4QO3 A;  2Q9X A;  3BAH A;  4I3N A;  4LO0 A;  4HA2 A;  4OWL A;  5FZZ A;  2FFU A;  4QC4 A;  7I1B A;  1HWP B;  1DQO A;  3NJ5 A;  2LIQ A;  3N7K A;  1Q04 A;  3WO3 A;  1G9B A;  4F83 A;  3PHZ A;  4I96 A;  1G82 A;  2ERM A;  4OEE A;  4ZBV B;  1BFB A;  4P0J A;  4J2X A;  2NZ9 A;  2D44 A;  3UDA A;  2AQZ A;  1DIW A;  3UD9 A;  1YTO A;  3AH2 A;  5G00 A;  4JPZ A;  3CRI A;  1WD4 A;  1XZZ A;  2X2T A;  1ONK B;  1Z4S A;  2MIB A;  2FGF A;  8I1B A;  4I37 A;  1EVT A;  1JT7 A;  4HR6 C;  1ITB A;  4ZFU B;  4I1B A;  3ILA A;  4JP0 A;  3BA7 A;  3VSZ A;  1CVS A;  1G9A A;  3O4A A;  2NYY A;  4JKQ A;  4A7Y A;  5FZU A;  4XFT A;  1AFC A;  5EC5 A;  2UUS A;  4I4S A;  3V0A B;  1S0L A;  3CU1 B;  3OJM A;  1S0B A;  2NM1 A;  1V6X A;  3H6Q A;  1FWV A;  1II4 A;  4ZFY B;  3BRF A;  3F1R A;  2AXM A;  3ZX7 A;  4G6J A;  4Q91 A;  1DZC A;  5F8W A;  1XHB A;  4USO A;  3BAV A;  3T8S A;  2F2F A;  3JUT A;  4D8H A;  3HN1 A;  2M49 A;  1ISY A;  3HAL A;  3F62 B;  4LO0 C;  3UD8 A;  3FGM A;  1T9F A;  4Q9G A;  4JQ0 A;  1BAS A;  4LO2 C;  4MZH A;  4QD2 C;  2ZQN A;  1NUN A;  2AFG A;  5JMC A;  4F34 A;  5D62 A;  3CRG A;  3OJ2 A;  1D0H A;  4Z8S B;  3BAO A;  3Q7W A;  2RST A;  1EYL A;  2IWT B;  6I1B A;  4DEN A;  1DJS B;  4AN6 A;  2BEB A;  5EHA A;  3QYD A;  4X38 A;  4GOY A;  4IZE A;  4JRA A;  4ZLB B;  1NZK A;  2VXR A;  3FJE A;  1ISV A;  4KEI A;  5DSS B;  3BA4 A;  3BRG C;  1R8O A;  2D7R A;  2Y9G A;  1AVX B;  1IJT A;  2RQ9 A;  3V0B A;  2IHO A;  4QAL A;  3ZC9 A;  2L5X A;  3O5W B;  5BP5 A;  2D23 A;  2D24 A;  4WBC A;  3O4C A;  4XFS A;  4XFU A;  4ZKT B;  1FWU A;  1HCE A;  3JRR A;  5FZY A;  2AAI B;  1BFG A;  1BFC A;  2KI4 A;  1W3A A;  3WMV A;  3BAG A;  3AJ6 A;  3P6I A;  3BB2 A;  1JLY A;  4J23 B;  4KEJ A;  2Z48 A;  2MLL B;  3EF2 A;  2NVH A;  4I4Y A;  5D61 A;  3VT1 A;  2ET2 A;  3O4O A;  5DZU A;  1WD3 A;  4I1E A;  4KC3 A;  5GAQ A;  3HSM A;  2QYI B;  2F8X C;  2NP0 A;  5FNX A;  4ZOT A;  1K5V A;  4LO2 A;  1PC8 B;  1E0O A;  3ZXD A;  1A8D A;  2F2F C;  4H9W A;  3OJV A;  1S0E A;  1F31 A;  3IM6 A;  3POK A;  5DUY A;  3RTI B;  2FO1 A;  4A7Z A;  3FJC A;  2KH2 A;  3CA3 A;  2RG9 B;  3AZW A;  1BA7 A;  2BFH A;  1EPW A;  3QR5 A;  4KBB A;  1TFM B;  3FUO A;  3VUO A;  3P53 A;  3I2X A;  2BEA A;  1SR4 A;  4I4P A;  4PC4 A;  4IYB A;  5BOW A;  1S0D A;  3BAD A;  1V6V A;  4G9N A;  1FMM S;  1OQL B;  3H6S E;  1PUU B;  5D63 A;  1N4K A;  3IIR A;  4ZGR B;  1IHK A;  1RG8 A;  2D7I A;  3IM7 A;  2J3P A;  3OGG A;  3PME A;  3A22 A;  1JLX A;  4D0Z A;  1FQ9 A;  4HJJ A;  3H6R A;  4DEP A;  2K8R A;  1ISW A;  2P23 A;  3AZV A;  2DRE A;  4AN7 B;  4J2S A;  4L4I A;  3FFZ A;  5BP5 C;  4I8M A;  4P0K A;  2K43 A;  3D7W B;  1ISZ A;  3O3Q A;  1ISX A;  3R4S A;  3WIN A;  4LO7 B;  1S0C A;  1FGA A;  2VLC A;  3CA4 A;  3MPP G;  1YXW A;  2KLL A;  3OBT A;  1YYN A;  1IIL A;  4GOV A;  3RMY A;  3FJI A;  3O49 A;  4QD2 B;  4IHZ A;  2DRY A;  3BA5 A;  3CRH A;  4EB2 B;  1G9D A;  1BLD A;  1FV3 A;  1IRP A;  4J2Y A;  1EV2 A;  4LO7 C;  2FFV A;  5FNW A;  31BI A;  1HWM B;  2DS0 A;  3PUB A;  4MZF B;  5HPZ A;  3BAQ A;  3BX1 C;  4I0Y A;  3VWC A;  3A07 A;  1JY0 A;  3LLP A;  2D43 A;  1HWN B;  1JT3 A;  1Q03 A;  3VEQ A;  3IM5 A;  1M16 A;  4OEG A;  3BTA A;  2HWA A;  2XOA A;  1S0F A;  4I7I A;  4CJM A;  4OW4 A;  2ZQO A;  1Z2V A;  4P0L A;  4OUJ A;  3WO4 A;  1Q1U A;  1T4Q A;  3FJD A;  4GP3 A;  1AVW B;  4I2S A;  2X2S A;  3VT0 A;  1FMZ A;  1DFQ A;  4LO3 A;  2Y9F A;  1SR4 C;  4KEK A;  3BRD A;  3A21 A;  3ZC8 A;  9ILB A;  4EFR A;  2GZB A;  3AJ5 A;  1VCL A;  1FN0 A;  4I4X A;  1TWE A;  1DZD A;  1HKN A;  1W3F A;  3NBN A;  4Z9W B;  3RMX A;  2QN4 A;  3KMV A;  3TC2 A;  1YBI A;  4R6U B;  1TTU A;  1AF9 A;  4IQP A;  1YF8 B;  3SNV A;  1RZO B;  1R8N A;  3HOM A;  4JAW A;  3IAG C;  4Q9P A;  5I1B A;  3LTQ A;  3NBE A;  3WIN C;  4IZX A;  3O44 A;  4QKR A;  2ESU A;  3AH4 A;  1IT0 A;  3P6J A;  1M2T B;  2HWM A;  2LIE A;  3AKH A;  1V6U A;  1SZ6 B;  3CQA A;  4LO1 A;  1JT5 A;  4MZG B;  1ABR B;  5EG6 C;  4I4V A;  2YUG A;  4JKX B;  4H75 A;  1TWM A;  4I4R A;  1BAR A;  3AKG A;  3AH1 A;  5BVP I;  4A7K A;  2NS2 A;  4P6A A;  3NBC A;  4QBV A;  1PUM B;  4QBC A;  5B2H A;  4X39 A;  1JT4 A;  3A23 A;  1RY7 A;  2VSE A;  4USP A;  3S8J A;  4DCK C;  3R4U A;  3V0B B;  1RML A;  2I1B A;  2D1Z A;  3OBR A;  3RSJ A;  4G9M A;  1HIB A;  2MC2 A;  3CA5 A;  5BXR A;  1BFF A;  3FJ8 A;  3I29 B;  3N0K A;  5BQU A;  4EKX B;  4LO3 C;  4D0T A;  2WRY A;  1AVA C;  3CA0 A;  1GGP B;  1QXM A;  3NBD A;  1AXM A;  1JQZ A;  21BI A;  2GO2 A; 
#chains in the Genus database with same CATH homology
 2D22 A;  2NTD A;  1CE7 B;  1L2H A;  2KI6 B;  1Z0H A;  3HBW A;  1XYF A;  3UJ4 A;  1BLA A;  4QKS A;  4I4Q A;  1W3G A;  4ZFW B;  3ZXG A;  2Y9X E;  1IOB A;  4GAI A;  3K1X A;  3Q7X A;  4EFP A;  2HW9 A;  5BXP A;  3FJF A;  3CAH A;  1PWA A;  3FJJ A;  4OWK A;  5F90 A;  3PG0 A;  4ISQ A;  4IY8 A;  3WO2 A;  2DRZ A;  3S8K A;  3RTJ B;  3BAU A;  1TIE A;  1JTC A;  2E4M C;  1I1B A;  3B9U A;  3I2A A;  4I6I A;  3O4B A;  1V6W A;  3VT2 A;  3UD7 A;  3E8L C;  3CA1 A;  1I1E A;  2P39 A;  1MD6 A;  3N7M A;  4EEE B;  4ZA3 B;  41BI A;  5E24 E;  1ILR 1;  4LO1 C;  1AVU A;  3FUQ A;  3FJ9 A;  2ZR1 B;  2R9K B;  3OGF A;  5JLV A;  3FJH A;  3Q7Y A;  4ION A;  3AKF A;  4G6M A;  4G1R A;  4TLP A;  1HWO B;  2VUA A;  1G9C A;  3C9Z A;  3H6R B;  4L4H A;  1KNM A;  2VSA A;  4X37 A;  4I4U A;  2VXT I;  5F8Y A;  2VU9 A;  4FGF A;  1XG6 A;  4II0 A;  2Q3N B;  4I4O A;  1UPS A;  4H04 A;  3FJB A;  2D20 A;  5BQU C;  3AKI A;  4LO8 B;  1TP0 A;  3UJ0 A;  1QQL A;  1WBC A;  3N7J A;  3FJK A;  3HMY A;  3VSF A;  3WMU A;  4X3A A;  5DVH A;  2Y9W C;  4EFQ A;  3W9T A;  3MAL A;  1HCD A;  4OEF A;  1DLL A;  4GAF A;  5BXS A;  5BXT A;  4FVV A;  3V79 C;  3O4D A;  4ISR A;  3WA1 A;  4J2K A;  1MC9 A;  2E4M A;  2Z49 A;  4YOL A;  2K4A B;  1K5U A;  2HZ9 A;  2WBC A;  2FDB M;  1TOO A;  4OWJ A;  4END A;  4UY4 A;  3N7L A;  3CA6 A;  4GP0 A;  5F8S A;  1WBA A;  4IY9 A;  3V0A A;  2KKI A;  1J0S A;  1S0G A;  1FV2 A;  3FJA A;  1P63 A;  1DFC A;  1DQG A;  4XKI A;  1PZZ A;  1IRA X;  1QQK A;  4QO3 A;  2Q9X A;  3BAH A;  4I3N A;  4LO0 A;  4HA2 A;  4OWL A;  5FZZ A;  2FFU A;  4QC4 A;  7I1B A;  1HWP B;  1DQO A;  3NJ5 A;  2LIQ A;  3N7K A;  1Q04 A;  3WO3 A;  1G9B A;  4F83 A;  3PHZ A;  4I96 A;  1G82 A;  2ERM A;  4OEE A;  4ZBV B;  1BFB A;  4P0J A;  4J2X A;  2NZ9 A;  2D44 A;  3UDA A;  2AQZ A;  1DIW A;  3UD9 A;  1YTO A;  3AH2 A;  5G00 A;  4JPZ A;  3CRI A;  1WD4 A;  1XZZ A;  2X2T A;  1ONK B;  1Z4S A;  2MIB A;  2FGF A;  8I1B A;  4I37 A;  1EVT A;  1JT7 A;  4HR6 C;  1ITB A;  4ZFU B;  4I1B A;  3ILA A;  4JP0 A;  3BA7 A;  3VSZ A;  1CVS A;  1G9A A;  3O4A A;  2NYY A;  4JKQ A;  4A7Y A;  5FZU A;  4XFT A;  1AFC A;  5EC5 A;  2UUS A;  4I4S A;  3V0A B;  1S0L A;  3CU1 B;  3OJM A;  1S0B A;  2NM1 A;  1V6X A;  3H6Q A;  1FWV A;  1II4 A;  4ZFY B;  3BRF A;  3F1R A;  2AXM A;  3ZX7 A;  4G6J A;  4Q91 A;  1DZC A;  5F8W A;  1XHB A;  4USO A;  3BAV A;  3T8S A;  2F2F A;  3JUT A;  4D8H A;  3HN1 A;  2M49 A;  1ISY A;  3HAL A;  3F62 B;  4LO0 C;  3UD8 A;  3FGM A;  1T9F A;  4Q9G A;  4JQ0 A;  1BAS A;  4LO2 C;  4MZH A;  4QD2 C;  2ZQN A;  1NUN A;  2AFG A;  5JMC A;  4F34 A;  5D62 A;  3CRG A;  3OJ2 A;  1D0H A;  4Z8S B;  3BAO A;  3Q7W A;  2RST A;  1EYL A;  2IWT B;  6I1B A;  4DEN A;  1DJS B;  4AN6 A;  2BEB A;  5EHA A;  3QYD A;  4X38 A;  4GOY A;  4IZE A;  4JRA A;  4ZLB B;  1NZK A;  2VXR A;  3FJE A;  1ISV A;  4KEI A;  5DSS B;  3BA4 A;  3BRG C;  1R8O A;  2D7R A;  2Y9G A;  1AVX B;  1IJT A;  2RQ9 A;  3V0B A;  2IHO A;  4QAL A;  3ZC9 A;  2L5X A;  3O5W B;  5BP5 A;  2D23 A;  2D24 A;  4WBC A;  3O4C A;  4XFS A;  4XFU A;  4ZKT B;  1FWU A;  1HCE A;  3JRR A;  5FZY A;  2AAI B;  1BFG A;  1BFC A;  2KI4 A;  1W3A A;  3WMV A;  3BAG A;  3AJ6 A;  3P6I A;  3BB2 A;  1JLY A;  4J23 B;  4KEJ A;  2Z48 A;  2MLL B;  3EF2 A;  2NVH A;  4I4Y A;  5D61 A;  3VT1 A;  2ET2 A;  3O4O A;  5DZU A;  1WD3 A;  4I1E A;  4KC3 A;  5GAQ A;  3HSM A;  2QYI B;  2F8X C;  2NP0 A;  5FNX A;  4ZOT A;  1K5V A;  4LO2 A;  1PC8 B;  1E0O A;  3ZXD A;  1A8D A;  2F2F C;  4H9W A;  3OJV A;  1S0E A;  1F31 A;  3IM6 A;  3POK A;  5DUY A;  3RTI B;  2FO1 A;  4A7Z A;  3FJC A;  2KH2 A;  3CA3 A;  2RG9 B;  3AZW A;  1BA7 A;  2BFH A;  1EPW A;  3QR5 A;  4KBB A;  1TFM B;  3FUO A;  3VUO A;  3P53 A;  3I2X A;  2BEA A;  1SR4 A;  4I4P A;  4PC4 A;  4IYB A;  5BOW A;  1S0D A;  3BAD A;  1V6V A;  4G9N A;  1FMM S;  1OQL B;  3H6S E;  1PUU B;  5D63 A;  1N4K A;  3IIR A;  4ZGR B;  1IHK A;  1RG8 A;  2D7I A;  3IM7 A;  2J3P A;  3OGG A;  3PME A;  3A22 A;  1JLX A;  4D0Z A;  1FQ9 A;  4HJJ A;  3H6R A;  4DEP A;  2K8R A;  1ISW A;  2P23 A;  3AZV A;  2DRE A;  4AN7 B;  4J2S A;  4L4I A;  3FFZ A;  5BP5 C;  4I8M A;  4P0K A;  2K43 A;  3D7W B;  1ISZ A;  3O3Q A;  1ISX A;  3R4S A;  3WIN A;  4LO7 B;  1S0C A;  1FGA A;  2VLC A;  3CA4 A;  3MPP G;  1YXW A;  2KLL A;  3OBT A;  1YYN A;  1IIL A;  4GOV A;  3RMY A;  3FJI A;  3O49 A;  4QD2 B;  4IHZ A;  2DRY A;  3BA5 A;  3CRH A;  4EB2 B;  1G9D A;  1BLD A;  1FV3 A;  1IRP A;  4J2Y A;  1EV2 A;  4LO7 C;  2FFV A;  5FNW A;  31BI A;  1HWM B;  2DS0 A;  3PUB A;  4MZF B;  5HPZ A;  3BAQ A;  3BX1 C;  4I0Y A;  3VWC A;  3A07 A;  1JY0 A;  3LLP A;  2D43 A;  1HWN B;  1JT3 A;  1Q03 A;  3VEQ A;  3IM5 A;  1M16 A;  4OEG A;  3BTA A;  2HWA A;  2XOA A;  1S0F A;  4I7I A;  4CJM A;  4OW4 A;  2ZQO A;  1Z2V A;  4P0L A;  4OUJ A;  3WO4 A;  1Q1U A;  1T4Q A;  3FJD A;  4GP3 A;  1AVW B;  4I2S A;  2X2S A;  3VT0 A;  1FMZ A;  1DFQ A;  4LO3 A;  2Y9F A;  1SR4 C;  4KEK A;  3BRD A;  3A21 A;  3ZC8 A;  9ILB A;  4EFR A;  2GZB A;  3AJ5 A;  1VCL A;  1FN0 A;  4I4X A;  1TWE A;  1DZD A;  1HKN A;  1W3F A;  3NBN A;  4Z9W B;  3RMX A;  2QN4 A;  3KMV A;  3TC2 A;  1YBI A;  4R6U B;  1TTU A;  1AF9 A;  4IQP A;  1YF8 B;  3SNV A;  1RZO B;  1R8N A;  3HOM A;  4JAW A;  3IAG C;  4Q9P A;  5I1B A;  3LTQ A;  3NBE A;  3WIN C;  4IZX A;  3O44 A;  4QKR A;  2ESU A;  3AH4 A;  1IT0 A;  3P6J A;  1M2T B;  2HWM A;  2LIE A;  3AKH A;  1V6U A;  1SZ6 B;  3CQA A;  4LO1 A;  1JT5 A;  4MZG B;  1ABR B;  5EG6 C;  4I4V A;  2YUG A;  4JKX B;  4H75 A;  1TWM A;  4I4R A;  1BAR A;  3AKG A;  3AH1 A;  5BVP I;  4A7K A;  2NS2 A;  4P6A A;  3NBC A;  4QBV A;  1PUM B;  4QBC A;  5B2H A;  4X39 A;  1JT4 A;  3A23 A;  1RY7 A;  2VSE A;  4USP A;  3S8J A;  4DCK C;  3R4U A;  3V0B B;  1RML A;  2I1B A;  2D1Z A;  3OBR A;  3RSJ A;  4G9M A;  1HIB A;  2MC2 A;  3CA5 A;  5BXR A;  1BFF A;  3FJ8 A;  3I29 B;  3N0K A;  5BQU A;  4EKX B;  4LO3 C;  4D0T A;  2WRY A;  1AVA C;  3CA0 A;  1GGP B;  1QXM A;  3NBD A;  1AXM A;  1JQZ A;  21BI A;  2GO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...