1FGAA

Refinement of the structure of human basic fibroblast growth factor at 1.6 angstroms resolution and analysis of presumed heparin binding sites by selenate substitution
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
124
structure length
124
Chain Sequence
PKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Growth factor
molecule keywords BASIC FIBROBLAST GROWTH FACTOR
publication title Refinement of the structure of human basic fibroblast growth factor at 1.6 A resolution and analysis of presumed heparin binding sites by selenate substitution.
pubmed rcsb
source organism Homo sapiens
total genus 29
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1993-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1fgaA00
1ISVA 3CRIA 4ZLBB 4Q9PA 4I4PA 3TC2A 3BRGC 2X2TA 3QYDA 3O49A 1P63A 4OEEA 3PG0A 1PZZA 4OW4A 1FN0A 2ERMA 1JT5A 3ILAA 5E24E 1II4A 4LO3C 2D44A 2D23A 3AZVA 3I2XA 4QALA 1IT0A 4IHZA 4KEIA 5BQUA 4OWKA 3EF2A 3N7LA 3ZC8A 3VSZA 3JUTA 4XFTA 2D24A 1MC9A 1DIWA 3CU1B 3N7JA 4XFSA 2F8XC 1T4QA 3BAVA 3CA0A 1HWPB 1VCLA 2NVHA 1QQLA 3ZX7A 2VSAA 1HCEA 4LO1C 5DVHA 2MC2A 4F34A 2ET2A 3WO3A 2KLLA 4QBVA 3POKA 2IHOA 4ZFWB 1XG6A 1JT7A 5D62A 1I1EA 1WBAA 3FJEA 4I6IA 4Q9GA 5EG6C 3BRFA 3UD7A 1S0CA 3P53A 2Y9XE 3FJJA 3BADA 4IONA 1AFCA 3IM6A 4JKQA 4FVVA 4HJJA 2ZQOA 5GAQA 1HCDA 2Q3NB 4XKIA 2LIQA 3VEQA 2GO2A 4I4RA 3OBRA 4JKXB 3IM7A 1Z4SA 1QQKA 4LO7B 4PC4A 2E4MA 2DRZA 5FZYA 3WMUA 4I37A 3ZXDA 3V0BB 4G1RA 3OJ2A 1NUNA 4QBCA 1TTUA 1Q03A 3NBEA 3HSMA 3AH2A 2Z49A 4OWLA 1GGPB 1AXMA 3UJ0A 5F8YA 3V0BA 3FUOA 3LTQA 4YOLA 2Y9GA 4QKRA 1S0BA 1RY7A 2P23A 3FJCA 1IRPA 4IZEA 1G9AA 3BTAA 4WBCA 1E0OA 3HBWA 4AN6A 4HR6C 5BXTA 3VSFA 2QN4A 3CA3A 3A21A 5FNWA 1FWVA 1DQOA 4HA2A 4EFRA 1FQ9A 5G00A 1BARA 4Q91A 1JTCA 4JRAA 4QKSA 3B9UA 5FNXA 3FJBA 3NJ5A 1I1BA 3VT0A 1BFGA 1UPSA 3PHZA 2D22A 5DZUA 3R4UA 4J2KA 3IM5A 1PWAA 3AKIA 3UJ4A 4EKXB 3WO2A 2F2FC 5BOWA 3MALA 4A7KA 4D0TA 4D0ZA 3S8KA 1EYLA 4GAFA 3FJIA 1J0SA 1K5UA 1V6VA 3FJ8A 3HALA 3OJMA 4I96A 2M49A 3LLPA 1Q04A 5FZUA 5I1BA 1KNMA 2AFGA 2P39A 2RSTA 3N7KA 1S0GA 3AH1A 1YTOA 2FFUA 3BAUA 4LO2C 4QC4A 1BLDA 1JLYA 2HZ9A 1FMMS 1RZOB 4P6AA 4ZKTB 3P6IA 3I2AA 1BFFA 3V0AB 1CVSA 1TFMB 3AZWA 1ISYA 4IQPA 5BP5C 1DZDA 3OBTA 1NZKA 4ISQA 4LO8B 4QD2C 1BFBA 2DREA 3O4DA 3O4OA 3AJ5A 4LO0C 4IY8A 5BXRA 2QYIB 3PMEA 4EB2B 4I1BA 4X38A 3BAHA 3V0AA 5BXPA 3RTIB 3BA5A 1PUUB 1YYNA 3FJAA 3VT2A 2VSEA 4USOA 4G9NA 3HMYA 3MPPG 3O3QA 1M16A 2MIBA 5F90A 4IZXA 1HWNB 4GOYA 4KC3A 4JAWA 4I1EA 2KH2A 4JP0A 5DUYA 2FDBM 1ISZA 2VLCA 2K43A 3WO4A 3O4BA 7I1BA 1TWEA 1FGAA 3V79C 2HWMA 4LO3A 1W3FA 4P0JA 1HKNA 4I4SA 4OWJA 3FJDA 4IY9A 3O4AA 2NTDA 1TP0A 4A7ZA 2D1ZA 1S0LA 2RQ9A 3WINC 3NBNA 1V6WA 1WD3A 1Z2VA 4X37A 1PUMB 4LO0A 4ZA3B 4LO1A 1ONKB 3AKGA 4EFQA 2R9KB 5EHAA 3N0KA 4JPZA 4P0KA 1HIBA 2Y9FA 1R8NA 1AVWB 4I4UA 3RMXA 1MD6A 4I4OA 1W3AA 3AH4A 4G6MA 3WA1A 4H04A 1EV2A 1BASA 1SR4C 2FGFA 2YUGA 4J2YA 4USPA 1QXMA 3BRDA 4OEGA 1BA7A 1HWMB 5DSSB 2WBCA 1IJTA 3RTJB 4ZBVB 1T9FA 4I0YA 5BVPI 1YF8B 4KBBA 3F62B 1EVTA 1EPWA 3H6QA 3RSJA 1FWUA 2D7RA 3NBDA 2DRYA 4X3AA 41BIA 1A8DA 4ZOTA 5B2HA 1ISWA 2J3PA 4CJMA 1ITBA 3H6SE 5BQUC 1XZZA 4I2SA 4F83A 1AVAC 3CQAA 6I1BA 3OGGA 2MLLB 3Q7XA 1RMLA 3UDAA 4ZFUB 2NM1A 1Z0HA 1W3GA 1M2TB 2I1BA 3BX1C 1ILR1 3P6JA 4EFPA 1V6XA 1G9BA 4I4XA 1XHBA 2VU9A 1RG8A 4AN7B 2ZR1B 2UUSA 4J2SA 2ESUA 3CRHA 5F8SA 1JQZA 3N7MA 3BB2A 4D8HA 2FFVA 3BA7A 4GP0A 3A22A 2Q9XA 3Q7WA 1BFCA 3KMVA 3HN1A 3SNVA 4GOVA 4ISRA 2Y9WC 2D7IA 1FMZA 3JRRA 2VUAA 3VWCA 3BAQA 3BAOA 3ZC9A 3BAGA 4I7IA 3HOMA 2AQZA 3FJKA 1HWOB 3WMVA 4Z9WB 1IOBA 2KKIA 1G82A 4I4VA 1AVXB 4J23B 2F2FA 1YXWA 3CA1A 21BIA 2E4MC 1OQLB 1AF9A 1PC8B 1DFCA 3CRGA 1WD4A 1AVUA 2KI6B 4GAIA 4KEJA 3OGFA 4LO7C 4I8MA 2BFHA 1ABRB 4ZFYB 2BEAA 3UD9A 2RG9B 3QR5A 4GP3A 3PUBA 1L2HA 2X2SA 4LO2A 4P0LA 3Q7YA 4QD2B 2FO1A 2AXMA 4II0A 3FUQA 2XOAA 3FJ9A 4XFUA 5BXSA 1JT3A 3I29B 4I4YA 5BP5A 3ZXGA 2Z48A 1WBCA 4L4IA 4Z8SB 5D61A 4QO3A 4X39A 2HWAA 4ZGRB 3D7WB 4DEPA 3IIRA 3O44A 3FFZA 3K1XA 3RMYA 1JLXA 3AKFA 3CA5A 4ENDA 3VUOA 1K5VA 1DLLA 3CA6A 2K8RA 2VXRA 4JQ0A 2DS0A 2LIEA 1IHKA 3FJFA 2BEBA 2HW9A 1DJSB 5F8WA 4G6JA 5JMCA 9ILBA 1FV2A 1S0DA 3S8JA 2D43A 1D0HA 1XYFA 3T8SA 1DQGA 3VT1A 8I1BA 3CAHA 4OEFA 1F31A 4OUJA 1DFQA 1JT4A 3O4CA 4I4QA 1FV3A 3AJ6A 3UD8A 2ZQNA 1YBIA 1TIEA 1JY0A 3E8LC 1TOOA 1R8OA 4R6UB 3BA4A 3WINA 4I3NA 1G9CA 2KI4A 1TWMA 1DZCA 4DENA 5FZZA 1Q1UA 31BIA 3A07A 5JLVA 3R4SA 1IILA 1S0FA 3A23A 1ISXA 4KEKA 1CE7B 4A7YA 3FJHA 2L5XA 2D20A 4TLPA 1SZ6B 3OJVA 4G9MA 4H9WA 1G9DA 4EEEB 3CA4A 1V6UA 3AKHA 1S0EA 3C9ZA 3H6RB 2VXTI 2IWTB 1BLAA 3IAGC 3O5WB 1SR4A 5EC5A 2WRYA 2NP0A 3FGMA 1N4KA 3NBCA 4IYBA 4L4HA 2NZ9A 2GZBA 1IRAX 2AAIB 4FGFA 3H6RA 3W9TA 4J2XA 5HPZA 2NYYA 4DCKC 3F1RA 5D63A 2K4AB
chains in the Genus database with same CATH superfamily
1ISVA 3CRIA 4ZLBB 4Q9PA 4I4PA 3TC2A 3BRGC 2X2TA 3QYDA 3O49A 1P63A 4OEEA 3PG0A 1PZZA 4OW4A 1FN0A 2ERMA 1JT5A 3ILAA 5E24E 1II4A 4LO3C 2D44A 2D23A 3AZVA 3I2XA 4QALA 1IT0A 4IHZA 4KEIA 5BQUA 4OWKA 3EF2A 3N7LA 3ZC8A 3VSZA 3JUTA 4XFTA 2D24A 1MC9A 1DIWA 3CU1B 3N7JA 4XFSA 2F8XC 1T4QA 3BAVA 3CA0A 1HWPB 1VCLA 2NVHA 1QQLA 3ZX7A 2VSAA 1HCEA 4LO1C 5DVHA 2MC2A 4F34A 2ET2A 3WO3A 2KLLA 4QBVA 3POKA 2IHOA 4ZFWB 1XG6A 1JT7A 5D62A 1I1EA 1WBAA 3FJEA 4I6IA 4Q9GA 5EG6C 3BRFA 3UD7A 1S0CA 3P53A 2Y9XE 3FJJA 3BADA 4IONA 1AFCA 3IM6A 4JKQA 4FVVA 4HJJA 2ZQOA 5GAQA 1HCDA 2Q3NB 4XKIA 2LIQA 3VEQA 2GO2A 4I4RA 3OBRA 4JKXB 3IM7A 1Z4SA 1QQKA 4LO7B 4PC4A 2E4MA 2DRZA 5FZYA 3WMUA 4I37A 3ZXDA 3V0BB 4G1RA 3OJ2A 1NUNA 4QBCA 1TTUA 1Q03A 3NBEA 3HSMA 3AH2A 2Z49A 4OWLA 1GGPB 1AXMA 3UJ0A 5F8YA 3V0BA 3FUOA 3LTQA 4YOLA 2Y9GA 4QKRA 4MZFB 1S0BA 1RY7A 2P23A 3FJCA 1IRPA 4IZEA 1G9AA 3BTAA 4WBCA 1E0OA 3HBWA 4AN6A 4HR6C 4MZGB 5BXTA 3VSFA 2QN4A 3CA3A 3A21A 5FNWA 1FWVA 1DQOA 4HA2A 4EFRA 1FQ9A 5G00A 1BARA 4Q91A 1JTCA 4JRAA 4QKSA 3B9UA 5FNXA 3FJBA 3NJ5A 1I1BA 3VT0A 1BFGA 1UPSA 3PHZA 2D22A 5DZUA 3R4UA 4J2KA 3IM5A 1PWAA 3AKIA 3UJ4A 4EKXB 3WO2A 2F2FC 5BOWA 3MALA 4A7KA 4D0TA 4D0ZA 3S8KA 1EYLA 4GAFA 3FJIA 1J0SA 1K5UA 1V6VA 3FJ8A 3HALA 3OJMA 4I96A 4MZHA 2M49A 3LLPA 1Q04A 5FZUA 5I1BA 1KNMA 2AFGA 2P39A 2RSTA 3N7KA 1S0GA 3AH1A 1YTOA 2FFUA 3BAUA 4LO2C 4QC4A 1BLDA 1JLYA 2HZ9A 1FMMS 1RZOB 4P6AA 4ZKTB 3P6IA 3I2AA 1BFFA 3V0AB 1CVSA 1TFMB 3AZWA 2NS2A 1ISYA 4IQPA 5BP5C 1DZDA 3OBTA 1NZKA 4ISQA 4LO8B 4QD2C 1BFBA 2DREA 3O4DA 3O4OA 3AJ5A 4LO0C 4IY8A 5BXRA 2QYIB 3PMEA 4EB2B 4I1BA 4X38A 3BAHA 3V0AA 5BXPA 3RTIB 3BA5A 1PUUB 1YYNA 3FJAA 3VT2A 2VSEA 4USOA 4G9NA 3HMYA 3MPPG 3O3QA 1M16A 2MIBA 5F90A 4IZXA 1HWNB 4GOYA 4KC3A 4JAWA 4I1EA 2KH2A 4JP0A 5DUYA 2FDBM 1ISZA 2VLCA 2K43A 3WO4A 3O4BA 7I1BA 1TWEA 1FGAA 3V79C 2HWMA 4LO3A 1W3FA 4P0JA 1HKNA 4I4SA 4OWJA 3FJDA 4IY9A 3O4AA 2NTDA 1TP0A 4A7ZA 2D1ZA 1S0LA 2RQ9A 3WINC 3NBNA 1V6WA 1WD3A 1Z2VA 4X37A 1PUMB 4LO0A 4ZA3B 4LO1A 1ONKB 3AKGA 4EFQA 2R9KB 5EHAA 3N0KA 4JPZA 4P0KA 1HIBA 2Y9FA 1R8NA 1AVWB 4I4UA 3RMXA 1MD6A 4I4OA 1W3AA 3AH4A 4G6MA 3WA1A 4H04A 1EV2A 1BASA 1SR4C 2FGFA 2YUGA 4J2YA 4USPA 1QXMA 3BRDA 4OEGA 1BA7A 1HWMB 5DSSB 2WBCA 1IJTA 3RTJB 4ZBVB 1T9FA 4I0YA 5BVPI 1YF8B 4KBBA 3F62B 1EVTA 1EPWA 3H6QA 3RSJA 1FWUA 2D7RA 3NBDA 2DRYA 4X3AA 41BIA 1A8DA 4ZOTA 5B2HA 1ISWA 2J3PA 4CJMA 1ITBA 3H6SE 5BQUC 1XZZA 4I2SA 4F83A 1AVAC 3CQAA 6I1BA 3OGGA 2MLLB 3Q7XA 1RMLA 3UDAA 4ZFUB 2NM1A 1Z0HA 1W3GA 1M2TB 2I1BA 3BX1C 1ILR1 3P6JA 4EFPA 1V6XA 1G9BA 4I4XA 1XHBA 2VU9A 1RG8A 4AN7B 2ZR1B 2UUSA 4J2SA 2ESUA 3CRHA 5F8SA 1JQZA 3N7MA 3BB2A 4D8HA 2FFVA 3BA7A 4GP0A 3A22A 2Q9XA 3Q7WA 1BFCA 3KMVA 3HN1A 3SNVA 4GOVA 4ISRA 2Y9WC 2D7IA 1FMZA 3JRRA 2VUAA 3VWCA 3BAQA 3BAOA 3ZC9A 3BAGA 4I7IA 3HOMA 2AQZA 3FJKA 1HWOB 3WMVA 4Z9WB 1IOBA 2KKIA 1G82A 4I4VA 1AVXB 4J23B 2F2FA 1YXWA 3CA1A 21BIA 2E4MC 1OQLB 1AF9A 1PC8B 1DFCA 3CRGA 1WD4A 1AVUA 2KI6B 4GAIA 4KEJA 3OGFA 4LO7C 4I8MA 2BFHA 1ABRB 4ZFYB 2BEAA 3UD9A 2RG9B 3QR5A 4GP3A 3PUBA 1L2HA 2X2SA 4LO2A 4P0LA 3Q7YA 4QD2B 2FO1A 2AXMA 4II0A 3FUQA 2XOAA 3FJ9A 4XFUA 5BXSA 1JT3A 3I29B 4I4YA 5BP5A 3ZXGA 2Z48A 1WBCA 4L4IA 4Z8SB 5D61A 4QO3A 4X39A 2HWAA 4ZGRB 3D7WB 4DEPA 3IIRA 3O44A 3FFZA 3K1XA 3RMYA 1JLXA 3AKFA 3CA5A 4ENDA 3VUOA 1K5VA 1DLLA 3CA6A 2K8RA 2VXRA 4JQ0A 2DS0A 2LIEA 1IHKA 3FJFA 2BEBA 2HW9A 1DJSB 5F8WA 4G6JA 5JMCA 9ILBA 1FV2A 1S0DA 3S8JA 2D43A 1D0HA 1XYFA 3T8SA 1DQGA 3VT1A 8I1BA 3CAHA 4OEFA 1F31A 4OUJA 1DFQA 1JT4A 4UY4A 3O4CA 4I4QA 1FV3A 3AJ6A 3UD8A 2ZQNA 1YBIA 1TIEA 1JY0A 3E8LC 1TOOA 1R8OA 4R6UB 3BA4A 3WINA 4I3NA 1G9CA 2KI4A 1TWMA 1DZCA 4DENA 5FZZA 1Q1UA 31BIA 3A07A 5JLVA 3R4SA 1IILA 1S0FA 3A23A 1ISXA 4KEKA 1CE7B 4A7YA 3FJHA 2L5XA 2D20A 4TLPA 1SZ6B 3OJVA 4G9MA 4H9WA 1G9DA 4EEEB 3CA4A 1V6UA 3AKHA 1S0EA 3C9ZA 3H6RB 2VXTI 2IWTB 1BLAA 3IAGC 3O5WB 1SR4A 5EC5A 2WRYA 2NP0A 3FGMA 1N4KA 3NBCA 4H75A 4IYBA 4L4HA 2NZ9A 2GZBA 1IRAX 2AAIB 4FGFA 3H6RA 3W9TA 4J2XA 5HPZA 2NYYA 4DCKC 3F1RA 5D63A 2K4AB
chains in the Genus database with same CATH topology
1ISVA 3CRIA 4ZLBB 4Q9PA 4I4PA 3TC2A 3BRGC 2X2TA 3QYDA 3O49A 1P63A 4OEEA 3PG0A 1PZZA 4OW4A 1FN0A 2ERMA 1JT5A 3ILAA 5E24E 1II4A 4LO3C 2D44A 2D23A 3AZVA 3I2XA 4QALA 1IT0A 4IHZA 4KEIA 5BQUA 4OWKA 3EF2A 3N7LA 3ZC8A 3VSZA 3JUTA 4XFTA 2D24A 1MC9A 1DIWA 3CU1B 3N7JA 4XFSA 2F8XC 1T4QA 3BAVA 3CA0A 1HWPB 1VCLA 2NVHA 1QQLA 3ZX7A 2VSAA 1HCEA 4LO1C 5DVHA 2MC2A 4F34A 2ET2A 3WO3A 2KLLA 4QBVA 3POKA 2IHOA 4ZFWB 1XG6A 1JT7A 5D62A 1I1EA 1WBAA 3FJEA 4I6IA 4Q9GA 5EG6C 3BRFA 3UD7A 1S0CA 3P53A 2Y9XE 3FJJA 3BADA 4IONA 1AFCA 3IM6A 4JKQA 4FVVA 4HJJA 2ZQOA 5GAQA 1HCDA 2Q3NB 4XKIA 2LIQA 3VEQA 2GO2A 4I4RA 3OBRA 4JKXB 3IM7A 1Z4SA 1QQKA 4LO7B 4PC4A 2E4MA 2DRZA 5FZYA 3WMUA 4I37A 3ZXDA 3V0BB 4G1RA 3OJ2A 1NUNA 4QBCA 1TTUA 1Q03A 3NBEA 3HSMA 3AH2A 2Z49A 4OWLA 1GGPB 1AXMA 3UJ0A 5F8YA 3V0BA 3FUOA 3LTQA 4YOLA 2Y9GA 4QKRA 4MZFB 1S0BA 1RY7A 2P23A 3FJCA 1IRPA 4IZEA 1G9AA 3BTAA 4WBCA 1E0OA 3HBWA 4AN6A 4HR6C 4MZGB 5BXTA 3VSFA 2QN4A 3CA3A 3A21A 5FNWA 1FWVA 1DQOA 4HA2A 4EFRA 1FQ9A 5G00A 1BARA 4Q91A 1JTCA 4JRAA 4QKSA 3B9UA 5FNXA 3FJBA 3NJ5A 1I1BA 3VT0A 1BFGA 1UPSA 3PHZA 2D22A 5DZUA 3R4UA 4J2KA 3IM5A 1PWAA 3AKIA 3UJ4A 4EKXB 3WO2A 2F2FC 5BOWA 3MALA 4A7KA 4D0TA 4D0ZA 3S8KA 1EYLA 4GAFA 3FJIA 1J0SA 1K5UA 1V6VA 3FJ8A 3HALA 3OJMA 4I96A 4MZHA 2M49A 3LLPA 1Q04A 5FZUA 5I1BA 1KNMA 2AFGA 2P39A 2RSTA 3N7KA 1S0GA 3AH1A 1YTOA 2FFUA 3BAUA 4LO2C 4QC4A 1BLDA 1JLYA 2HZ9A 1FMMS 1RZOB 4P6AA 4ZKTB 3P6IA 3I2AA 1BFFA 3V0AB 1CVSA 1TFMB 3AZWA 2NS2A 1ISYA 4IQPA 5BP5C 1DZDA 3OBTA 1NZKA 4ISQA 4LO8B 4QD2C 1BFBA 2DREA 3O4DA 3O4OA 3AJ5A 4LO0C 4IY8A 5BXRA 2QYIB 3PMEA 4EB2B 4I1BA 4X38A 3BAHA 3V0AA 5BXPA 3RTIB 3BA5A 1PUUB 1YYNA 3FJAA 3VT2A 2VSEA 4USOA 4G9NA 3HMYA 3MPPG 3O3QA 1M16A 2MIBA 5F90A 4IZXA 1HWNB 4GOYA 4KC3A 4JAWA 4I1EA 2KH2A 4JP0A 5DUYA 2FDBM 1ISZA 2VLCA 2K43A 3WO4A 3O4BA 7I1BA 1TWEA 1FGAA 3V79C 2HWMA 4LO3A 1W3FA 4P0JA 1HKNA 4I4SA 4OWJA 3FJDA 4IY9A 3O4AA 2NTDA 1TP0A 4A7ZA 2D1ZA 1S0LA 2RQ9A 3WINC 3NBNA 1V6WA 1WD3A 1Z2VA 4X37A 1PUMB 4LO0A 4ZA3B 4LO1A 1ONKB 3AKGA 4EFQA 2R9KB 5EHAA 3N0KA 4JPZA 4P0KA 1HIBA 2Y9FA 1R8NA 1AVWB 4I4UA 3RMXA 1MD6A 4I4OA 1W3AA 3AH4A 4G6MA 3WA1A 4H04A 1EV2A 1BASA 1SR4C 2FGFA 2YUGA 4J2YA 4USPA 1QXMA 3BRDA 4OEGA 1BA7A 1HWMB 5DSSB 2WBCA 1IJTA 3RTJB 4ZBVB 1T9FA 4I0YA 5BVPI 1YF8B 4KBBA 3F62B 1EVTA 1EPWA 3H6QA 3RSJA 1FWUA 2D7RA 3NBDA 2DRYA 4X3AA 41BIA 1A8DA 4ZOTA 5B2HA 1ISWA 2J3PA 4CJMA 1ITBA 3H6SE 5BQUC 1XZZA 4I2SA 4F83A 1AVAC 3CQAA 6I1BA 3OGGA 2MLLB 3Q7XA 1RMLA 3UDAA 4ZFUB 2NM1A 1Z0HA 1W3GA 1M2TB 2I1BA 3BX1C 1ILR1 3P6JA 4EFPA 1V6XA 1G9BA 4I4XA 1XHBA 2VU9A 1RG8A 4AN7B 2ZR1B 2UUSA 4J2SA 2ESUA 3CRHA 5F8SA 1JQZA 3N7MA 3BB2A 4D8HA 2FFVA 3BA7A 4GP0A 3A22A 2Q9XA 3Q7WA 1BFCA 3KMVA 3HN1A 3SNVA 4GOVA 4ISRA 2Y9WC 2D7IA 1FMZA 3JRRA 2VUAA 3VWCA 3BAQA 3BAOA 3ZC9A 3BAGA 4I7IA 3HOMA 2AQZA 3FJKA 1HWOB 3WMVA 4Z9WB 1IOBA 2KKIA 1G82A 4I4VA 1AVXB 4J23B 2F2FA 1YXWA 3CA1A 21BIA 2E4MC 1OQLB 1AF9A 1PC8B 1DFCA 3CRGA 1WD4A 1AVUA 2KI6B 4GAIA 4KEJA 3OGFA 4LO7C 4I8MA 2BFHA 1ABRB 4ZFYB 2BEAA 3UD9A 2RG9B 3QR5A 4GP3A 3PUBA 1L2HA 2X2SA 4LO2A 4P0LA 3Q7YA 4QD2B 2FO1A 2AXMA 4II0A 3FUQA 2XOAA 3FJ9A 4XFUA 5BXSA 1JT3A 3I29B 4I4YA 5BP5A 3ZXGA 2Z48A 1WBCA 4L4IA 4Z8SB 5D61A 4QO3A 4X39A 2HWAA 4ZGRB 3D7WB 4DEPA 3IIRA 3O44A 3FFZA 3K1XA 3RMYA 1JLXA 3AKFA 3CA5A 4ENDA 3VUOA 1K5VA 1DLLA 3CA6A 2K8RA 2VXRA 4JQ0A 2DS0A 2LIEA 1IHKA 3FJFA 2BEBA 2HW9A 1DJSB 5F8WA 4G6JA 5JMCA 9ILBA 1FV2A 1S0DA 3S8JA 2D43A 1D0HA 1XYFA 3T8SA 1DQGA 3VT1A 8I1BA 3CAHA 4OEFA 1F31A 4OUJA 1DFQA 1JT4A 4UY4A 3O4CA 4I4QA 1FV3A 3AJ6A 3UD8A 2ZQNA 1YBIA 1TIEA 1JY0A 3E8LC 1TOOA 1R8OA 4R6UB 3BA4A 3WINA 4I3NA 1G9CA 2KI4A 1TWMA 1DZCA 4DENA 5FZZA 1Q1UA 31BIA 3A07A 5JLVA 3R4SA 1IILA 1S0FA 3A23A 1ISXA 4KEKA 1CE7B 4A7YA 3FJHA 2L5XA 2D20A 4TLPA 1SZ6B 3OJVA 4G9MA 4H9WA 1G9DA 4EEEB 3CA4A 1V6UA 3AKHA 1S0EA 3C9ZA 3H6RB 2VXTI 2IWTB 1BLAA 3IAGC 3O5WB 1SR4A 5EC5A 2WRYA 2NP0A 3FGMA 1N4KA 3NBCA 4H75A 4IYBA 4L4HA 2NZ9A 2GZBA 1IRAX 2AAIB 4FGFA 3H6RA 3W9TA 4J2XA 5HPZA 2NYYA 4DCKC 3F1RA 5D63A 2K4AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISV A;  3CRI A;  4ZLB B;  4Q9P A;  4I4P A;  3TC2 A;  3BRG C;  2X2T A;  3QYD A;  3O49 A;  1P63 A;  4OEE A;  3PG0 A;  1PZZ A;  4OW4 A;  1FN0 A;  2ERM A;  1JT5 A;  3ILA A;  5E24 E;  1II4 A;  4LO3 C;  2D44 A;  2D23 A;  3AZV A;  3I2X A;  4QAL A;  1IT0 A;  4IHZ A;  4KEI A;  5BQU A;  4OWK A;  3EF2 A;  3N7L A;  3ZC8 A;  3VSZ A;  3JUT A;  4XFT A;  2D24 A;  1MC9 A;  1DIW A;  3CU1 B;  3N7J A;  4XFS A;  2F8X C;  1T4Q A;  3BAV A;  3CA0 A;  1HWP B;  1VCL A;  2NVH A;  1QQL A;  3ZX7 A;  2VSA A;  1HCE A;  4LO1 C;  5DVH A;  2MC2 A;  4F34 A;  2ET2 A;  3WO3 A;  2KLL A;  4QBV A;  3POK A;  2IHO A;  4ZFW B;  1XG6 A;  1JT7 A;  5D62 A;  1I1E A;  1WBA A;  3FJE A;  4I6I A;  4Q9G A;  5EG6 C;  3BRF A;  3UD7 A;  1S0C A;  3P53 A;  2Y9X E;  3FJJ A;  3BAD A;  4ION A;  1AFC A;  3IM6 A;  4JKQ A;  4FVV A;  4HJJ A;  2ZQO A;  5GAQ A;  1HCD A;  2Q3N B;  4XKI A;  2LIQ A;  3VEQ A;  2GO2 A;  4I4R A;  3OBR A;  4JKX B;  3IM7 A;  1Z4S A;  1QQK A;  4LO7 B;  4PC4 A;  2E4M A;  2DRZ A;  5FZY A;  3WMU A;  4I37 A;  3ZXD A;  3V0B B;  4G1R A;  3OJ2 A;  1NUN A;  4QBC A;  1TTU A;  1Q03 A;  3NBE A;  3HSM A;  3AH2 A;  2Z49 A;  4OWL A;  1GGP B;  1AXM A;  3UJ0 A;  5F8Y A;  3V0B A;  3FUO A;  3LTQ A;  4YOL A;  2Y9G A;  4QKR A;  1S0B A;  1RY7 A;  2P23 A;  3FJC A;  1IRP A;  4IZE A;  1G9A A;  3BTA A;  4WBC A;  1E0O A;  3HBW A;  4AN6 A;  4HR6 C;  5BXT A;  3VSF A;  2QN4 A;  3CA3 A;  3A21 A;  5FNW A;  1FWV A;  1DQO A;  4HA2 A;  4EFR A;  1FQ9 A;  5G00 A;  1BAR A;  4Q91 A;  1JTC A;  4JRA A;  4QKS A;  3B9U A;  5FNX A;  3FJB A;  3NJ5 A;  1I1B A;  3VT0 A;  1BFG A;  1UPS A;  3PHZ A;  2D22 A;  5DZU A;  3R4U A;  4J2K A;  3IM5 A;  1PWA A;  3AKI A;  3UJ4 A;  4EKX B;  3WO2 A;  2F2F C;  5BOW A;  3MAL A;  4A7K A;  4D0T A;  4D0Z A;  3S8K A;  1EYL A;  4GAF A;  3FJI A;  1J0S A;  1K5U A;  1V6V A;  3FJ8 A;  3HAL A;  3OJM A;  4I96 A;  2M49 A;  3LLP A;  1Q04 A;  5FZU A;  5I1B A;  1KNM A;  2AFG A;  2P39 A;  2RST A;  3N7K A;  1S0G A;  3AH1 A;  1YTO A;  2FFU A;  3BAU A;  4LO2 C;  4QC4 A;  1BLD A;  1JLY A;  2HZ9 A;  1FMM S;  1RZO B;  4P6A A;  4ZKT B;  3P6I A;  3I2A A;  1BFF A;  3V0A B;  1CVS A;  1TFM B;  3AZW A;  1ISY A;  4IQP A;  5BP5 C;  1DZD A;  3OBT A;  1NZK A;  4ISQ A;  4LO8 B;  4QD2 C;  1BFB A;  2DRE A;  3O4D A;  3O4O A;  3AJ5 A;  4LO0 C;  4IY8 A;  5BXR A;  2QYI B;  3PME A;  4EB2 B;  4I1B A;  4X38 A;  3BAH A;  3V0A A;  5BXP A;  3RTI B;  3BA5 A;  1PUU B;  1YYN A;  3FJA A;  3VT2 A;  2VSE A;  4USO A;  4G9N A;  3HMY A;  3MPP G;  3O3Q A;  1M16 A;  2MIB A;  5F90 A;  4IZX A;  1HWN B;  4GOY A;  4KC3 A;  4JAW A;  4I1E A;  2KH2 A;  4JP0 A;  5DUY A;  2FDB M;  1ISZ A;  2VLC A;  2K43 A;  3WO4 A;  3O4B A;  7I1B A;  1TWE A;  1FGA A;  3V79 C;  2HWM A;  4LO3 A;  1W3F A;  4P0J A;  1HKN A;  4I4S A;  4OWJ A;  3FJD A;  4IY9 A;  3O4A A;  2NTD A;  1TP0 A;  4A7Z A;  2D1Z A;  1S0L A;  2RQ9 A;  3WIN C;  3NBN A;  1V6W A;  1WD3 A;  1Z2V A;  4X37 A;  1PUM B;  4LO0 A;  4ZA3 B;  4LO1 A;  1ONK B;  3AKG A;  4EFQ A;  2R9K B;  5EHA A;  3N0K A;  4JPZ A;  4P0K A;  1HIB A;  2Y9F A;  1R8N A;  1AVW B;  4I4U A;  3RMX A;  1MD6 A;  4I4O A;  1W3A A;  3AH4 A;  4G6M A;  3WA1 A;  4H04 A;  1EV2 A;  1BAS A;  1SR4 C;  2FGF A;  2YUG A;  4J2Y A;  4USP A;  1QXM A;  3BRD A;  4OEG A;  1BA7 A;  1HWM B;  5DSS B;  2WBC A;  1IJT A;  3RTJ B;  4ZBV B;  1T9F A;  4I0Y A;  5BVP I;  1YF8 B;  4KBB A;  3F62 B;  1EVT A;  1EPW A;  3H6Q A;  3RSJ A;  1FWU A;  2D7R A;  3NBD A;  2DRY A;  4X3A A;  41BI A;  1A8D A;  4ZOT A;  5B2H A;  1ISW A;  2J3P A;  4CJM A;  1ITB A;  3H6S E;  5BQU C;  1XZZ A;  4I2S A;  4F83 A;  1AVA C;  3CQA A;  6I1B A;  3OGG A;  2MLL B;  3Q7X A;  1RML A;  3UDA A;  4ZFU B;  2NM1 A;  1Z0H A;  1W3G A;  1M2T B;  2I1B A;  3BX1 C;  1ILR 1;  3P6J A;  4EFP A;  1V6X A;  1G9B A;  4I4X A;  1XHB A;  2VU9 A;  1RG8 A;  4AN7 B;  2ZR1 B;  2UUS A;  4J2S A;  2ESU A;  3CRH A;  5F8S A;  1JQZ A;  3N7M A;  3BB2 A;  4D8H A;  2FFV A;  3BA7 A;  4GP0 A;  3A22 A;  2Q9X A;  3Q7W A;  1BFC A;  3KMV A;  3HN1 A;  3SNV A;  4GOV A;  4ISR A;  2Y9W C;  2D7I A;  1FMZ A;  3JRR A;  2VUA A;  3VWC A;  3BAQ A;  3BAO A;  3ZC9 A;  3BAG A;  4I7I A;  3HOM A;  2AQZ A;  3FJK A;  1HWO B;  3WMV A;  4Z9W B;  1IOB A;  2KKI A;  1G82 A;  4I4V A;  1AVX B;  4J23 B;  2F2F A;  1YXW A;  3CA1 A;  21BI A;  2E4M C;  1OQL B;  1AF9 A;  1PC8 B;  1DFC A;  3CRG A;  1WD4 A;  1AVU A;  2KI6 B;  4GAI A;  4KEJ A;  3OGF A;  4LO7 C;  4I8M A;  2BFH A;  1ABR B;  4ZFY B;  2BEA A;  3UD9 A;  2RG9 B;  3QR5 A;  4GP3 A;  3PUB A;  1L2H A;  2X2S A;  4LO2 A;  4P0L A;  3Q7Y A;  4QD2 B;  2FO1 A;  2AXM A;  4II0 A;  3FUQ A;  2XOA A;  3FJ9 A;  4XFU A;  5BXS A;  1JT3 A;  3I29 B;  4I4Y A;  5BP5 A;  3ZXG A;  2Z48 A;  1WBC A;  4L4I A;  4Z8S B;  5D61 A;  4QO3 A;  4X39 A;  2HWA A;  4ZGR B;  3D7W B;  4DEP A;  3IIR A;  3O44 A;  3FFZ A;  3K1X A;  3RMY A;  1JLX A;  3AKF A;  3CA5 A;  4END A;  3VUO A;  1K5V A;  1DLL A;  3CA6 A;  2K8R A;  2VXR A;  4JQ0 A;  2DS0 A;  2LIE A;  1IHK A;  3FJF A;  2BEB A;  2HW9 A;  1DJS B;  5F8W A;  4G6J A;  5JMC A;  9ILB A;  1FV2 A;  1S0D A;  3S8J A;  2D43 A;  1D0H A;  1XYF A;  3T8S A;  1DQG A;  3VT1 A;  8I1B A;  3CAH A;  4OEF A;  1F31 A;  4OUJ A;  1DFQ A;  1JT4 A;  3O4C A;  4I4Q A;  1FV3 A;  3AJ6 A;  3UD8 A;  2ZQN A;  1YBI A;  1TIE A;  1JY0 A;  3E8L C;  1TOO A;  1R8O A;  4R6U B;  3BA4 A;  3WIN A;  4I3N A;  1G9C A;  2KI4 A;  1TWM A;  1DZC A;  4DEN A;  5FZZ A;  1Q1U A;  31BI A;  3A07 A;  5JLV A;  3R4S A;  1IIL A;  1S0F A;  3A23 A;  1ISX A;  4KEK A;  1CE7 B;  4A7Y A;  3FJH A;  2L5X A;  2D20 A;  4TLP A;  1SZ6 B;  3OJV A;  4G9M A;  4H9W A;  1G9D A;  4EEE B;  3CA4 A;  1V6U A;  3AKH A;  1S0E A;  3C9Z A;  3H6R B;  2VXT I;  2IWT B;  1BLA A;  3IAG C;  3O5W B;  1SR4 A;  5EC5 A;  2WRY A;  2NP0 A;  3FGM A;  1N4K A;  3NBC A;  4IYB A;  4L4H A;  2NZ9 A;  2GZB A;  1IRA X;  2AAI B;  4FGF A;  3H6R A;  3W9T A;  4J2X A;  5HPZ A;  2NYY A;  4DCK C;  3F1R A;  5D63 A;  2K4A B; 
#chains in the Genus database with same CATH topology
 1ISV A;  3CRI A;  4ZLB B;  4Q9P A;  4I4P A;  3TC2 A;  3BRG C;  2X2T A;  3QYD A;  3O49 A;  1P63 A;  4OEE A;  3PG0 A;  1PZZ A;  4OW4 A;  1FN0 A;  2ERM A;  1JT5 A;  3ILA A;  5E24 E;  1II4 A;  4LO3 C;  2D44 A;  2D23 A;  3AZV A;  3I2X A;  4QAL A;  1IT0 A;  4IHZ A;  4KEI A;  5BQU A;  4OWK A;  3EF2 A;  3N7L A;  3ZC8 A;  3VSZ A;  3JUT A;  4XFT A;  2D24 A;  1MC9 A;  1DIW A;  3CU1 B;  3N7J A;  4XFS A;  2F8X C;  1T4Q A;  3BAV A;  3CA0 A;  1HWP B;  1VCL A;  2NVH A;  1QQL A;  3ZX7 A;  2VSA A;  1HCE A;  4LO1 C;  5DVH A;  2MC2 A;  4F34 A;  2ET2 A;  3WO3 A;  2KLL A;  4QBV A;  3POK A;  2IHO A;  4ZFW B;  1XG6 A;  1JT7 A;  5D62 A;  1I1E A;  1WBA A;  3FJE A;  4I6I A;  4Q9G A;  5EG6 C;  3BRF A;  3UD7 A;  1S0C A;  3P53 A;  2Y9X E;  3FJJ A;  3BAD A;  4ION A;  1AFC A;  3IM6 A;  4JKQ A;  4FVV A;  4HJJ A;  2ZQO A;  5GAQ A;  1HCD A;  2Q3N B;  4XKI A;  2LIQ A;  3VEQ A;  2GO2 A;  4I4R A;  3OBR A;  4JKX B;  3IM7 A;  1Z4S A;  1QQK A;  4LO7 B;  4PC4 A;  2E4M A;  2DRZ A;  5FZY A;  3WMU A;  4I37 A;  3ZXD A;  3V0B B;  4G1R A;  3OJ2 A;  1NUN A;  4QBC A;  1TTU A;  1Q03 A;  3NBE A;  3HSM A;  3AH2 A;  2Z49 A;  4OWL A;  1GGP B;  1AXM A;  3UJ0 A;  5F8Y A;  3V0B A;  3FUO A;  3LTQ A;  4YOL A;  2Y9G A;  4QKR A;  4MZF B;  1S0B A;  1RY7 A;  2P23 A;  3FJC A;  1IRP A;  4IZE A;  1G9A A;  3BTA A;  4WBC A;  1E0O A;  3HBW A;  4AN6 A;  4HR6 C;  4MZG B;  5BXT A;  3VSF A;  2QN4 A;  3CA3 A;  3A21 A;  5FNW A;  1FWV A;  1DQO A;  4HA2 A;  4EFR A;  1FQ9 A;  5G00 A;  1BAR A;  4Q91 A;  1JTC A;  4JRA A;  4QKS A;  3B9U A;  5FNX A;  3FJB A;  3NJ5 A;  1I1B A;  3VT0 A;  1BFG A;  1UPS A;  3PHZ A;  2D22 A;  5DZU A;  3R4U A;  4J2K A;  3IM5 A;  1PWA A;  3AKI A;  3UJ4 A;  4EKX B;  3WO2 A;  2F2F C;  5BOW A;  3MAL A;  4A7K A;  4D0T A;  4D0Z A;  3S8K A;  1EYL A;  4GAF A;  3FJI A;  1J0S A;  1K5U A;  1V6V A;  3FJ8 A;  3HAL A;  3OJM A;  4I96 A;  4MZH A;  2M49 A;  3LLP A;  1Q04 A;  5FZU A;  5I1B A;  1KNM A;  2AFG A;  2P39 A;  2RST A;  3N7K A;  1S0G A;  3AH1 A;  1YTO A;  2FFU A;  3BAU A;  4LO2 C;  4QC4 A;  1BLD A;  1JLY A;  2HZ9 A;  1FMM S;  1RZO B;  4P6A A;  4ZKT B;  3P6I A;  3I2A A;  1BFF A;  3V0A B;  1CVS A;  1TFM B;  3AZW A;  2NS2 A;  1ISY A;  4IQP A;  5BP5 C;  1DZD A;  3OBT A;  1NZK A;  4ISQ A;  4LO8 B;  4QD2 C;  1BFB A;  2DRE A;  3O4D A;  3O4O A;  3AJ5 A;  4LO0 C;  4IY8 A;  5BXR A;  2QYI B;  3PME A;  4EB2 B;  4I1B A;  4X38 A;  3BAH A;  3V0A A;  5BXP A;  3RTI B;  3BA5 A;  1PUU B;  1YYN A;  3FJA A;  3VT2 A;  2VSE A;  4USO A;  4G9N A;  3HMY A;  3MPP G;  3O3Q A;  1M16 A;  2MIB A;  5F90 A;  4IZX A;  1HWN B;  4GOY A;  4KC3 A;  4JAW A;  4I1E A;  2KH2 A;  4JP0 A;  5DUY A;  2FDB M;  1ISZ A;  2VLC A;  2K43 A;  3WO4 A;  3O4B A;  7I1B A;  1TWE A;  1FGA A;  3V79 C;  2HWM A;  4LO3 A;  1W3F A;  4P0J A;  1HKN A;  4I4S A;  4OWJ A;  3FJD A;  4IY9 A;  3O4A A;  2NTD A;  1TP0 A;  4A7Z A;  2D1Z A;  1S0L A;  2RQ9 A;  3WIN C;  3NBN A;  1V6W A;  1WD3 A;  1Z2V A;  4X37 A;  1PUM B;  4LO0 A;  4ZA3 B;  4LO1 A;  1ONK B;  3AKG A;  4EFQ A;  2R9K B;  5EHA A;  3N0K A;  4JPZ A;  4P0K A;  1HIB A;  2Y9F A;  1R8N A;  1AVW B;  4I4U A;  3RMX A;  1MD6 A;  4I4O A;  1W3A A;  3AH4 A;  4G6M A;  3WA1 A;  4H04 A;  1EV2 A;  1BAS A;  1SR4 C;  2FGF A;  2YUG A;  4J2Y A;  4USP A;  1QXM A;  3BRD A;  4OEG A;  1BA7 A;  1HWM B;  5DSS B;  2WBC A;  1IJT A;  3RTJ B;  4ZBV B;  1T9F A;  4I0Y A;  5BVP I;  1YF8 B;  4KBB A;  3F62 B;  1EVT A;  1EPW A;  3H6Q A;  3RSJ A;  1FWU A;  2D7R A;  3NBD A;  2DRY A;  4X3A A;  41BI A;  1A8D A;  4ZOT A;  5B2H A;  1ISW A;  2J3P A;  4CJM A;  1ITB A;  3H6S E;  5BQU C;  1XZZ A;  4I2S A;  4F83 A;  1AVA C;  3CQA A;  6I1B A;  3OGG A;  2MLL B;  3Q7X A;  1RML A;  3UDA A;  4ZFU B;  2NM1 A;  1Z0H A;  1W3G A;  1M2T B;  2I1B A;  3BX1 C;  1ILR 1;  3P6J A;  4EFP A;  1V6X A;  1G9B A;  4I4X A;  1XHB A;  2VU9 A;  1RG8 A;  4AN7 B;  2ZR1 B;  2UUS A;  4J2S A;  2ESU A;  3CRH A;  5F8S A;  1JQZ A;  3N7M A;  3BB2 A;  4D8H A;  2FFV A;  3BA7 A;  4GP0 A;  3A22 A;  2Q9X A;  3Q7W A;  1BFC A;  3KMV A;  3HN1 A;  3SNV A;  4GOV A;  4ISR A;  2Y9W C;  2D7I A;  1FMZ A;  3JRR A;  2VUA A;  3VWC A;  3BAQ A;  3BAO A;  3ZC9 A;  3BAG A;  4I7I A;  3HOM A;  2AQZ A;  3FJK A;  1HWO B;  3WMV A;  4Z9W B;  1IOB A;  2KKI A;  1G82 A;  4I4V A;  1AVX B;  4J23 B;  2F2F A;  1YXW A;  3CA1 A;  21BI A;  2E4M C;  1OQL B;  1AF9 A;  1PC8 B;  1DFC A;  3CRG A;  1WD4 A;  1AVU A;  2KI6 B;  4GAI A;  4KEJ A;  3OGF A;  4LO7 C;  4I8M A;  2BFH A;  1ABR B;  4ZFY B;  2BEA A;  3UD9 A;  2RG9 B;  3QR5 A;  4GP3 A;  3PUB A;  1L2H A;  2X2S A;  4LO2 A;  4P0L A;  3Q7Y A;  4QD2 B;  2FO1 A;  2AXM A;  4II0 A;  3FUQ A;  2XOA A;  3FJ9 A;  4XFU A;  5BXS A;  1JT3 A;  3I29 B;  4I4Y A;  5BP5 A;  3ZXG A;  2Z48 A;  1WBC A;  4L4I A;  4Z8S B;  5D61 A;  4QO3 A;  4X39 A;  2HWA A;  4ZGR B;  3D7W B;  4DEP A;  3IIR A;  3O44 A;  3FFZ A;  3K1X A;  3RMY A;  1JLX A;  3AKF A;  3CA5 A;  4END A;  3VUO A;  1K5V A;  1DLL A;  3CA6 A;  2K8R A;  2VXR A;  4JQ0 A;  2DS0 A;  2LIE A;  1IHK A;  3FJF A;  2BEB A;  2HW9 A;  1DJS B;  5F8W A;  4G6J A;  5JMC A;  9ILB A;  1FV2 A;  1S0D A;  3S8J A;  2D43 A;  1D0H A;  1XYF A;  3T8S A;  1DQG A;  3VT1 A;  8I1B A;  3CAH A;  4OEF A;  1F31 A;  4OUJ A;  1DFQ A;  1JT4 A;  4UY4 A;  3O4C A;  4I4Q A;  1FV3 A;  3AJ6 A;  3UD8 A;  2ZQN A;  1YBI A;  1TIE A;  1JY0 A;  3E8L C;  1TOO A;  1R8O A;  4R6U B;  3BA4 A;  3WIN A;  4I3N A;  1G9C A;  2KI4 A;  1TWM A;  1DZC A;  4DEN A;  5FZZ A;  1Q1U A;  31BI A;  3A07 A;  5JLV A;  3R4S A;  1IIL A;  1S0F A;  3A23 A;  1ISX A;  4KEK A;  1CE7 B;  4A7Y A;  3FJH A;  2L5X A;  2D20 A;  4TLP A;  1SZ6 B;  3OJV A;  4G9M A;  4H9W A;  1G9D A;  4EEE B;  3CA4 A;  1V6U A;  3AKH A;  1S0E A;  3C9Z A;  3H6R B;  2VXT I;  2IWT B;  1BLA A;  3IAG C;  3O5W B;  1SR4 A;  5EC5 A;  2WRY A;  2NP0 A;  3FGM A;  1N4K A;  3NBC A;  4H75 A;  4IYB A;  4L4H A;  2NZ9 A;  2GZB A;  1IRA X;  2AAI B;  4FGF A;  3H6R A;  3W9T A;  4J2X A;  5HPZ A;  2NYY A;  4DCK C;  3F1R A;  5D63 A;  2K4A B; 
#chains in the Genus database with same CATH homology
 1ISV A;  3CRI A;  4ZLB B;  4Q9P A;  4I4P A;  3TC2 A;  3BRG C;  2X2T A;  3QYD A;  3O49 A;  1P63 A;  4OEE A;  3PG0 A;  1PZZ A;  4OW4 A;  1FN0 A;  2ERM A;  1JT5 A;  3ILA A;  5E24 E;  1II4 A;  4LO3 C;  2D44 A;  2D23 A;  3AZV A;  3I2X A;  4QAL A;  1IT0 A;  4IHZ A;  4KEI A;  5BQU A;  4OWK A;  3EF2 A;  3N7L A;  3ZC8 A;  3VSZ A;  3JUT A;  4XFT A;  2D24 A;  1MC9 A;  1DIW A;  3CU1 B;  3N7J A;  4XFS A;  2F8X C;  1T4Q A;  3BAV A;  3CA0 A;  1HWP B;  1VCL A;  2NVH A;  1QQL A;  3ZX7 A;  2VSA A;  1HCE A;  4LO1 C;  5DVH A;  2MC2 A;  4F34 A;  2ET2 A;  3WO3 A;  2KLL A;  4QBV A;  3POK A;  2IHO A;  4ZFW B;  1XG6 A;  1JT7 A;  5D62 A;  1I1E A;  1WBA A;  3FJE A;  4I6I A;  4Q9G A;  5EG6 C;  3BRF A;  3UD7 A;  1S0C A;  3P53 A;  2Y9X E;  3FJJ A;  3BAD A;  4ION A;  1AFC A;  3IM6 A;  4JKQ A;  4FVV A;  4HJJ A;  2ZQO A;  5GAQ A;  1HCD A;  2Q3N B;  4XKI A;  2LIQ A;  3VEQ A;  2GO2 A;  4I4R A;  3OBR A;  4JKX B;  3IM7 A;  1Z4S A;  1QQK A;  4LO7 B;  4PC4 A;  2E4M A;  2DRZ A;  5FZY A;  3WMU A;  4I37 A;  3ZXD A;  3V0B B;  4G1R A;  3OJ2 A;  1NUN A;  4QBC A;  1TTU A;  1Q03 A;  3NBE A;  3HSM A;  3AH2 A;  2Z49 A;  4OWL A;  1GGP B;  1AXM A;  3UJ0 A;  5F8Y A;  3V0B A;  3FUO A;  3LTQ A;  4YOL A;  2Y9G A;  4QKR A;  4MZF B;  1S0B A;  1RY7 A;  2P23 A;  3FJC A;  1IRP A;  4IZE A;  1G9A A;  3BTA A;  4WBC A;  1E0O A;  3HBW A;  4AN6 A;  4HR6 C;  4MZG B;  5BXT A;  3VSF A;  2QN4 A;  3CA3 A;  3A21 A;  5FNW A;  1FWV A;  1DQO A;  4HA2 A;  4EFR A;  1FQ9 A;  5G00 A;  1BAR A;  4Q91 A;  1JTC A;  4JRA A;  4QKS A;  3B9U A;  5FNX A;  3FJB A;  3NJ5 A;  1I1B A;  3VT0 A;  1BFG A;  1UPS A;  3PHZ A;  2D22 A;  5DZU A;  3R4U A;  4J2K A;  3IM5 A;  1PWA A;  3AKI A;  3UJ4 A;  4EKX B;  3WO2 A;  2F2F C;  5BOW A;  3MAL A;  4A7K A;  4D0T A;  4D0Z A;  3S8K A;  1EYL A;  4GAF A;  3FJI A;  1J0S A;  1K5U A;  1V6V A;  3FJ8 A;  3HAL A;  3OJM A;  4I96 A;  4MZH A;  2M49 A;  3LLP A;  1Q04 A;  5FZU A;  5I1B A;  1KNM A;  2AFG A;  2P39 A;  2RST A;  3N7K A;  1S0G A;  3AH1 A;  1YTO A;  2FFU A;  3BAU A;  4LO2 C;  4QC4 A;  1BLD A;  1JLY A;  2HZ9 A;  1FMM S;  1RZO B;  4P6A A;  4ZKT B;  3P6I A;  3I2A A;  1BFF A;  3V0A B;  1CVS A;  1TFM B;  3AZW A;  2NS2 A;  1ISY A;  4IQP A;  5BP5 C;  1DZD A;  3OBT A;  1NZK A;  4ISQ A;  4LO8 B;  4QD2 C;  1BFB A;  2DRE A;  3O4D A;  3O4O A;  3AJ5 A;  4LO0 C;  4IY8 A;  5BXR A;  2QYI B;  3PME A;  4EB2 B;  4I1B A;  4X38 A;  3BAH A;  3V0A A;  5BXP A;  3RTI B;  3BA5 A;  1PUU B;  1YYN A;  3FJA A;  3VT2 A;  2VSE A;  4USO A;  4G9N A;  3HMY A;  3MPP G;  3O3Q A;  1M16 A;  2MIB A;  5F90 A;  4IZX A;  1HWN B;  4GOY A;  4KC3 A;  4JAW A;  4I1E A;  2KH2 A;  4JP0 A;  5DUY A;  2FDB M;  1ISZ A;  2VLC A;  2K43 A;  3WO4 A;  3O4B A;  7I1B A;  1TWE A;  1FGA A;  3V79 C;  2HWM A;  4LO3 A;  1W3F A;  4P0J A;  1HKN A;  4I4S A;  4OWJ A;  3FJD A;  4IY9 A;  3O4A A;  2NTD A;  1TP0 A;  4A7Z A;  2D1Z A;  1S0L A;  2RQ9 A;  3WIN C;  3NBN A;  1V6W A;  1WD3 A;  1Z2V A;  4X37 A;  1PUM B;  4LO0 A;  4ZA3 B;  4LO1 A;  1ONK B;  3AKG A;  4EFQ A;  2R9K B;  5EHA A;  3N0K A;  4JPZ A;  4P0K A;  1HIB A;  2Y9F A;  1R8N A;  1AVW B;  4I4U A;  3RMX A;  1MD6 A;  4I4O A;  1W3A A;  3AH4 A;  4G6M A;  3WA1 A;  4H04 A;  1EV2 A;  1BAS A;  1SR4 C;  2FGF A;  2YUG A;  4J2Y A;  4USP A;  1QXM A;  3BRD A;  4OEG A;  1BA7 A;  1HWM B;  5DSS B;  2WBC A;  1IJT A;  3RTJ B;  4ZBV B;  1T9F A;  4I0Y A;  5BVP I;  1YF8 B;  4KBB A;  3F62 B;  1EVT A;  1EPW A;  3H6Q A;  3RSJ A;  1FWU A;  2D7R A;  3NBD A;  2DRY A;  4X3A A;  41BI A;  1A8D A;  4ZOT A;  5B2H A;  1ISW A;  2J3P A;  4CJM A;  1ITB A;  3H6S E;  5BQU C;  1XZZ A;  4I2S A;  4F83 A;  1AVA C;  3CQA A;  6I1B A;  3OGG A;  2MLL B;  3Q7X A;  1RML A;  3UDA A;  4ZFU B;  2NM1 A;  1Z0H A;  1W3G A;  1M2T B;  2I1B A;  3BX1 C;  1ILR 1;  3P6J A;  4EFP A;  1V6X A;  1G9B A;  4I4X A;  1XHB A;  2VU9 A;  1RG8 A;  4AN7 B;  2ZR1 B;  2UUS A;  4J2S A;  2ESU A;  3CRH A;  5F8S A;  1JQZ A;  3N7M A;  3BB2 A;  4D8H A;  2FFV A;  3BA7 A;  4GP0 A;  3A22 A;  2Q9X A;  3Q7W A;  1BFC A;  3KMV A;  3HN1 A;  3SNV A;  4GOV A;  4ISR A;  2Y9W C;  2D7I A;  1FMZ A;  3JRR A;  2VUA A;  3VWC A;  3BAQ A;  3BAO A;  3ZC9 A;  3BAG A;  4I7I A;  3HOM A;  2AQZ A;  3FJK A;  1HWO B;  3WMV A;  4Z9W B;  1IOB A;  2KKI A;  1G82 A;  4I4V A;  1AVX B;  4J23 B;  2F2F A;  1YXW A;  3CA1 A;  21BI A;  2E4M C;  1OQL B;  1AF9 A;  1PC8 B;  1DFC A;  3CRG A;  1WD4 A;  1AVU A;  2KI6 B;  4GAI A;  4KEJ A;  3OGF A;  4LO7 C;  4I8M A;  2BFH A;  1ABR B;  4ZFY B;  2BEA A;  3UD9 A;  2RG9 B;  3QR5 A;  4GP3 A;  3PUB A;  1L2H A;  2X2S A;  4LO2 A;  4P0L A;  3Q7Y A;  4QD2 B;  2FO1 A;  2AXM A;  4II0 A;  3FUQ A;  2XOA A;  3FJ9 A;  4XFU A;  5BXS A;  1JT3 A;  3I29 B;  4I4Y A;  5BP5 A;  3ZXG A;  2Z48 A;  1WBC A;  4L4I A;  4Z8S B;  5D61 A;  4QO3 A;  4X39 A;  2HWA A;  4ZGR B;  3D7W B;  4DEP A;  3IIR A;  3O44 A;  3FFZ A;  3K1X A;  3RMY A;  1JLX A;  3AKF A;  3CA5 A;  4END A;  3VUO A;  1K5V A;  1DLL A;  3CA6 A;  2K8R A;  2VXR A;  4JQ0 A;  2DS0 A;  2LIE A;  1IHK A;  3FJF A;  2BEB A;  2HW9 A;  1DJS B;  5F8W A;  4G6J A;  5JMC A;  9ILB A;  1FV2 A;  1S0D A;  3S8J A;  2D43 A;  1D0H A;  1XYF A;  3T8S A;  1DQG A;  3VT1 A;  8I1B A;  3CAH A;  4OEF A;  1F31 A;  4OUJ A;  1DFQ A;  1JT4 A;  4UY4 A;  3O4C A;  4I4Q A;  1FV3 A;  3AJ6 A;  3UD8 A;  2ZQN A;  1YBI A;  1TIE A;  1JY0 A;  3E8L C;  1TOO A;  1R8O A;  4R6U B;  3BA4 A;  3WIN A;  4I3N A;  1G9C A;  2KI4 A;  1TWM A;  1DZC A;  4DEN A;  5FZZ A;  1Q1U A;  31BI A;  3A07 A;  5JLV A;  3R4S A;  1IIL A;  1S0F A;  3A23 A;  1ISX A;  4KEK A;  1CE7 B;  4A7Y A;  3FJH A;  2L5X A;  2D20 A;  4TLP A;  1SZ6 B;  3OJV A;  4G9M A;  4H9W A;  1G9D A;  4EEE B;  3CA4 A;  1V6U A;  3AKH A;  1S0E A;  3C9Z A;  3H6R B;  2VXT I;  2IWT B;  1BLA A;  3IAG C;  3O5W B;  1SR4 A;  5EC5 A;  2WRY A;  2NP0 A;  3FGM A;  1N4K A;  3NBC A;  4H75 A;  4IYB A;  4L4H A;  2NZ9 A;  2GZB A;  1IRA X;  2AAI B;  4FGF A;  3H6R A;  3W9T A;  4J2X A;  5HPZ A;  2NYY A;  4DCK C;  3F1R A;  5D63 A;  2K4A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...