5DUYA

Structure of lectin from the sea mussel crenomytilus grayanus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
150
structure length
150
Chain Sequence
b'MTTFLIKHKASGKFLHPYGGSSNPANNTKLVLHSDIHERMYFQFDVVDERWGYIKHVASGKIVHPYGGQANPPNETNMVLHQDRHDRALFAMDFFNDNIMHKGGKYIHPKGGSPNPPNNTETVIHGDKHAAMEFIFVSPKNKDKRVLVYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GalNAc/Gal-specific lectin
publication title Structure of a lectin from the sea mussel Crenomytilus grayanus (CGL).
pubmed doi rcsb
source organism Crenomytilus grayanus
molecule tags Sugar binding protein
total genus 40
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5duyA00
1WD4A 1JY0A 4I4UA 1IILA 5FNWA 3FJDA 4X39A 3FJ9A 1V6WA 4XFSA 2Z49A 1W3AA 2VXTI 3QR5A 1S0EA 21BIA 1HKNA 2VSEA 1NZKA 3Q7XA 4A7KA 3BX1C 2Q9XA 1R8NA 1PUMB 4Q91A 4QALA 1TTUA 1V6UA 3IIRA 4YOLA 5BXSA 3POKA 2F8XC 4I4SA 1HWNB 3CA6A 3OBRA 1S0DA 3AKFA 4I1BA 2J3PA 3SNVA 3FUQA 3H6QA 5BXPA 4IZEA 4EKXB 1WBCA 3Q7YA 5EG6C 3AKGA 4EB2B 4QC4A 2HWMA 5JMCA 5GAQA 1FQ9A 3KMVA 3F1RA 1XZZA 3VSFA 3H6RB 4I0YA 1YBIA 3D7WB 3LTQA 3T8SA 1K5VA 4IYBA 1TFMB 4KEIA 4Q9PA 2HWAA 2MIBA 3VEQA 1ISVA 1BFGA 1TOOA 2F2FA 5F8SA 1WD3A 1DQGA 1G9BA 2HZ9A 4G1RA 3FJKA 3UJ0A 1G82A 1KNMA 3ZXDA 3UD9A 5BQUA 3O5WB 3I2AA 1FV2A 2AAIB 1EPWA 3HBWA 4OWLA 1DIWA 3I29B 3BRDA 5I1BA 3IM6A 4IHZA 3C9ZA 1AFCA 1IRAX 4ZBVB 1AVWB 3NBNA 5DSSB 3N7KA 2AQZA 1DQOA 1BARA 4OWKA 3V0BA 2GZBA 5D63A 3BAQA 4I2SA 1E0OA 1PWAA 1S0CA 4P6AA 1YYNA 3ZC8A 3S8JA 4D8HA 1FMZA 3HSMA 3FFZA 1TWMA 4IQPA 5E24E 4LO2C 2X2TA 1F31A 4LO0A 4F83A 2D7IA 2RQ9A 1BFCA 1VCLA 2ZQNA 3WINA 1IRPA 3W9TA 1HCDA 1FN0A 3FJCA 3IM5A 3O49A 4JQ0A 4R6UB 2KI6B 4QD2B 4Z9WB 2QN4A 1V6XA 3MPPG 1RY7A 2R9KB 2KI4A 4ZLBB 4KBBA 2UUSA 4QKRA 5D62A 4JPZA 3OJMA 1XHBA 1HWOB 4J2SA 2NZ9A 2Z48A 3F62B 1DJSB 3FJAA 1DZCA 5EC5A 4QD2C 2FDBM 1HCEA 1II4A 4LO8B 1JLYA 3RMXA 1M16A 5FZYA 3NJ5A 3NBEA 4I8MA 1JT5A 3FJ8A 2HW9A 3AZVA 1DFCA 5F8YA 2BEAA 4OEGA 1W3GA 4KEJA 2LIQA 3UDAA 1T4QA 3WO3A 3V79C 3ILAA 1PUUB 3CA0A 4LO1C 2KKIA 1XG6A 3WO2A 4G6MA 4OWJA 4J2XA 2K43A 3A23A 1M2TB 4JKQA 4JAWA 4P0LA 1TIEA 1SR4C 4GAFA 3N7MA 1QQLA 3CA3A 1SR4A 4I4YA 3RSJA 1EYLA 5B2HA 4I7IA 4GP3A 4AN7B 2E4MC 3BA4A 4I1EA 2VU9A 3V0AB 1YXWA 1Z4SA 1G9AA 1HWMB 1Z2VA 3PMEA 4HR6C 2RG9B 2D20A 6I1BA 4LO3C 3UD7A 1OQLB 2K4AB 4P0KA 1HIBA 2K8RA 2D1ZA 3NBCA 1W3FA 3AH2A 5F8WA 4EFRA 4QBCA 4JRAA 3ZX7A 4ZA3B 4X37A 3PUBA 3VWCA 3ZC9A 5BVPI 1S0GA 1MD6A 3AH1A 3BAVA 3Q7WA 4GOYA 3A07A 3JRRA 2D22A 4IY8A 9ILBA 2MLLB 4P0JA 4D0TA 4GAIA 3O3QA 3P6IA 4A7ZA 2P23A 2FO1A 3CRGA 1FMMS 4ENDA 1S0BA 7I1BA 4OEEA 2X2SA 2L5XA 4OEFA 4I4XA 1ISWA 3BRGC 3H6RA 4I37A 3CRHA 3WO4A 3HALA 1BLAA 1JLXA 4X3AA 1EV2A 3ZXGA 4L4IA 5BXRA 2BFHA 2D24A 4II0A 3FJBA 3BA5A 4FVVA 1BFFA 4G6JA 5DZUA 8I1BA 4J2KA 1G9DA 2DRYA 2NVHA 3FJEA 3CA5A 3AH4A 1IHKA 2MC2A 3JUTA 1HWPB 3FGMA 4QO3A 3VT0A 2AFGA 3CAHA 4AN6A 1YTOA 4LO2A 3VT1A 2KLLA 4L4HA 3NBDA 2Y9WC 4GP0A 2NM1A 3WA1A 4LO7B 4G9MA 5F90A 1D0HA 4ZOTA 2D43A 1Z0HA 3O4AA 5FZUA 3CA4A 4USPA 3TC2A 1TP0A 4KC3A 3UJ4A 1I1BA 3O4OA 4FGFA 1ISYA 2I1BA 3OJVA 5BOWA 3HMYA 3S8KA 1JTCA 1JQZA 1Q03A 1UPSA 2WBCA 3BRFA 1QQKA 1A8DA 4IY9A 3VT2A 1ISXA 1NUNA 4XFTA 1BA7A 1G9CA 4IZXA 4Q9GA 3BAOA 4ZFUB 1SZ6B 4ISRA 1JT4A 3FJFA 4Z8SB 2Y9XE 3IM7A 4I4RA 3OBTA 5BP5C 1IOBA 5EHAA 4LO1A 4H04A 3AZWA 1AVXB 5DUYA 3N7JA 3CU1B 4D0ZA 4ZFYB 2AXMA 1JT3A 3N7LA 3R4UA 4I3NA 2VLCA 1RZOB 4HA2A 2D7RA 3PHZA 2DREA 3P6JA 1V6VA 3UD8A 4CJMA 3LLPA 1DLLA 2VSAA 1DFQA 2E4MA 2XOAA 3HN1A 4G9NA 4QKSA 3CRIA 4I96A 4HJJA 3RMYA 1CVSA 1ONKB 1S0FA 3AJ6A 3OJ2A 3B9UA 3H6SE 3P53A 3I2XA 3OGFA 1BLDA 4LO3A 3BAUA 4DENA 2Q3NB 1ISZA 1BASA 4OUJA 3VUOA 5FZZA 2RSTA 3N0KA 3OGGA 4DCKC 2Y9FA 4TLPA 3V0AA 2ESUA 2IHOA 2ZR1B 5HPZA 2GO2A 2LIEA 3CA1A 1EVTA 2FFVA 4QBVA 3E8LC 4J2YA 2M49A 3QYDA 2QYIB 1RG8A 2NP0A 3FJIA 1FWUA 41BIA 2VUAA 3PG0A 4ZKTB 3BA7A 1I1EA 4X38A 1FV3A 1AVUA 2IWTB 3IAGC 1AXMA 1XYFA 2WRYA 1AVAC 3BAGA 1Q04A 2F2FC 1K5UA 2DS0A 4ZFWB 2FGFA 1FWVA 1S0LA 2Y9GA 4PC4A 4KEKA 1CE7B 2KH2A 4I4OA 1PZZA 3V0BB 4OW4A 5BQUC 1PC8B 31BIA 1T9FA 4ISQA 4JKXB 1IJTA 5DVHA 1R8OA 5D61A 3FJJA 3A22A 4J23B 4EFPA 2VXRA 1YF8B 4USOA 4DEPA 4EFQA 1J0SA 2NTDA 1ITBA 3CQAA 4IONA 3WMUA 3AKHA 1RMLA 1BFBA 2YUGA 3FUOA 3R4SA 1JT7A 2ET2A 4A7YA 3RTJB 2BEBA 1IT0A 3O4BA 5FNXA 4EEEB 3K1XA 4LO0C 3AJ5A 4LO7C 5G00A 4WBCA 2D44A 2P39A 5JLVA 1L2HA 3BADA 3WINC 1N4KA 3BB2A 3BAHA 4I6IA 3MALA 3RTIB 1WBAA 3WMVA 4JP0A 1AF9A 1ILR1 4H9WA 1MC9A 2ZQOA 4I4PA 3O44A 1DZDA 3BTAA 4I4VA 3O4CA 1P63A 4XFUA 2D23A 3AKIA 5BP5A 2ERMA 1QXMA 2NYYA 2FFUA 5BXTA 4F34A 4GOVA 1GGPB 4XKIA 3A21A 1TWEA 2DRZA 3VSZA 3O4DA 3FJHA 4I4QA 4ZGRB 1Q1UA 3EF2A 3HOMA 1FGAA 1ABRB
chains in the Genus database with same CATH superfamily
1WD4A 1JY0A 4I4UA 1IILA 5FNWA 3FJDA 4X39A 3FJ9A 1V6WA 4XFSA 2Z49A 1W3AA 2VXTI 3QR5A 1S0EA 21BIA 1HKNA 2VSEA 1NZKA 3Q7XA 4A7KA 3BX1C 2Q9XA 1R8NA 1PUMB 4Q91A 4QALA 1TTUA 1V6UA 3IIRA 4YOLA 5BXSA 3POKA 2F8XC 4I4SA 1HWNB 2NS2A 3CA6A 3OBRA 1S0DA 3AKFA 4I1BA 2J3PA 3SNVA 3FUQA 3H6QA 5BXPA 4IZEA 4EKXB 1WBCA 3Q7YA 5EG6C 3AKGA 4EB2B 4QC4A 2HWMA 5JMCA 5GAQA 1FQ9A 3KMVA 3F1RA 1XZZA 3VSFA 3H6RB 4I0YA 1YBIA 3D7WB 3LTQA 3T8SA 1K5VA 4IYBA 1TFMB 4KEIA 4Q9PA 2HWAA 2MIBA 3VEQA 1ISVA 1BFGA 1TOOA 2F2FA 5F8SA 1WD3A 1DQGA 1G9BA 2HZ9A 4G1RA 3FJKA 4H75A 3UJ0A 1G82A 1KNMA 3ZXDA 3UD9A 5BQUA 3O5WB 3I2AA 1FV2A 2AAIB 1EPWA 3HBWA 4OWLA 1DIWA 3I29B 3BRDA 5I1BA 3IM6A 4IHZA 3C9ZA 1AFCA 1IRAX 4ZBVB 1AVWB 3NBNA 5DSSB 3N7KA 2AQZA 1DQOA 1BARA 4OWKA 3V0BA 2GZBA 5D63A 3BAQA 4I2SA 1E0OA 1PWAA 1S0CA 4P6AA 1YYNA 3ZC8A 3S8JA 4D8HA 1FMZA 3HSMA 3FFZA 1TWMA 4IQPA 5E24E 4LO2C 2X2TA 1F31A 4LO0A 4F83A 2D7IA 2RQ9A 1BFCA 1VCLA 2ZQNA 3WINA 1IRPA 3W9TA 1HCDA 1FN0A 3FJCA 3IM5A 3O49A 4JQ0A 4R6UB 2KI6B 4QD2B 4Z9WB 2QN4A 1V6XA 3MPPG 1RY7A 2R9KB 2KI4A 4ZLBB 4KBBA 2UUSA 4QKRA 5D62A 4JPZA 3OJMA 1XHBA 1HWOB 4J2SA 2NZ9A 2Z48A 3F62B 1DJSB 3FJAA 1DZCA 5EC5A 4QD2C 2FDBM 1HCEA 1II4A 4LO8B 1JLYA 3RMXA 1M16A 5FZYA 3NJ5A 3NBEA 4I8MA 1JT5A 3FJ8A 2HW9A 3AZVA 1DFCA 5F8YA 2BEAA 4OEGA 1W3GA 4KEJA 2LIQA 3UDAA 1T4QA 3WO3A 3V79C 3ILAA 1PUUB 3CA0A 4LO1C 2KKIA 1XG6A 3WO2A 4G6MA 4OWJA 4J2XA 2K43A 3A23A 1M2TB 4JKQA 4JAWA 4P0LA 1TIEA 1SR4C 4GAFA 3N7MA 1QQLA 3CA3A 1SR4A 4I4YA 3RSJA 1EYLA 5B2HA 4I7IA 4GP3A 4AN7B 2E4MC 3BA4A 4I1EA 2VU9A 3V0AB 1YXWA 1Z4SA 1G9AA 1HWMB 1Z2VA 3PMEA 4HR6C 2RG9B 2D20A 6I1BA 4LO3C 3UD7A 1OQLB 2K4AB 4P0KA 1HIBA 2K8RA 2D1ZA 3NBCA 1W3FA 3AH2A 5F8WA 4EFRA 4QBCA 4JRAA 3ZX7A 4ZA3B 4X37A 3PUBA 3VWCA 3ZC9A 5BVPI 1S0GA 1MD6A 3AH1A 3BAVA 3Q7WA 4GOYA 3A07A 3JRRA 2D22A 4IY8A 9ILBA 2MLLB 4P0JA 4D0TA 4GAIA 3O3QA 3P6IA 4A7ZA 2P23A 2FO1A 3CRGA 1FMMS 4ENDA 1S0BA 7I1BA 4OEEA 2X2SA 2L5XA 4OEFA 4I4XA 1ISWA 3BRGC 3H6RA 4I37A 3CRHA 3WO4A 3HALA 1BLAA 1JLXA 4X3AA 1EV2A 3ZXGA 4L4IA 5BXRA 2BFHA 2D24A 4II0A 3FJBA 3BA5A 4FVVA 1BFFA 4G6JA 5DZUA 8I1BA 4J2KA 1G9DA 2DRYA 2NVHA 3FJEA 3CA5A 3AH4A 1IHKA 2MC2A 3JUTA 1HWPB 3FGMA 4QO3A 3VT0A 2AFGA 3CAHA 4AN6A 1YTOA 4LO2A 3VT1A 2KLLA 4L4HA 3NBDA 2Y9WC 4GP0A 2NM1A 3WA1A 4LO7B 4G9MA 5F90A 1D0HA 4ZOTA 2D43A 1Z0HA 3O4AA 5FZUA 3CA4A 4USPA 4MZHA 3TC2A 1TP0A 4KC3A 3UJ4A 1I1BA 3O4OA 4FGFA 1ISYA 2I1BA 3OJVA 5BOWA 3HMYA 3S8KA 1JTCA 1JQZA 1Q03A 1UPSA 2WBCA 3BRFA 1QQKA 1A8DA 4IY9A 3VT2A 4MZFB 1ISXA 1NUNA 4XFTA 1BA7A 1G9CA 4IZXA 4Q9GA 3BAOA 4ZFUB 1SZ6B 4ISRA 1JT4A 3FJFA 4Z8SB 2Y9XE 3IM7A 4I4RA 3OBTA 5BP5C 1IOBA 5EHAA 4LO1A 4H04A 3AZWA 1AVXB 5DUYA 3N7JA 3CU1B 4D0ZA 4ZFYB 2AXMA 1JT3A 3N7LA 3R4UA 4I3NA 2VLCA 1RZOB 4HA2A 2D7RA 3PHZA 2DREA 3P6JA 1V6VA 3UD8A 4CJMA 3LLPA 1DLLA 2VSAA 1DFQA 2E4MA 2XOAA 3HN1A 4G9NA 4QKSA 3CRIA 4I96A 4HJJA 3RMYA 1CVSA 1ONKB 1S0FA 3AJ6A 3OJ2A 3B9UA 3H6SE 3P53A 4MZGB 3I2XA 3OGFA 1BLDA 4LO3A 3BAUA 4DENA 2Q3NB 1ISZA 1BASA 4OUJA 3VUOA 5FZZA 2RSTA 3N0KA 3OGGA 4DCKC 2Y9FA 4TLPA 3V0AA 2ESUA 2IHOA 2ZR1B 5HPZA 2GO2A 2LIEA 3CA1A 1EVTA 2FFVA 4QBVA 3E8LC 4J2YA 2M49A 3QYDA 2QYIB 1RG8A 2NP0A 3FJIA 1FWUA 41BIA 2VUAA 3PG0A 4ZKTB 3BA7A 1I1EA 4X38A 1FV3A 1AVUA 2IWTB 3IAGC 1AXMA 1XYFA 2WRYA 1AVAC 3BAGA 1Q04A 2F2FC 1K5UA 2DS0A 4ZFWB 2FGFA 1FWVA 1S0LA 2Y9GA 4PC4A 4KEKA 1CE7B 2KH2A 4I4OA 1PZZA 3V0BB 4OW4A 5BQUC 1PC8B 31BIA 1T9FA 4ISQA 4JKXB 1IJTA 5DVHA 1R8OA 5D61A 3FJJA 3A22A 4J23B 4EFPA 2VXRA 1YF8B 4USOA 4DEPA 4EFQA 1J0SA 2NTDA 1ITBA 3CQAA 4IONA 3WMUA 3AKHA 1RMLA 1BFBA 2YUGA 3FUOA 3R4SA 1JT7A 2ET2A 4A7YA 3RTJB 2BEBA 1IT0A 3O4BA 5FNXA 4EEEB 3K1XA 4LO0C 3AJ5A 4LO7C 5G00A 4WBCA 2D44A 2P39A 5JLVA 1L2HA 3BADA 3WINC 1N4KA 3BB2A 3BAHA 4I6IA 3MALA 3RTIB 1WBAA 3WMVA 4JP0A 1AF9A 1ILR1 4H9WA 1MC9A 2ZQOA 4I4PA 3O44A 1DZDA 3BTAA 4I4VA 3O4CA 1P63A 4UY4A 4XFUA 2D23A 3AKIA 5BP5A 2ERMA 1QXMA 2NYYA 2FFUA 5BXTA 4F34A 4GOVA 1GGPB 4XKIA 3A21A 1TWEA 2DRZA 3VSZA 3O4DA 3FJHA 4I4QA 4ZGRB 1Q1UA 3EF2A 3HOMA 1FGAA 1ABRB
chains in the Genus database with same CATH topology
1WD4A 1JY0A 4I4UA 1IILA 5FNWA 3FJDA 4X39A 3FJ9A 1V6WA 4XFSA 2Z49A 1W3AA 2VXTI 3QR5A 1S0EA 21BIA 1HKNA 2VSEA 1NZKA 3Q7XA 4A7KA 3BX1C 2Q9XA 1R8NA 1PUMB 4Q91A 4QALA 1TTUA 1V6UA 3IIRA 4YOLA 5BXSA 3POKA 2F8XC 4I4SA 1HWNB 2NS2A 3CA6A 3OBRA 1S0DA 3AKFA 4I1BA 2J3PA 3SNVA 3FUQA 3H6QA 5BXPA 4IZEA 4EKXB 1WBCA 3Q7YA 5EG6C 3AKGA 4EB2B 4QC4A 2HWMA 5JMCA 5GAQA 1FQ9A 3KMVA 3F1RA 1XZZA 3VSFA 3H6RB 4I0YA 1YBIA 3D7WB 3LTQA 3T8SA 1K5VA 4IYBA 1TFMB 4KEIA 4Q9PA 2HWAA 2MIBA 3VEQA 1ISVA 1BFGA 1TOOA 2F2FA 5F8SA 1WD3A 1DQGA 1G9BA 2HZ9A 4G1RA 3FJKA 4H75A 3UJ0A 1G82A 1KNMA 3ZXDA 3UD9A 5BQUA 3O5WB 3I2AA 1FV2A 2AAIB 1EPWA 3HBWA 4OWLA 1DIWA 3I29B 3BRDA 5I1BA 3IM6A 4IHZA 3C9ZA 1AFCA 1IRAX 4ZBVB 1AVWB 3NBNA 5DSSB 3N7KA 2AQZA 1DQOA 1BARA 4OWKA 3V0BA 2GZBA 5D63A 3BAQA 4I2SA 1E0OA 1PWAA 1S0CA 4P6AA 1YYNA 3ZC8A 3S8JA 4D8HA 1FMZA 3HSMA 3FFZA 1TWMA 4IQPA 5E24E 4LO2C 2X2TA 1F31A 4LO0A 4F83A 2D7IA 2RQ9A 1BFCA 1VCLA 2ZQNA 3WINA 1IRPA 3W9TA 1HCDA 1FN0A 3FJCA 3IM5A 3O49A 4JQ0A 4R6UB 2KI6B 4QD2B 4Z9WB 2QN4A 1V6XA 3MPPG 1RY7A 2R9KB 2KI4A 4ZLBB 4KBBA 2UUSA 4QKRA 5D62A 4JPZA 3OJMA 1XHBA 1HWOB 4J2SA 2NZ9A 2Z48A 3F62B 1DJSB 3FJAA 1DZCA 5EC5A 4QD2C 2FDBM 1HCEA 1II4A 4LO8B 1JLYA 3RMXA 1M16A 5FZYA 3NJ5A 3NBEA 4I8MA 1JT5A 3FJ8A 2HW9A 3AZVA 1DFCA 5F8YA 2BEAA 4OEGA 1W3GA 4KEJA 2LIQA 3UDAA 1T4QA 3WO3A 3V79C 3ILAA 1PUUB 3CA0A 4LO1C 2KKIA 1XG6A 3WO2A 4G6MA 4OWJA 4J2XA 2K43A 3A23A 1M2TB 4JKQA 4JAWA 4P0LA 1TIEA 1SR4C 4GAFA 3N7MA 1QQLA 3CA3A 1SR4A 4I4YA 3RSJA 1EYLA 5B2HA 4I7IA 4GP3A 4AN7B 2E4MC 3BA4A 4I1EA 2VU9A 3V0AB 1YXWA 1Z4SA 1G9AA 1HWMB 1Z2VA 3PMEA 4HR6C 2RG9B 2D20A 6I1BA 4LO3C 3UD7A 1OQLB 2K4AB 4P0KA 1HIBA 2K8RA 2D1ZA 3NBCA 1W3FA 3AH2A 5F8WA 4EFRA 4QBCA 4JRAA 3ZX7A 4ZA3B 4X37A 3PUBA 3VWCA 3ZC9A 5BVPI 1S0GA 1MD6A 3AH1A 3BAVA 3Q7WA 4GOYA 3A07A 3JRRA 2D22A 4IY8A 9ILBA 2MLLB 4P0JA 4D0TA 4GAIA 3O3QA 3P6IA 4A7ZA 2P23A 2FO1A 3CRGA 1FMMS 4ENDA 1S0BA 7I1BA 4OEEA 2X2SA 2L5XA 4OEFA 4I4XA 1ISWA 3BRGC 3H6RA 4I37A 3CRHA 3WO4A 3HALA 1BLAA 1JLXA 4X3AA 1EV2A 3ZXGA 4L4IA 5BXRA 2BFHA 2D24A 4II0A 3FJBA 3BA5A 4FVVA 1BFFA 4G6JA 5DZUA 8I1BA 4J2KA 1G9DA 2DRYA 2NVHA 3FJEA 3CA5A 3AH4A 1IHKA 2MC2A 3JUTA 1HWPB 3FGMA 4QO3A 3VT0A 2AFGA 3CAHA 4AN6A 1YTOA 4LO2A 3VT1A 2KLLA 4L4HA 3NBDA 2Y9WC 4GP0A 2NM1A 3WA1A 4LO7B 4G9MA 5F90A 1D0HA 4ZOTA 2D43A 1Z0HA 3O4AA 5FZUA 3CA4A 4USPA 4MZHA 3TC2A 1TP0A 4KC3A 3UJ4A 1I1BA 3O4OA 4FGFA 1ISYA 2I1BA 3OJVA 5BOWA 3HMYA 3S8KA 1JTCA 1JQZA 1Q03A 1UPSA 2WBCA 3BRFA 1QQKA 1A8DA 4IY9A 3VT2A 4MZFB 1ISXA 1NUNA 4XFTA 1BA7A 1G9CA 4IZXA 4Q9GA 3BAOA 4ZFUB 1SZ6B 4ISRA 1JT4A 3FJFA 4Z8SB 2Y9XE 3IM7A 4I4RA 3OBTA 5BP5C 1IOBA 5EHAA 4LO1A 4H04A 3AZWA 1AVXB 5DUYA 3N7JA 3CU1B 4D0ZA 4ZFYB 2AXMA 1JT3A 3N7LA 3R4UA 4I3NA 2VLCA 1RZOB 4HA2A 2D7RA 3PHZA 2DREA 3P6JA 1V6VA 3UD8A 4CJMA 3LLPA 1DLLA 2VSAA 1DFQA 2E4MA 2XOAA 3HN1A 4G9NA 4QKSA 3CRIA 4I96A 4HJJA 3RMYA 1CVSA 1ONKB 1S0FA 3AJ6A 3OJ2A 3B9UA 3H6SE 3P53A 4MZGB 3I2XA 3OGFA 1BLDA 4LO3A 3BAUA 4DENA 2Q3NB 1ISZA 1BASA 4OUJA 3VUOA 5FZZA 2RSTA 3N0KA 3OGGA 4DCKC 2Y9FA 4TLPA 3V0AA 2ESUA 2IHOA 2ZR1B 5HPZA 2GO2A 2LIEA 3CA1A 1EVTA 2FFVA 4QBVA 3E8LC 4J2YA 2M49A 3QYDA 2QYIB 1RG8A 2NP0A 3FJIA 1FWUA 41BIA 2VUAA 3PG0A 4ZKTB 3BA7A 1I1EA 4X38A 1FV3A 1AVUA 2IWTB 3IAGC 1AXMA 1XYFA 2WRYA 1AVAC 3BAGA 1Q04A 2F2FC 1K5UA 2DS0A 4ZFWB 2FGFA 1FWVA 1S0LA 2Y9GA 4PC4A 4KEKA 1CE7B 2KH2A 4I4OA 1PZZA 3V0BB 4OW4A 5BQUC 1PC8B 31BIA 1T9FA 4ISQA 4JKXB 1IJTA 5DVHA 1R8OA 5D61A 3FJJA 3A22A 4J23B 4EFPA 2VXRA 1YF8B 4USOA 4DEPA 4EFQA 1J0SA 2NTDA 1ITBA 3CQAA 4IONA 3WMUA 3AKHA 1RMLA 1BFBA 2YUGA 3FUOA 3R4SA 1JT7A 2ET2A 4A7YA 3RTJB 2BEBA 1IT0A 3O4BA 5FNXA 4EEEB 3K1XA 4LO0C 3AJ5A 4LO7C 5G00A 4WBCA 2D44A 2P39A 5JLVA 1L2HA 3BADA 3WINC 1N4KA 3BB2A 3BAHA 4I6IA 3MALA 3RTIB 1WBAA 3WMVA 4JP0A 1AF9A 1ILR1 4H9WA 1MC9A 2ZQOA 4I4PA 3O44A 1DZDA 3BTAA 4I4VA 3O4CA 1P63A 4UY4A 4XFUA 2D23A 3AKIA 5BP5A 2ERMA 1QXMA 2NYYA 2FFUA 5BXTA 4F34A 4GOVA 1GGPB 4XKIA 3A21A 1TWEA 2DRZA 3VSZA 3O4DA 3FJHA 4I4QA 4ZGRB 1Q1UA 3EF2A 3HOMA 1FGAA 1ABRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD4 A;  1JY0 A;  4I4U A;  1IIL A;  5FNW A;  3FJD A;  4X39 A;  3FJ9 A;  1V6W A;  4XFS A;  2Z49 A;  1W3A A;  2VXT I;  3QR5 A;  1S0E A;  21BI A;  1HKN A;  2VSE A;  1NZK A;  3Q7X A;  4A7K A;  3BX1 C;  2Q9X A;  1R8N A;  1PUM B;  4Q91 A;  4QAL A;  1TTU A;  1V6U A;  3IIR A;  4YOL A;  5BXS A;  3POK A;  2F8X C;  4I4S A;  1HWN B;  3CA6 A;  3OBR A;  1S0D A;  3AKF A;  4I1B A;  2J3P A;  3SNV A;  3FUQ A;  3H6Q A;  5BXP A;  4IZE A;  4EKX B;  1WBC A;  3Q7Y A;  5EG6 C;  3AKG A;  4EB2 B;  4QC4 A;  2HWM A;  5JMC A;  5GAQ A;  1FQ9 A;  3KMV A;  3F1R A;  1XZZ A;  3VSF A;  3H6R B;  4I0Y A;  1YBI A;  3D7W B;  3LTQ A;  3T8S A;  1K5V A;  4IYB A;  1TFM B;  4KEI A;  4Q9P A;  2HWA A;  2MIB A;  3VEQ A;  1ISV A;  1BFG A;  1TOO A;  2F2F A;  5F8S A;  1WD3 A;  1DQG A;  1G9B A;  2HZ9 A;  4G1R A;  3FJK A;  3UJ0 A;  1G82 A;  1KNM A;  3ZXD A;  3UD9 A;  5BQU A;  3O5W B;  3I2A A;  1FV2 A;  2AAI B;  1EPW A;  3HBW A;  4OWL A;  1DIW A;  3I29 B;  3BRD A;  5I1B A;  3IM6 A;  4IHZ A;  3C9Z A;  1AFC A;  1IRA X;  4ZBV B;  1AVW B;  3NBN A;  5DSS B;  3N7K A;  2AQZ A;  1DQO A;  1BAR A;  4OWK A;  3V0B A;  2GZB A;  5D63 A;  3BAQ A;  4I2S A;  1E0O A;  1PWA A;  1S0C A;  4P6A A;  1YYN A;  3ZC8 A;  3S8J A;  4D8H A;  1FMZ A;  3HSM A;  3FFZ A;  1TWM A;  4IQP A;  5E24 E;  4LO2 C;  2X2T A;  1F31 A;  4LO0 A;  4F83 A;  2D7I A;  2RQ9 A;  1BFC A;  1VCL A;  2ZQN A;  3WIN A;  1IRP A;  3W9T A;  1HCD A;  1FN0 A;  3FJC A;  3IM5 A;  3O49 A;  4JQ0 A;  4R6U B;  2KI6 B;  4QD2 B;  4Z9W B;  2QN4 A;  1V6X A;  3MPP G;  1RY7 A;  2R9K B;  2KI4 A;  4ZLB B;  4KBB A;  2UUS A;  4QKR A;  5D62 A;  4JPZ A;  3OJM A;  1XHB A;  1HWO B;  4J2S A;  2NZ9 A;  2Z48 A;  3F62 B;  1DJS B;  3FJA A;  1DZC A;  5EC5 A;  4QD2 C;  2FDB M;  1HCE A;  1II4 A;  4LO8 B;  1JLY A;  3RMX A;  1M16 A;  5FZY A;  3NJ5 A;  3NBE A;  4I8M A;  1JT5 A;  3FJ8 A;  2HW9 A;  3AZV A;  1DFC A;  5F8Y A;  2BEA A;  4OEG A;  1W3G A;  4KEJ A;  2LIQ A;  3UDA A;  1T4Q A;  3WO3 A;  3V79 C;  3ILA A;  1PUU B;  3CA0 A;  4LO1 C;  2KKI A;  1XG6 A;  3WO2 A;  4G6M A;  4OWJ A;  4J2X A;  2K43 A;  3A23 A;  1M2T B;  4JKQ A;  4JAW A;  4P0L A;  1TIE A;  1SR4 C;  4GAF A;  3N7M A;  1QQL A;  3CA3 A;  1SR4 A;  4I4Y A;  3RSJ A;  1EYL A;  5B2H A;  4I7I A;  4GP3 A;  4AN7 B;  2E4M C;  3BA4 A;  4I1E A;  2VU9 A;  3V0A B;  1YXW A;  1Z4S A;  1G9A A;  1HWM B;  1Z2V A;  3PME A;  4HR6 C;  2RG9 B;  2D20 A;  6I1B A;  4LO3 C;  3UD7 A;  1OQL B;  2K4A B;  4P0K A;  1HIB A;  2K8R A;  2D1Z A;  3NBC A;  1W3F A;  3AH2 A;  5F8W A;  4EFR A;  4QBC A;  4JRA A;  3ZX7 A;  4ZA3 B;  4X37 A;  3PUB A;  3VWC A;  3ZC9 A;  5BVP I;  1S0G A;  1MD6 A;  3AH1 A;  3BAV A;  3Q7W A;  4GOY A;  3A07 A;  3JRR A;  2D22 A;  4IY8 A;  9ILB A;  2MLL B;  4P0J A;  4D0T A;  4GAI A;  3O3Q A;  3P6I A;  4A7Z A;  2P23 A;  2FO1 A;  3CRG A;  1FMM S;  4END A;  1S0B A;  7I1B A;  4OEE A;  2X2S A;  2L5X A;  4OEF A;  4I4X A;  1ISW A;  3BRG C;  3H6R A;  4I37 A;  3CRH A;  3WO4 A;  3HAL A;  1BLA A;  1JLX A;  4X3A A;  1EV2 A;  3ZXG A;  4L4I A;  5BXR A;  2BFH A;  2D24 A;  4II0 A;  3FJB A;  3BA5 A;  4FVV A;  1BFF A;  4G6J A;  5DZU A;  8I1B A;  4J2K A;  1G9D A;  2DRY A;  2NVH A;  3FJE A;  3CA5 A;  3AH4 A;  1IHK A;  2MC2 A;  3JUT A;  1HWP B;  3FGM A;  4QO3 A;  3VT0 A;  2AFG A;  3CAH A;  4AN6 A;  1YTO A;  4LO2 A;  3VT1 A;  2KLL A;  4L4H A;  3NBD A;  2Y9W C;  4GP0 A;  2NM1 A;  3WA1 A;  4LO7 B;  4G9M A;  5F90 A;  1D0H A;  4ZOT A;  2D43 A;  1Z0H A;  3O4A A;  5FZU A;  3CA4 A;  4USP A;  3TC2 A;  1TP0 A;  4KC3 A;  3UJ4 A;  1I1B A;  3O4O A;  4FGF A;  1ISY A;  2I1B A;  3OJV A;  5BOW A;  3HMY A;  3S8K A;  1JTC A;  1JQZ A;  1Q03 A;  1UPS A;  2WBC A;  3BRF A;  1QQK A;  1A8D A;  4IY9 A;  3VT2 A;  1ISX A;  1NUN A;  4XFT A;  1BA7 A;  1G9C A;  4IZX A;  4Q9G A;  3BAO A;  4ZFU B;  1SZ6 B;  4ISR A;  1JT4 A;  3FJF A;  4Z8S B;  2Y9X E;  3IM7 A;  4I4R A;  3OBT A;  5BP5 C;  1IOB A;  5EHA A;  4LO1 A;  4H04 A;  3AZW A;  1AVX B;  5DUY A;  3N7J A;  3CU1 B;  4D0Z A;  4ZFY B;  2AXM A;  1JT3 A;  3N7L A;  3R4U A;  4I3N A;  2VLC A;  1RZO B;  4HA2 A;  2D7R A;  3PHZ A;  2DRE A;  3P6J A;  1V6V A;  3UD8 A;  4CJM A;  3LLP A;  1DLL A;  2VSA A;  1DFQ A;  2E4M A;  2XOA A;  3HN1 A;  4G9N A;  4QKS A;  3CRI A;  4I96 A;  4HJJ A;  3RMY A;  1CVS A;  1ONK B;  1S0F A;  3AJ6 A;  3OJ2 A;  3B9U A;  3H6S E;  3P53 A;  3I2X A;  3OGF A;  1BLD A;  4LO3 A;  3BAU A;  4DEN A;  2Q3N B;  1ISZ A;  1BAS A;  4OUJ A;  3VUO A;  5FZZ A;  2RST A;  3N0K A;  3OGG A;  4DCK C;  2Y9F A;  4TLP A;  3V0A A;  2ESU A;  2IHO A;  2ZR1 B;  5HPZ A;  2GO2 A;  2LIE A;  3CA1 A;  1EVT A;  2FFV A;  4QBV A;  3E8L C;  4J2Y A;  2M49 A;  3QYD A;  2QYI B;  1RG8 A;  2NP0 A;  3FJI A;  1FWU A;  41BI A;  2VUA A;  3PG0 A;  4ZKT B;  3BA7 A;  1I1E A;  4X38 A;  1FV3 A;  1AVU A;  2IWT B;  3IAG C;  1AXM A;  1XYF A;  2WRY A;  1AVA C;  3BAG A;  1Q04 A;  2F2F C;  1K5U A;  2DS0 A;  4ZFW B;  2FGF A;  1FWV A;  1S0L A;  2Y9G A;  4PC4 A;  4KEK A;  1CE7 B;  2KH2 A;  4I4O A;  1PZZ A;  3V0B B;  4OW4 A;  5BQU C;  1PC8 B;  31BI A;  1T9F A;  4ISQ A;  4JKX B;  1IJT A;  5DVH A;  1R8O A;  5D61 A;  3FJJ A;  3A22 A;  4J23 B;  4EFP A;  2VXR A;  1YF8 B;  4USO A;  4DEP A;  4EFQ A;  1J0S A;  2NTD A;  1ITB A;  3CQA A;  4ION A;  3WMU A;  3AKH A;  1RML A;  1BFB A;  2YUG A;  3FUO A;  3R4S A;  1JT7 A;  2ET2 A;  4A7Y A;  3RTJ B;  2BEB A;  1IT0 A;  3O4B A;  5FNX A;  4EEE B;  3K1X A;  4LO0 C;  3AJ5 A;  4LO7 C;  5G00 A;  4WBC A;  2D44 A;  2P39 A;  5JLV A;  1L2H A;  3BAD A;  3WIN C;  1N4K A;  3BB2 A;  3BAH A;  4I6I A;  3MAL A;  3RTI B;  1WBA A;  3WMV A;  4JP0 A;  1AF9 A;  1ILR 1;  4H9W A;  1MC9 A;  2ZQO A;  4I4P A;  3O44 A;  1DZD A;  3BTA A;  4I4V A;  3O4C A;  1P63 A;  4XFU A;  2D23 A;  3AKI A;  5BP5 A;  2ERM A;  1QXM A;  2NYY A;  2FFU A;  5BXT A;  4F34 A;  4GOV A;  1GGP B;  4XKI A;  3A21 A;  1TWE A;  2DRZ A;  3VSZ A;  3O4D A;  3FJH A;  4I4Q A;  4ZGR B;  1Q1U A;  3EF2 A;  3HOM A;  1FGA A;  1ABR B; 
#chains in the Genus database with same CATH topology
 1WD4 A;  1JY0 A;  4I4U A;  1IIL A;  5FNW A;  3FJD A;  4X39 A;  3FJ9 A;  1V6W A;  4XFS A;  2Z49 A;  1W3A A;  2VXT I;  3QR5 A;  1S0E A;  21BI A;  1HKN A;  2VSE A;  1NZK A;  3Q7X A;  4A7K A;  3BX1 C;  2Q9X A;  1R8N A;  1PUM B;  4Q91 A;  4QAL A;  1TTU A;  1V6U A;  3IIR A;  4YOL A;  5BXS A;  3POK A;  2F8X C;  4I4S A;  1HWN B;  2NS2 A;  3CA6 A;  3OBR A;  1S0D A;  3AKF A;  4I1B A;  2J3P A;  3SNV A;  3FUQ A;  3H6Q A;  5BXP A;  4IZE A;  4EKX B;  1WBC A;  3Q7Y A;  5EG6 C;  3AKG A;  4EB2 B;  4QC4 A;  2HWM A;  5JMC A;  5GAQ A;  1FQ9 A;  3KMV A;  3F1R A;  1XZZ A;  3VSF A;  3H6R B;  4I0Y A;  1YBI A;  3D7W B;  3LTQ A;  3T8S A;  1K5V A;  4IYB A;  1TFM B;  4KEI A;  4Q9P A;  2HWA A;  2MIB A;  3VEQ A;  1ISV A;  1BFG A;  1TOO A;  2F2F A;  5F8S A;  1WD3 A;  1DQG A;  1G9B A;  2HZ9 A;  4G1R A;  3FJK A;  4H75 A;  3UJ0 A;  1G82 A;  1KNM A;  3ZXD A;  3UD9 A;  5BQU A;  3O5W B;  3I2A A;  1FV2 A;  2AAI B;  1EPW A;  3HBW A;  4OWL A;  1DIW A;  3I29 B;  3BRD A;  5I1B A;  3IM6 A;  4IHZ A;  3C9Z A;  1AFC A;  1IRA X;  4ZBV B;  1AVW B;  3NBN A;  5DSS B;  3N7K A;  2AQZ A;  1DQO A;  1BAR A;  4OWK A;  3V0B A;  2GZB A;  5D63 A;  3BAQ A;  4I2S A;  1E0O A;  1PWA A;  1S0C A;  4P6A A;  1YYN A;  3ZC8 A;  3S8J A;  4D8H A;  1FMZ A;  3HSM A;  3FFZ A;  1TWM A;  4IQP A;  5E24 E;  4LO2 C;  2X2T A;  1F31 A;  4LO0 A;  4F83 A;  2D7I A;  2RQ9 A;  1BFC A;  1VCL A;  2ZQN A;  3WIN A;  1IRP A;  3W9T A;  1HCD A;  1FN0 A;  3FJC A;  3IM5 A;  3O49 A;  4JQ0 A;  4R6U B;  2KI6 B;  4QD2 B;  4Z9W B;  2QN4 A;  1V6X A;  3MPP G;  1RY7 A;  2R9K B;  2KI4 A;  4ZLB B;  4KBB A;  2UUS A;  4QKR A;  5D62 A;  4JPZ A;  3OJM A;  1XHB A;  1HWO B;  4J2S A;  2NZ9 A;  2Z48 A;  3F62 B;  1DJS B;  3FJA A;  1DZC A;  5EC5 A;  4QD2 C;  2FDB M;  1HCE A;  1II4 A;  4LO8 B;  1JLY A;  3RMX A;  1M16 A;  5FZY A;  3NJ5 A;  3NBE A;  4I8M A;  1JT5 A;  3FJ8 A;  2HW9 A;  3AZV A;  1DFC A;  5F8Y A;  2BEA A;  4OEG A;  1W3G A;  4KEJ A;  2LIQ A;  3UDA A;  1T4Q A;  3WO3 A;  3V79 C;  3ILA A;  1PUU B;  3CA0 A;  4LO1 C;  2KKI A;  1XG6 A;  3WO2 A;  4G6M A;  4OWJ A;  4J2X A;  2K43 A;  3A23 A;  1M2T B;  4JKQ A;  4JAW A;  4P0L A;  1TIE A;  1SR4 C;  4GAF A;  3N7M A;  1QQL A;  3CA3 A;  1SR4 A;  4I4Y A;  3RSJ A;  1EYL A;  5B2H A;  4I7I A;  4GP3 A;  4AN7 B;  2E4M C;  3BA4 A;  4I1E A;  2VU9 A;  3V0A B;  1YXW A;  1Z4S A;  1G9A A;  1HWM B;  1Z2V A;  3PME A;  4HR6 C;  2RG9 B;  2D20 A;  6I1B A;  4LO3 C;  3UD7 A;  1OQL B;  2K4A B;  4P0K A;  1HIB A;  2K8R A;  2D1Z A;  3NBC A;  1W3F A;  3AH2 A;  5F8W A;  4EFR A;  4QBC A;  4JRA A;  3ZX7 A;  4ZA3 B;  4X37 A;  3PUB A;  3VWC A;  3ZC9 A;  5BVP I;  1S0G A;  1MD6 A;  3AH1 A;  3BAV A;  3Q7W A;  4GOY A;  3A07 A;  3JRR A;  2D22 A;  4IY8 A;  9ILB A;  2MLL B;  4P0J A;  4D0T A;  4GAI A;  3O3Q A;  3P6I A;  4A7Z A;  2P23 A;  2FO1 A;  3CRG A;  1FMM S;  4END A;  1S0B A;  7I1B A;  4OEE A;  2X2S A;  2L5X A;  4OEF A;  4I4X A;  1ISW A;  3BRG C;  3H6R A;  4I37 A;  3CRH A;  3WO4 A;  3HAL A;  1BLA A;  1JLX A;  4X3A A;  1EV2 A;  3ZXG A;  4L4I A;  5BXR A;  2BFH A;  2D24 A;  4II0 A;  3FJB A;  3BA5 A;  4FVV A;  1BFF A;  4G6J A;  5DZU A;  8I1B A;  4J2K A;  1G9D A;  2DRY A;  2NVH A;  3FJE A;  3CA5 A;  3AH4 A;  1IHK A;  2MC2 A;  3JUT A;  1HWP B;  3FGM A;  4QO3 A;  3VT0 A;  2AFG A;  3CAH A;  4AN6 A;  1YTO A;  4LO2 A;  3VT1 A;  2KLL A;  4L4H A;  3NBD A;  2Y9W C;  4GP0 A;  2NM1 A;  3WA1 A;  4LO7 B;  4G9M A;  5F90 A;  1D0H A;  4ZOT A;  2D43 A;  1Z0H A;  3O4A A;  5FZU A;  3CA4 A;  4USP A;  4MZH A;  3TC2 A;  1TP0 A;  4KC3 A;  3UJ4 A;  1I1B A;  3O4O A;  4FGF A;  1ISY A;  2I1B A;  3OJV A;  5BOW A;  3HMY A;  3S8K A;  1JTC A;  1JQZ A;  1Q03 A;  1UPS A;  2WBC A;  3BRF A;  1QQK A;  1A8D A;  4IY9 A;  3VT2 A;  4MZF B;  1ISX A;  1NUN A;  4XFT A;  1BA7 A;  1G9C A;  4IZX A;  4Q9G A;  3BAO A;  4ZFU B;  1SZ6 B;  4ISR A;  1JT4 A;  3FJF A;  4Z8S B;  2Y9X E;  3IM7 A;  4I4R A;  3OBT A;  5BP5 C;  1IOB A;  5EHA A;  4LO1 A;  4H04 A;  3AZW A;  1AVX B;  5DUY A;  3N7J A;  3CU1 B;  4D0Z A;  4ZFY B;  2AXM A;  1JT3 A;  3N7L A;  3R4U A;  4I3N A;  2VLC A;  1RZO B;  4HA2 A;  2D7R A;  3PHZ A;  2DRE A;  3P6J A;  1V6V A;  3UD8 A;  4CJM A;  3LLP A;  1DLL A;  2VSA A;  1DFQ A;  2E4M A;  2XOA A;  3HN1 A;  4G9N A;  4QKS A;  3CRI A;  4I96 A;  4HJJ A;  3RMY A;  1CVS A;  1ONK B;  1S0F A;  3AJ6 A;  3OJ2 A;  3B9U A;  3H6S E;  3P53 A;  4MZG B;  3I2X A;  3OGF A;  1BLD A;  4LO3 A;  3BAU A;  4DEN A;  2Q3N B;  1ISZ A;  1BAS A;  4OUJ A;  3VUO A;  5FZZ A;  2RST A;  3N0K A;  3OGG A;  4DCK C;  2Y9F A;  4TLP A;  3V0A A;  2ESU A;  2IHO A;  2ZR1 B;  5HPZ A;  2GO2 A;  2LIE A;  3CA1 A;  1EVT A;  2FFV A;  4QBV A;  3E8L C;  4J2Y A;  2M49 A;  3QYD A;  2QYI B;  1RG8 A;  2NP0 A;  3FJI A;  1FWU A;  41BI A;  2VUA A;  3PG0 A;  4ZKT B;  3BA7 A;  1I1E A;  4X38 A;  1FV3 A;  1AVU A;  2IWT B;  3IAG C;  1AXM A;  1XYF A;  2WRY A;  1AVA C;  3BAG A;  1Q04 A;  2F2F C;  1K5U A;  2DS0 A;  4ZFW B;  2FGF A;  1FWV A;  1S0L A;  2Y9G A;  4PC4 A;  4KEK A;  1CE7 B;  2KH2 A;  4I4O A;  1PZZ A;  3V0B B;  4OW4 A;  5BQU C;  1PC8 B;  31BI A;  1T9F A;  4ISQ A;  4JKX B;  1IJT A;  5DVH A;  1R8O A;  5D61 A;  3FJJ A;  3A22 A;  4J23 B;  4EFP A;  2VXR A;  1YF8 B;  4USO A;  4DEP A;  4EFQ A;  1J0S A;  2NTD A;  1ITB A;  3CQA A;  4ION A;  3WMU A;  3AKH A;  1RML A;  1BFB A;  2YUG A;  3FUO A;  3R4S A;  1JT7 A;  2ET2 A;  4A7Y A;  3RTJ B;  2BEB A;  1IT0 A;  3O4B A;  5FNX A;  4EEE B;  3K1X A;  4LO0 C;  3AJ5 A;  4LO7 C;  5G00 A;  4WBC A;  2D44 A;  2P39 A;  5JLV A;  1L2H A;  3BAD A;  3WIN C;  1N4K A;  3BB2 A;  3BAH A;  4I6I A;  3MAL A;  3RTI B;  1WBA A;  3WMV A;  4JP0 A;  1AF9 A;  1ILR 1;  4H9W A;  1MC9 A;  2ZQO A;  4I4P A;  3O44 A;  1DZD A;  3BTA A;  4I4V A;  3O4C A;  1P63 A;  4UY4 A;  4XFU A;  2D23 A;  3AKI A;  5BP5 A;  2ERM A;  1QXM A;  2NYY A;  2FFU A;  5BXT A;  4F34 A;  4GOV A;  1GGP B;  4XKI A;  3A21 A;  1TWE A;  2DRZ A;  3VSZ A;  3O4D A;  3FJH A;  4I4Q A;  4ZGR B;  1Q1U A;  3EF2 A;  3HOM A;  1FGA A;  1ABR B; 
#chains in the Genus database with same CATH homology
 1WD4 A;  1JY0 A;  4I4U A;  1IIL A;  5FNW A;  3FJD A;  4X39 A;  3FJ9 A;  1V6W A;  4XFS A;  2Z49 A;  1W3A A;  2VXT I;  3QR5 A;  1S0E A;  21BI A;  1HKN A;  2VSE A;  1NZK A;  3Q7X A;  4A7K A;  3BX1 C;  2Q9X A;  1R8N A;  1PUM B;  4Q91 A;  4QAL A;  1TTU A;  1V6U A;  3IIR A;  4YOL A;  5BXS A;  3POK A;  2F8X C;  4I4S A;  1HWN B;  2NS2 A;  3CA6 A;  3OBR A;  1S0D A;  3AKF A;  4I1B A;  2J3P A;  3SNV A;  3FUQ A;  3H6Q A;  5BXP A;  4IZE A;  4EKX B;  1WBC A;  3Q7Y A;  5EG6 C;  3AKG A;  4EB2 B;  4QC4 A;  2HWM A;  5JMC A;  5GAQ A;  1FQ9 A;  3KMV A;  3F1R A;  1XZZ A;  3VSF A;  3H6R B;  4I0Y A;  1YBI A;  3D7W B;  3LTQ A;  3T8S A;  1K5V A;  4IYB A;  1TFM B;  4KEI A;  4Q9P A;  2HWA A;  2MIB A;  3VEQ A;  1ISV A;  1BFG A;  1TOO A;  2F2F A;  5F8S A;  1WD3 A;  1DQG A;  1G9B A;  2HZ9 A;  4G1R A;  3FJK A;  4H75 A;  3UJ0 A;  1G82 A;  1KNM A;  3ZXD A;  3UD9 A;  5BQU A;  3O5W B;  3I2A A;  1FV2 A;  2AAI B;  1EPW A;  3HBW A;  4OWL A;  1DIW A;  3I29 B;  3BRD A;  5I1B A;  3IM6 A;  4IHZ A;  3C9Z A;  1AFC A;  1IRA X;  4ZBV B;  1AVW B;  3NBN A;  5DSS B;  3N7K A;  2AQZ A;  1DQO A;  1BAR A;  4OWK A;  3V0B A;  2GZB A;  5D63 A;  3BAQ A;  4I2S A;  1E0O A;  1PWA A;  1S0C A;  4P6A A;  1YYN A;  3ZC8 A;  3S8J A;  4D8H A;  1FMZ A;  3HSM A;  3FFZ A;  1TWM A;  4IQP A;  5E24 E;  4LO2 C;  2X2T A;  1F31 A;  4LO0 A;  4F83 A;  2D7I A;  2RQ9 A;  1BFC A;  1VCL A;  2ZQN A;  3WIN A;  1IRP A;  3W9T A;  1HCD A;  1FN0 A;  3FJC A;  3IM5 A;  3O49 A;  4JQ0 A;  4R6U B;  2KI6 B;  4QD2 B;  4Z9W B;  2QN4 A;  1V6X A;  3MPP G;  1RY7 A;  2R9K B;  2KI4 A;  4ZLB B;  4KBB A;  2UUS A;  4QKR A;  5D62 A;  4JPZ A;  3OJM A;  1XHB A;  1HWO B;  4J2S A;  2NZ9 A;  2Z48 A;  3F62 B;  1DJS B;  3FJA A;  1DZC A;  5EC5 A;  4QD2 C;  2FDB M;  1HCE A;  1II4 A;  4LO8 B;  1JLY A;  3RMX A;  1M16 A;  5FZY A;  3NJ5 A;  3NBE A;  4I8M A;  1JT5 A;  3FJ8 A;  2HW9 A;  3AZV A;  1DFC A;  5F8Y A;  2BEA A;  4OEG A;  1W3G A;  4KEJ A;  2LIQ A;  3UDA A;  1T4Q A;  3WO3 A;  3V79 C;  3ILA A;  1PUU B;  3CA0 A;  4LO1 C;  2KKI A;  1XG6 A;  3WO2 A;  4G6M A;  4OWJ A;  4J2X A;  2K43 A;  3A23 A;  1M2T B;  4JKQ A;  4JAW A;  4P0L A;  1TIE A;  1SR4 C;  4GAF A;  3N7M A;  1QQL A;  3CA3 A;  1SR4 A;  4I4Y A;  3RSJ A;  1EYL A;  5B2H A;  4I7I A;  4GP3 A;  4AN7 B;  2E4M C;  3BA4 A;  4I1E A;  2VU9 A;  3V0A B;  1YXW A;  1Z4S A;  1G9A A;  1HWM B;  1Z2V A;  3PME A;  4HR6 C;  2RG9 B;  2D20 A;  6I1B A;  4LO3 C;  3UD7 A;  1OQL B;  2K4A B;  4P0K A;  1HIB A;  2K8R A;  2D1Z A;  3NBC A;  1W3F A;  3AH2 A;  5F8W A;  4EFR A;  4QBC A;  4JRA A;  3ZX7 A;  4ZA3 B;  4X37 A;  3PUB A;  3VWC A;  3ZC9 A;  5BVP I;  1S0G A;  1MD6 A;  3AH1 A;  3BAV A;  3Q7W A;  4GOY A;  3A07 A;  3JRR A;  2D22 A;  4IY8 A;  9ILB A;  2MLL B;  4P0J A;  4D0T A;  4GAI A;  3O3Q A;  3P6I A;  4A7Z A;  2P23 A;  2FO1 A;  3CRG A;  1FMM S;  4END A;  1S0B A;  7I1B A;  4OEE A;  2X2S A;  2L5X A;  4OEF A;  4I4X A;  1ISW A;  3BRG C;  3H6R A;  4I37 A;  3CRH A;  3WO4 A;  3HAL A;  1BLA A;  1JLX A;  4X3A A;  1EV2 A;  3ZXG A;  4L4I A;  5BXR A;  2BFH A;  2D24 A;  4II0 A;  3FJB A;  3BA5 A;  4FVV A;  1BFF A;  4G6J A;  5DZU A;  8I1B A;  4J2K A;  1G9D A;  2DRY A;  2NVH A;  3FJE A;  3CA5 A;  3AH4 A;  1IHK A;  2MC2 A;  3JUT A;  1HWP B;  3FGM A;  4QO3 A;  3VT0 A;  2AFG A;  3CAH A;  4AN6 A;  1YTO A;  4LO2 A;  3VT1 A;  2KLL A;  4L4H A;  3NBD A;  2Y9W C;  4GP0 A;  2NM1 A;  3WA1 A;  4LO7 B;  4G9M A;  5F90 A;  1D0H A;  4ZOT A;  2D43 A;  1Z0H A;  3O4A A;  5FZU A;  3CA4 A;  4USP A;  4MZH A;  3TC2 A;  1TP0 A;  4KC3 A;  3UJ4 A;  1I1B A;  3O4O A;  4FGF A;  1ISY A;  2I1B A;  3OJV A;  5BOW A;  3HMY A;  3S8K A;  1JTC A;  1JQZ A;  1Q03 A;  1UPS A;  2WBC A;  3BRF A;  1QQK A;  1A8D A;  4IY9 A;  3VT2 A;  4MZF B;  1ISX A;  1NUN A;  4XFT A;  1BA7 A;  1G9C A;  4IZX A;  4Q9G A;  3BAO A;  4ZFU B;  1SZ6 B;  4ISR A;  1JT4 A;  3FJF A;  4Z8S B;  2Y9X E;  3IM7 A;  4I4R A;  3OBT A;  5BP5 C;  1IOB A;  5EHA A;  4LO1 A;  4H04 A;  3AZW A;  1AVX B;  5DUY A;  3N7J A;  3CU1 B;  4D0Z A;  4ZFY B;  2AXM A;  1JT3 A;  3N7L A;  3R4U A;  4I3N A;  2VLC A;  1RZO B;  4HA2 A;  2D7R A;  3PHZ A;  2DRE A;  3P6J A;  1V6V A;  3UD8 A;  4CJM A;  3LLP A;  1DLL A;  2VSA A;  1DFQ A;  2E4M A;  2XOA A;  3HN1 A;  4G9N A;  4QKS A;  3CRI A;  4I96 A;  4HJJ A;  3RMY A;  1CVS A;  1ONK B;  1S0F A;  3AJ6 A;  3OJ2 A;  3B9U A;  3H6S E;  3P53 A;  4MZG B;  3I2X A;  3OGF A;  1BLD A;  4LO3 A;  3BAU A;  4DEN A;  2Q3N B;  1ISZ A;  1BAS A;  4OUJ A;  3VUO A;  5FZZ A;  2RST A;  3N0K A;  3OGG A;  4DCK C;  2Y9F A;  4TLP A;  3V0A A;  2ESU A;  2IHO A;  2ZR1 B;  5HPZ A;  2GO2 A;  2LIE A;  3CA1 A;  1EVT A;  2FFV A;  4QBV A;  3E8L C;  4J2Y A;  2M49 A;  3QYD A;  2QYI B;  1RG8 A;  2NP0 A;  3FJI A;  1FWU A;  41BI A;  2VUA A;  3PG0 A;  4ZKT B;  3BA7 A;  1I1E A;  4X38 A;  1FV3 A;  1AVU A;  2IWT B;  3IAG C;  1AXM A;  1XYF A;  2WRY A;  1AVA C;  3BAG A;  1Q04 A;  2F2F C;  1K5U A;  2DS0 A;  4ZFW B;  2FGF A;  1FWV A;  1S0L A;  2Y9G A;  4PC4 A;  4KEK A;  1CE7 B;  2KH2 A;  4I4O A;  1PZZ A;  3V0B B;  4OW4 A;  5BQU C;  1PC8 B;  31BI A;  1T9F A;  4ISQ A;  4JKX B;  1IJT A;  5DVH A;  1R8O A;  5D61 A;  3FJJ A;  3A22 A;  4J23 B;  4EFP A;  2VXR A;  1YF8 B;  4USO A;  4DEP A;  4EFQ A;  1J0S A;  2NTD A;  1ITB A;  3CQA A;  4ION A;  3WMU A;  3AKH A;  1RML A;  1BFB A;  2YUG A;  3FUO A;  3R4S A;  1JT7 A;  2ET2 A;  4A7Y A;  3RTJ B;  2BEB A;  1IT0 A;  3O4B A;  5FNX A;  4EEE B;  3K1X A;  4LO0 C;  3AJ5 A;  4LO7 C;  5G00 A;  4WBC A;  2D44 A;  2P39 A;  5JLV A;  1L2H A;  3BAD A;  3WIN C;  1N4K A;  3BB2 A;  3BAH A;  4I6I A;  3MAL A;  3RTI B;  1WBA A;  3WMV A;  4JP0 A;  1AF9 A;  1ILR 1;  4H9W A;  1MC9 A;  2ZQO A;  4I4P A;  3O44 A;  1DZD A;  3BTA A;  4I4V A;  3O4C A;  1P63 A;  4UY4 A;  4XFU A;  2D23 A;  3AKI A;  5BP5 A;  2ERM A;  1QXM A;  2NYY A;  2FFU A;  5BXT A;  4F34 A;  4GOV A;  1GGP B;  4XKI A;  3A21 A;  1TWE A;  2DRZ A;  3VSZ A;  3O4D A;  3FJH A;  4I4Q A;  4ZGR B;  1Q1U A;  3EF2 A;  3HOM A;  1FGA A;  1ABR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...