2Y9XE

Crystal structure of ppo3, a tyrosinase from agaricus bisporus, in deoxy-form that contains additional unknown lectin-like subunit, with inhibitor tropolone
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
142
structure length
136
Chain Sequence
LDLPGTRILNGANWANNSATSGTLIIFDQSTPGQDADRWLIHNYLDGYKIFNMGSNNWASVSRGNTVLGVSEFDGQTCKWSIEYSGNGEEFWIRVPREGGGGAVWTIKPASSQGPTTVFLDLLKETDPNQRIKFAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Agaricus Bisporus Mushroom Tyrosinase: Identity of the Tetramer Subunits and Interaction with Tropolone.
pubmed doi rcsb
molecule keywords POLYPHENOL OXIDASE
molecule tags Oxidoreductase
total genus 25
structure length 136
sequence length 142
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2011-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2y9xE00
1JT3A 5I1BA 2KKIA 4H9WA 4J23B 3V0BB 3VWCA 3WMVA 4II0A 4IZEA 4JP0A 1BA7A 1JT5A 3ZXDA 4D8HA 1BASA 1IHKA 4I4RA 2F2FA 4OWKA 1TTUA 1EPWA 4WBCA 3BRFA 3NJ5A 3OBTA 5GAQA 1G9DA 1HWOB 1L2HA 3BX1C 3RSJA 2NYYA 1HWMB 1JLYA 3UD8A 4LO2C 1G9AA 1PUUB 3OJ2A 2D7RA 1TIEA 4I4VA 1PZZA 3O3QA 4JQ0A 1F31A 4P0KA 4KBBA 1QQKA 1AVWB 5HPZA 3O4AA 1I1BA 3UJ0A 2KH2A 3AH1A 1Q03A 3OJMA 4P0LA 4GP3A 2ZR1B 3I2AA 3RTJB 5D63A 1S0DA 2UUSA 2K8RA 3OBRA 2DRYA 1TWEA 2AXMA 1YBIA 2RQ9A 1YXWA 3ZC9A 5D61A 2NZ9A 1FMZA 3A22A 1I1EA 3Q7WA 5FZUA 3CQAA 2VLCA 1RMLA 3CA4A 2D1ZA 3JUTA 1T9FA 4KEKA 3PMEA 2Q3NB 4ZOTA 3FJ8A 4TLPA 4LO7B 4Z8SB 4XFSA 4YOLA 3QYDA 2P39A 3FJAA 3VEQA 2D7IA 2VXTI 4QALA 1KNMA 3FJDA 3CAHA 3HALA 1OQLB 2Y9GA 4L4IA 2L5XA 1DQGA 1CVSA 2AAIB 3O44A 1BFFA 3WO4A 1SZ6B 3V0AB 4DENA 3LLPA 4PC4A 3UDAA 1GGPB 2VXRA 4USPA 3EF2A 3BRDA 4QBVA 3CU1B 4I4QA 5BXTA 4I7IA 1HIBA 4DCKC 1E0OA 3C9ZA 5G00A 3O4OA 4I4XA 3BAVA 3IAGC 3CRHA 1A8DA 1M2TB 2D23A 3FJHA 2KLLA 3MALA 3RMXA 3BTAA 1PUMB 2Z48A 3FJJA 4ISRA 2X2SA 1HWNB 1NZKA 3BAHA 3OJVA 1CE7B 3MPPG 4Q9GA 31BIA 1JY0A 4I3NA 4IONA 2R9KB 3BB2A 1W3AA 2ET2A 3Q7XA 1FQ9A 3H6RA 4LO0C 1IILA 1WD4A 2FFUA 3H6RB 1XYFA 4X38A 1Z4SA 4EKXB 1BFCA 4GOYA 8I1BA 3FJIA 3TC2A 2Z49A 3F62B 3SNVA 4I1EA 4EEEB 4I8MA 2E4MA 1JTCA 4IHZA 1V6WA 1NUNA 3CA3A 3AKFA 2BEBA 2GO2A 3CA1A 4I4YA 3ZX7A 4I4SA 3I2XA 1RG8A 5BP5C 3NBNA 3A21A 2DRZA 1DZDA 41BIA 1S0FA 2FDBM 4EB2B 1AF9A 1ISWA 1S0LA 4IY8A 5FZYA 4A7KA 3VSZA 1G9CA 3O4DA 1FN0A 4I1BA 1XZZA 4ZLBB 4L4HA 4KC3A 2I1BA 4G9MA 3E8LC 4ENDA 1II4A 2DREA 3CA0A 1AXMA 4I4UA 3FUQA 2BFHA 4QD2C 1JLXA 1IT0A 2KI6B 3T8SA 1XG6A 1ABRB 4FGFA 2XOAA 2VSEA 1DQOA 1BARA 3QR5A 1N4KA 2LIQA 1J0SA 1TWMA 4HR6C 3LTQA 4I4OA 1IRPA 4LO0A 1SR4C 2AQZA 1ISZA 3FJEA 3VUOA 1AFCA 1YTOA 2YUGA 4P6AA 3WO3A 4I4PA 2Y9XE 5F8YA 1AVUA 4JKQA 1DFCA 1BFBA 3CA6A 1HWPB 1MC9A 2MIBA 4QO3A 4FVVA 3BAUA 4Q9PA 1PWAA 3POKA 2LIEA 4HJJA 3HOMA 6I1BA 4OWJA 2K4AB 5DSSB 4X3AA 1DIWA 4I2SA 1FV2A 3VT2A 2BEAA 4GAIA 3H6SE 2KI4A 1V6XA 3O4CA 4OEFA 1Q1UA 3WA1A 4ZGRB 4QBCA 2FGFA 5D62A 3WINC 4JRAA 4ZFWB 5DUYA 2RSTA 2NTDA 2VUAA 3IIRA 2X2TA 4GP0A 1FMMS 3RMYA 1FWUA 4LO2A 1G9BA 1AVXB 4I6IA 4G6MA 2K43A 2ZQOA 1IOBA 1FWVA 2ERMA 4OWLA 4KEIA 3JRRA 1TOOA 4LO1C 4DEPA 4LO3C 4ZKTB 5BQUC 1R8OA 3UD9A 3OGFA 1K5VA 1RY7A 1V6VA 4IZXA 3N7JA 4KEJA 3AKIA 3O5WB 4ZBVB 2IWTB 1D0HA 1ISYA 2J3PA 1DZCA 3I29B 4I96A 2HZ9A 5BXSA 3BAOA 3ZXGA 5DVHA 3HBWA 1YF8B 1FV3A 3P6IA 2DS0A 3VSFA 1K5UA 1S0BA 3D7WB 3HN1A 5FNWA 2D22A 3HSMA 3A23A 1WBAA 4J2KA 4JPZA 1MD6A 4J2YA 4I37A 2RG9B 2D43A 4EFRA 2HW9A 5F8WA 4ZFUB 3WINA 4J2SA 3BAGA 2NP0A 1R8NA 4OW4A 3HMYA 4XFTA 1EYLA 1HCDA 4QKSA 3BA5A 3N0KA 4F83A 1BFGA 1DLLA 1G82A 4ZFYB 3AZWA 1HKNA 2WBCA 4GAFA 4LO8B 2FO1A 4LO1A 4J2XA 4LO3A 5BQUA 2F8XC 1AVAC 1S0EA 3CRGA 1S0GA 3V0BA 1ONKB 2GZBA 3FGMA 4ISQA 4EFQA 2QN4A 4LO7C 1DFQA 2P23A 1Q04A 3PUBA 3BA7A 5BOWA 1QQLA 2MC2A 3Q7YA 3P53A 7I1BA 1VCLA 5EG6C 3R4SA 4GOVA 5BVPI 3FUOA 3F1RA 4JAWA 3B9UA 3FJ9A 2D44A 1W3FA 4IQPA 4A7YA 1ISXA 1M16A 3V79C 4H04A 3WO2A 3FJKA 2FFVA 2Q9XA 3P6JA 3N7MA 1YYNA 1JQZA 2D24A 4G1RA 2MLLB 4D0TA 2HWAA 2ZQNA 3O49A 1W3GA 3ZC8A 5B2HA 5BP5A 3IM6A 3N7LA 3BRGC 1ITBA 3BADA 3W9TA 3NBDA 3NBEA 4A7ZA 3CA5A 4P0JA 3S8JA 3IM7A 4OEEA 4USOA 1V6UA 2M49A 4AN6A 5JLVA 1HCEA 1XHBA 1EVTA 2Y9FA 1JT7A 5EC5A 3OGGA 4QD2B 4QKRA 5FZZA 3NBCA 3H6QA 3FJCA 3PHZA 4EFPA 3FJBA 4G6JA 1BLAA 5JMCA 3AH4A 21BIA 2ESUA 1FGAA 4IYBA 1IJTA 4OUJA 4X39A 2E4MC 3AKGA 3IM5A 1SR4A 3PG0A 3V0AA 1Z2VA 5EHAA 2QYIB 3CRIA 4ZA3B 3VT0A 2Y9WC 3AZVA 4D0ZA 1JT4A 2NVHA 2IHOA 3ILAA 1TFMB 1RZOB 4QC4A 4JKXB 2F2FC 3K1XA 2VU9A 3O4BA 4HA2A 4IY9A 1S0CA 1P63A 1TP0A 3S8KA 1ISVA 4G9NA 4XFUA 4OEGA 3AJ5A 5BXPA 3KMVA 2WRYA 3R4UA 5DZUA 2NM1A 2HWMA 4Z9WB 4R6UB 3FJFA 3VT1A 1EV2A 1Z0HA 5FNXA 1ILR1 2VSAA 3WMUA 1BLDA 4X37A 3UJ4A 3N7KA 1T4QA 4XKIA 1WD3A 5E24E 3AKHA 3UD7A 3AH2A 4AN7B 5F8SA 1QXMA 3RTIB 4F34A 1WBCA 2D20A 5F90A 3AJ6A 1DJSB 2AFGA 3A07A 1PC8B 4Q91A 3FFZA 4I0YA 5BXRA 1IRAX 1UPSA 3BAQA 9ILBA 3BA4A 4CJMA
chains in the Genus database with same CATH superfamily
1JT3A 5I1BA 2KKIA 4H9WA 4J23B 3V0BB 3VWCA 3WMVA 4II0A 4IZEA 4JP0A 1BA7A 1JT5A 3ZXDA 4D8HA 1BASA 1IHKA 4I4RA 2F2FA 4OWKA 1TTUA 1EPWA 4WBCA 3BRFA 3NJ5A 3OBTA 5GAQA 1G9DA 1HWOB 1L2HA 3BX1C 3RSJA 2NYYA 1HWMB 1JLYA 3UD8A 4LO2C 1G9AA 1PUUB 3OJ2A 2D7RA 1TIEA 4I4VA 1PZZA 3O3QA 4JQ0A 1F31A 4P0KA 4KBBA 1QQKA 1AVWB 5HPZA 3O4AA 1I1BA 3UJ0A 2KH2A 3AH1A 1Q03A 3OJMA 4P0LA 4GP3A 2ZR1B 3I2AA 3RTJB 5D63A 1S0DA 2UUSA 2K8RA 3OBRA 2DRYA 1TWEA 2AXMA 1YBIA 2RQ9A 1YXWA 3ZC9A 5D61A 2NZ9A 1FMZA 3A22A 1I1EA 3Q7WA 5FZUA 3CQAA 2VLCA 1RMLA 3CA4A 2D1ZA 3JUTA 1T9FA 4KEKA 3PMEA 2Q3NB 4ZOTA 3FJ8A 4TLPA 4LO7B 4Z8SB 4XFSA 4YOLA 3QYDA 2P39A 3FJAA 3VEQA 2D7IA 2VXTI 4QALA 1KNMA 3FJDA 3CAHA 3HALA 1OQLB 2Y9GA 4L4IA 2L5XA 1DQGA 1CVSA 2AAIB 3O44A 1BFFA 3WO4A 1SZ6B 3V0AB 4DENA 3LLPA 4PC4A 3UDAA 1GGPB 2VXRA 4USPA 3EF2A 4MZFB 3BRDA 4QBVA 3CU1B 4I4QA 5BXTA 4I7IA 1HIBA 4DCKC 1E0OA 3C9ZA 5G00A 3O4OA 4I4XA 3BAVA 3IAGC 3CRHA 1A8DA 1M2TB 2D23A 3FJHA 2KLLA 3MALA 3RMXA 3BTAA 1PUMB 2Z48A 3FJJA 4ISRA 2X2SA 1HWNB 1NZKA 3BAHA 3OJVA 1CE7B 3MPPG 4Q9GA 31BIA 1JY0A 4I3NA 4IONA 2R9KB 3BB2A 1W3AA 2ET2A 3Q7XA 1FQ9A 3H6RA 4LO0C 1IILA 1WD4A 2FFUA 3H6RB 1XYFA 4X38A 1Z4SA 4EKXB 1BFCA 4GOYA 8I1BA 3FJIA 3TC2A 2Z49A 3F62B 3SNVA 4I1EA 4EEEB 4I8MA 2E4MA 1JTCA 4IHZA 1V6WA 1NUNA 3CA3A 3AKFA 2BEBA 2GO2A 3CA1A 4I4YA 4MZGB 3ZX7A 4I4SA 3I2XA 1RG8A 5BP5C 3NBNA 3A21A 2DRZA 1DZDA 41BIA 1S0FA 2FDBM 4EB2B 1AF9A 1ISWA 1S0LA 4IY8A 5FZYA 4A7KA 3VSZA 1G9CA 3O4DA 1FN0A 4I1BA 1XZZA 4ZLBB 4L4HA 4KC3A 2I1BA 4G9MA 3E8LC 4ENDA 1II4A 2DREA 3CA0A 1AXMA 4I4UA 3FUQA 2BFHA 4QD2C 1JLXA 1IT0A 2KI6B 3T8SA 1XG6A 1ABRB 4FGFA 2XOAA 2VSEA 1DQOA 1BARA 3QR5A 1N4KA 2LIQA 1J0SA 1TWMA 4HR6C 3LTQA 4I4OA 1IRPA 4LO0A 1SR4C 2AQZA 1ISZA 3FJEA 3VUOA 1AFCA 1YTOA 2YUGA 4P6AA 3WO3A 4I4PA 2Y9XE 5F8YA 1AVUA 4JKQA 4UY4A 1DFCA 1BFBA 3CA6A 1HWPB 1MC9A 2MIBA 4QO3A 4FVVA 3BAUA 4Q9PA 1PWAA 3POKA 2LIEA 4HJJA 3HOMA 6I1BA 4OWJA 2K4AB 5DSSB 4X3AA 1DIWA 4I2SA 1FV2A 3VT2A 2BEAA 4GAIA 3H6SE 2KI4A 1V6XA 3O4CA 4OEFA 1Q1UA 3WA1A 4ZGRB 4QBCA 2FGFA 5D62A 3WINC 4JRAA 4ZFWB 5DUYA 2RSTA 2NTDA 2VUAA 3IIRA 2X2TA 4GP0A 1FMMS 3RMYA 1FWUA 4LO2A 1G9BA 1AVXB 4I6IA 4G6MA 2K43A 2ZQOA 1IOBA 1FWVA 2ERMA 4OWLA 4KEIA 3JRRA 1TOOA 4LO1C 4DEPA 4LO3C 4ZKTB 5BQUC 1R8OA 3UD9A 3OGFA 1K5VA 1RY7A 1V6VA 4IZXA 3N7JA 4KEJA 3AKIA 3O5WB 4ZBVB 2IWTB 1D0HA 1ISYA 2J3PA 1DZCA 3I29B 4I96A 2HZ9A 5BXSA 3BAOA 3ZXGA 5DVHA 3HBWA 1YF8B 1FV3A 3P6IA 2DS0A 3VSFA 1K5UA 1S0BA 3D7WB 3HN1A 5FNWA 2D22A 3HSMA 3A23A 1WBAA 4J2KA 4JPZA 1MD6A 4J2YA 4I37A 2RG9B 2D43A 4EFRA 2HW9A 5F8WA 4ZFUB 3WINA 4J2SA 3BAGA 2NP0A 1R8NA 4OW4A 3HMYA 4XFTA 1EYLA 1HCDA 4QKSA 3BA5A 3N0KA 4F83A 1BFGA 1DLLA 1G82A 4ZFYB 3AZWA 1HKNA 2WBCA 4GAFA 4LO8B 2FO1A 4LO1A 4J2XA 4LO3A 5BQUA 2F8XC 1AVAC 1S0EA 3CRGA 1S0GA 3V0BA 1ONKB 2GZBA 3FGMA 4ISQA 4EFQA 2QN4A 4LO7C 1DFQA 2P23A 1Q04A 3PUBA 3BA7A 5BOWA 1QQLA 2MC2A 3Q7YA 3P53A 7I1BA 1VCLA 5EG6C 4H75A 3R4SA 4GOVA 5BVPI 3FUOA 3F1RA 4JAWA 3B9UA 3FJ9A 2D44A 1W3FA 4IQPA 4A7YA 1ISXA 1M16A 3V79C 2NS2A 4H04A 3WO2A 3FJKA 2FFVA 4MZHA 2Q9XA 3P6JA 3N7MA 1YYNA 1JQZA 2D24A 4G1RA 2MLLB 4D0TA 2HWAA 2ZQNA 3O49A 1W3GA 3ZC8A 5B2HA 5BP5A 3IM6A 3N7LA 3BRGC 1ITBA 3BADA 3W9TA 3NBDA 3NBEA 4A7ZA 3CA5A 4P0JA 3S8JA 3IM7A 4OEEA 4USOA 1V6UA 2M49A 4AN6A 5JLVA 1HCEA 1XHBA 1EVTA 2Y9FA 1JT7A 5EC5A 3OGGA 4QD2B 4QKRA 5FZZA 3NBCA 3H6QA 3FJCA 3PHZA 4EFPA 3FJBA 4G6JA 1BLAA 5JMCA 3AH4A 21BIA 2ESUA 1FGAA 4IYBA 1IJTA 4OUJA 4X39A 2E4MC 3AKGA 3IM5A 1SR4A 3PG0A 3V0AA 1Z2VA 5EHAA 2QYIB 3CRIA 4ZA3B 3VT0A 2Y9WC 3AZVA 4D0ZA 1JT4A 2NVHA 2IHOA 3ILAA 1TFMB 1RZOB 4QC4A 4JKXB 2F2FC 3K1XA 2VU9A 3O4BA 4HA2A 4IY9A 1S0CA 1P63A 1TP0A 3S8KA 1ISVA 4G9NA 4XFUA 4OEGA 3AJ5A 5BXPA 3KMVA 2WRYA 3R4UA 5DZUA 2NM1A 2HWMA 4Z9WB 4R6UB 3FJFA 3VT1A 1EV2A 1Z0HA 5FNXA 1ILR1 2VSAA 3WMUA 1BLDA 4X37A 3UJ4A 3N7KA 1T4QA 4XKIA 1WD3A 5E24E 3AKHA 3UD7A 3AH2A 4AN7B 5F8SA 1QXMA 3RTIB 4F34A 1WBCA 2D20A 5F90A 3AJ6A 1DJSB 2AFGA 3A07A 1PC8B 4Q91A 3FFZA 4I0YA 5BXRA 1IRAX 1UPSA 3BAQA 9ILBA 3BA4A 4CJMA
chains in the Genus database with same CATH topology
1JT3A 5I1BA 2KKIA 4H9WA 4J23B 3V0BB 3VWCA 3WMVA 4II0A 4IZEA 4JP0A 1BA7A 1JT5A 3ZXDA 4D8HA 1BASA 1IHKA 4I4RA 2F2FA 4OWKA 1TTUA 1EPWA 4WBCA 3BRFA 3NJ5A 3OBTA 5GAQA 1G9DA 1HWOB 1L2HA 3BX1C 3RSJA 2NYYA 1HWMB 1JLYA 3UD8A 4LO2C 1G9AA 1PUUB 3OJ2A 2D7RA 1TIEA 4I4VA 1PZZA 3O3QA 4JQ0A 1F31A 4P0KA 4KBBA 1QQKA 1AVWB 5HPZA 3O4AA 1I1BA 3UJ0A 2KH2A 3AH1A 1Q03A 3OJMA 4P0LA 4GP3A 2ZR1B 3I2AA 3RTJB 5D63A 1S0DA 2UUSA 2K8RA 3OBRA 2DRYA 1TWEA 2AXMA 1YBIA 2RQ9A 1YXWA 3ZC9A 5D61A 2NZ9A 1FMZA 3A22A 1I1EA 3Q7WA 5FZUA 3CQAA 2VLCA 1RMLA 3CA4A 2D1ZA 3JUTA 1T9FA 4KEKA 3PMEA 2Q3NB 4ZOTA 3FJ8A 4TLPA 4LO7B 4Z8SB 4XFSA 4YOLA 3QYDA 2P39A 3FJAA 3VEQA 2D7IA 2VXTI 4QALA 1KNMA 3FJDA 3CAHA 3HALA 1OQLB 2Y9GA 4L4IA 2L5XA 1DQGA 1CVSA 2AAIB 3O44A 1BFFA 3WO4A 1SZ6B 3V0AB 4DENA 3LLPA 4PC4A 3UDAA 1GGPB 2VXRA 4USPA 3EF2A 4MZFB 3BRDA 4QBVA 3CU1B 4I4QA 5BXTA 4I7IA 1HIBA 4DCKC 1E0OA 3C9ZA 5G00A 3O4OA 4I4XA 3BAVA 3IAGC 3CRHA 1A8DA 1M2TB 2D23A 3FJHA 2KLLA 3MALA 3RMXA 3BTAA 1PUMB 2Z48A 3FJJA 4ISRA 2X2SA 1HWNB 1NZKA 3BAHA 3OJVA 1CE7B 3MPPG 4Q9GA 31BIA 1JY0A 4I3NA 4IONA 2R9KB 3BB2A 1W3AA 2ET2A 3Q7XA 1FQ9A 3H6RA 4LO0C 1IILA 1WD4A 2FFUA 3H6RB 1XYFA 4X38A 1Z4SA 4EKXB 1BFCA 4GOYA 8I1BA 3FJIA 3TC2A 2Z49A 3F62B 3SNVA 4I1EA 4EEEB 4I8MA 2E4MA 1JTCA 4IHZA 1V6WA 1NUNA 3CA3A 3AKFA 2BEBA 2GO2A 3CA1A 4I4YA 4MZGB 3ZX7A 4I4SA 3I2XA 1RG8A 5BP5C 3NBNA 3A21A 2DRZA 1DZDA 41BIA 1S0FA 2FDBM 4EB2B 1AF9A 1ISWA 1S0LA 4IY8A 5FZYA 4A7KA 3VSZA 1G9CA 3O4DA 1FN0A 4I1BA 1XZZA 4ZLBB 4L4HA 4KC3A 2I1BA 4G9MA 3E8LC 4ENDA 1II4A 2DREA 3CA0A 1AXMA 4I4UA 3FUQA 2BFHA 4QD2C 1JLXA 1IT0A 2KI6B 3T8SA 1XG6A 1ABRB 4FGFA 2XOAA 2VSEA 1DQOA 1BARA 3QR5A 1N4KA 2LIQA 1J0SA 1TWMA 4HR6C 3LTQA 4I4OA 1IRPA 4LO0A 1SR4C 2AQZA 1ISZA 3FJEA 3VUOA 1AFCA 1YTOA 2YUGA 4P6AA 3WO3A 4I4PA 2Y9XE 5F8YA 1AVUA 4JKQA 4UY4A 1DFCA 1BFBA 3CA6A 1HWPB 1MC9A 2MIBA 4QO3A 4FVVA 3BAUA 4Q9PA 1PWAA 3POKA 2LIEA 4HJJA 3HOMA 6I1BA 4OWJA 2K4AB 5DSSB 4X3AA 1DIWA 4I2SA 1FV2A 3VT2A 2BEAA 4GAIA 3H6SE 2KI4A 1V6XA 3O4CA 4OEFA 1Q1UA 3WA1A 4ZGRB 4QBCA 2FGFA 5D62A 3WINC 4JRAA 4ZFWB 5DUYA 2RSTA 2NTDA 2VUAA 3IIRA 2X2TA 4GP0A 1FMMS 3RMYA 1FWUA 4LO2A 1G9BA 1AVXB 4I6IA 4G6MA 2K43A 2ZQOA 1IOBA 1FWVA 2ERMA 4OWLA 4KEIA 3JRRA 1TOOA 4LO1C 4DEPA 4LO3C 4ZKTB 5BQUC 1R8OA 3UD9A 3OGFA 1K5VA 1RY7A 1V6VA 4IZXA 3N7JA 4KEJA 3AKIA 3O5WB 4ZBVB 2IWTB 1D0HA 1ISYA 2J3PA 1DZCA 3I29B 4I96A 2HZ9A 5BXSA 3BAOA 3ZXGA 5DVHA 3HBWA 1YF8B 1FV3A 3P6IA 2DS0A 3VSFA 1K5UA 1S0BA 3D7WB 3HN1A 5FNWA 2D22A 3HSMA 3A23A 1WBAA 4J2KA 4JPZA 1MD6A 4J2YA 4I37A 2RG9B 2D43A 4EFRA 2HW9A 5F8WA 4ZFUB 3WINA 4J2SA 3BAGA 2NP0A 1R8NA 4OW4A 3HMYA 4XFTA 1EYLA 1HCDA 4QKSA 3BA5A 3N0KA 4F83A 1BFGA 1DLLA 1G82A 4ZFYB 3AZWA 1HKNA 2WBCA 4GAFA 4LO8B 2FO1A 4LO1A 4J2XA 4LO3A 5BQUA 2F8XC 1AVAC 1S0EA 3CRGA 1S0GA 3V0BA 1ONKB 2GZBA 3FGMA 4ISQA 4EFQA 2QN4A 4LO7C 1DFQA 2P23A 1Q04A 3PUBA 3BA7A 5BOWA 1QQLA 2MC2A 3Q7YA 3P53A 7I1BA 1VCLA 5EG6C 4H75A 3R4SA 4GOVA 5BVPI 3FUOA 3F1RA 4JAWA 3B9UA 3FJ9A 2D44A 1W3FA 4IQPA 4A7YA 1ISXA 1M16A 3V79C 2NS2A 4H04A 3WO2A 3FJKA 2FFVA 4MZHA 2Q9XA 3P6JA 3N7MA 1YYNA 1JQZA 2D24A 4G1RA 2MLLB 4D0TA 2HWAA 2ZQNA 3O49A 1W3GA 3ZC8A 5B2HA 5BP5A 3IM6A 3N7LA 3BRGC 1ITBA 3BADA 3W9TA 3NBDA 3NBEA 4A7ZA 3CA5A 4P0JA 3S8JA 3IM7A 4OEEA 4USOA 1V6UA 2M49A 4AN6A 5JLVA 1HCEA 1XHBA 1EVTA 2Y9FA 1JT7A 5EC5A 3OGGA 4QD2B 4QKRA 5FZZA 3NBCA 3H6QA 3FJCA 3PHZA 4EFPA 3FJBA 4G6JA 1BLAA 5JMCA 3AH4A 21BIA 2ESUA 1FGAA 4IYBA 1IJTA 4OUJA 4X39A 2E4MC 3AKGA 3IM5A 1SR4A 3PG0A 3V0AA 1Z2VA 5EHAA 2QYIB 3CRIA 4ZA3B 3VT0A 2Y9WC 3AZVA 4D0ZA 1JT4A 2NVHA 2IHOA 3ILAA 1TFMB 1RZOB 4QC4A 4JKXB 2F2FC 3K1XA 2VU9A 3O4BA 4HA2A 4IY9A 1S0CA 1P63A 1TP0A 3S8KA 1ISVA 4G9NA 4XFUA 4OEGA 3AJ5A 5BXPA 3KMVA 2WRYA 3R4UA 5DZUA 2NM1A 2HWMA 4Z9WB 4R6UB 3FJFA 3VT1A 1EV2A 1Z0HA 5FNXA 1ILR1 2VSAA 3WMUA 1BLDA 4X37A 3UJ4A 3N7KA 1T4QA 4XKIA 1WD3A 5E24E 3AKHA 3UD7A 3AH2A 4AN7B 5F8SA 1QXMA 3RTIB 4F34A 1WBCA 2D20A 5F90A 3AJ6A 1DJSB 2AFGA 3A07A 1PC8B 4Q91A 3FFZA 4I0YA 5BXRA 1IRAX 1UPSA 3BAQA 9ILBA 3BA4A 4CJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JT3 A;  5I1B A;  2KKI A;  4H9W A;  4J23 B;  3V0B B;  3VWC A;  3WMV A;  4II0 A;  4IZE A;  4JP0 A;  1BA7 A;  1JT5 A;  3ZXD A;  4D8H A;  1BAS A;  1IHK A;  4I4R A;  2F2F A;  4OWK A;  1TTU A;  1EPW A;  4WBC A;  3BRF A;  3NJ5 A;  3OBT A;  5GAQ A;  1G9D A;  1HWO B;  1L2H A;  3BX1 C;  3RSJ A;  2NYY A;  1HWM B;  1JLY A;  3UD8 A;  4LO2 C;  1G9A A;  1PUU B;  3OJ2 A;  2D7R A;  1TIE A;  4I4V A;  1PZZ A;  3O3Q A;  4JQ0 A;  1F31 A;  4P0K A;  4KBB A;  1QQK A;  1AVW B;  5HPZ A;  3O4A A;  1I1B A;  3UJ0 A;  2KH2 A;  3AH1 A;  1Q03 A;  3OJM A;  4P0L A;  4GP3 A;  2ZR1 B;  3I2A A;  3RTJ B;  5D63 A;  1S0D A;  2UUS A;  2K8R A;  3OBR A;  2DRY A;  1TWE A;  2AXM A;  1YBI A;  2RQ9 A;  1YXW A;  3ZC9 A;  5D61 A;  2NZ9 A;  1FMZ A;  3A22 A;  1I1E A;  3Q7W A;  5FZU A;  3CQA A;  2VLC A;  1RML A;  3CA4 A;  2D1Z A;  3JUT A;  1T9F A;  4KEK A;  3PME A;  2Q3N B;  4ZOT A;  3FJ8 A;  4TLP A;  4LO7 B;  4Z8S B;  4XFS A;  4YOL A;  3QYD A;  2P39 A;  3FJA A;  3VEQ A;  2D7I A;  2VXT I;  4QAL A;  1KNM A;  3FJD A;  3CAH A;  3HAL A;  1OQL B;  2Y9G A;  4L4I A;  2L5X A;  1DQG A;  1CVS A;  2AAI B;  3O44 A;  1BFF A;  3WO4 A;  1SZ6 B;  3V0A B;  4DEN A;  3LLP A;  4PC4 A;  3UDA A;  1GGP B;  2VXR A;  4USP A;  3EF2 A;  3BRD A;  4QBV A;  3CU1 B;  4I4Q A;  5BXT A;  4I7I A;  1HIB A;  4DCK C;  1E0O A;  3C9Z A;  5G00 A;  3O4O A;  4I4X A;  3BAV A;  3IAG C;  3CRH A;  1A8D A;  1M2T B;  2D23 A;  3FJH A;  2KLL A;  3MAL A;  3RMX A;  3BTA A;  1PUM B;  2Z48 A;  3FJJ A;  4ISR A;  2X2S A;  1HWN B;  1NZK A;  3BAH A;  3OJV A;  1CE7 B;  3MPP G;  4Q9G A;  31BI A;  1JY0 A;  4I3N A;  4ION A;  2R9K B;  3BB2 A;  1W3A A;  2ET2 A;  3Q7X A;  1FQ9 A;  3H6R A;  4LO0 C;  1IIL A;  1WD4 A;  2FFU A;  3H6R B;  1XYF A;  4X38 A;  1Z4S A;  4EKX B;  1BFC A;  4GOY A;  8I1B A;  3FJI A;  3TC2 A;  2Z49 A;  3F62 B;  3SNV A;  4I1E A;  4EEE B;  4I8M A;  2E4M A;  1JTC A;  4IHZ A;  1V6W A;  1NUN A;  3CA3 A;  3AKF A;  2BEB A;  2GO2 A;  3CA1 A;  4I4Y A;  3ZX7 A;  4I4S A;  3I2X A;  1RG8 A;  5BP5 C;  3NBN A;  3A21 A;  2DRZ A;  1DZD A;  41BI A;  1S0F A;  2FDB M;  4EB2 B;  1AF9 A;  1ISW A;  1S0L A;  4IY8 A;  5FZY A;  4A7K A;  3VSZ A;  1G9C A;  3O4D A;  1FN0 A;  4I1B A;  1XZZ A;  4ZLB B;  4L4H A;  4KC3 A;  2I1B A;  4G9M A;  3E8L C;  4END A;  1II4 A;  2DRE A;  3CA0 A;  1AXM A;  4I4U A;  3FUQ A;  2BFH A;  4QD2 C;  1JLX A;  1IT0 A;  2KI6 B;  3T8S A;  1XG6 A;  1ABR B;  4FGF A;  2XOA A;  2VSE A;  1DQO A;  1BAR A;  3QR5 A;  1N4K A;  2LIQ A;  1J0S A;  1TWM A;  4HR6 C;  3LTQ A;  4I4O A;  1IRP A;  4LO0 A;  1SR4 C;  2AQZ A;  1ISZ A;  3FJE A;  3VUO A;  1AFC A;  1YTO A;  2YUG A;  4P6A A;  3WO3 A;  4I4P A;  2Y9X E;  5F8Y A;  1AVU A;  4JKQ A;  1DFC A;  1BFB A;  3CA6 A;  1HWP B;  1MC9 A;  2MIB A;  4QO3 A;  4FVV A;  3BAU A;  4Q9P A;  1PWA A;  3POK A;  2LIE A;  4HJJ A;  3HOM A;  6I1B A;  4OWJ A;  2K4A B;  5DSS B;  4X3A A;  1DIW A;  4I2S A;  1FV2 A;  3VT2 A;  2BEA A;  4GAI A;  3H6S E;  2KI4 A;  1V6X A;  3O4C A;  4OEF A;  1Q1U A;  3WA1 A;  4ZGR B;  4QBC A;  2FGF A;  5D62 A;  3WIN C;  4JRA A;  4ZFW B;  5DUY A;  2RST A;  2NTD A;  2VUA A;  3IIR A;  2X2T A;  4GP0 A;  1FMM S;  3RMY A;  1FWU A;  4LO2 A;  1G9B A;  1AVX B;  4I6I A;  4G6M A;  2K43 A;  2ZQO A;  1IOB A;  1FWV A;  2ERM A;  4OWL A;  4KEI A;  3JRR A;  1TOO A;  4LO1 C;  4DEP A;  4LO3 C;  4ZKT B;  5BQU C;  1R8O A;  3UD9 A;  3OGF A;  1K5V A;  1RY7 A;  1V6V A;  4IZX A;  3N7J A;  4KEJ A;  3AKI A;  3O5W B;  4ZBV B;  2IWT B;  1D0H A;  1ISY A;  2J3P A;  1DZC A;  3I29 B;  4I96 A;  2HZ9 A;  5BXS A;  3BAO A;  3ZXG A;  5DVH A;  3HBW A;  1YF8 B;  1FV3 A;  3P6I A;  2DS0 A;  3VSF A;  1K5U A;  1S0B A;  3D7W B;  3HN1 A;  5FNW A;  2D22 A;  3HSM A;  3A23 A;  1WBA A;  4J2K A;  4JPZ A;  1MD6 A;  4J2Y A;  4I37 A;  2RG9 B;  2D43 A;  4EFR A;  2HW9 A;  5F8W A;  4ZFU B;  3WIN A;  4J2S A;  3BAG A;  2NP0 A;  1R8N A;  4OW4 A;  3HMY A;  4XFT A;  1EYL A;  1HCD A;  4QKS A;  3BA5 A;  3N0K A;  4F83 A;  1BFG A;  1DLL A;  1G82 A;  4ZFY B;  3AZW A;  1HKN A;  2WBC A;  4GAF A;  4LO8 B;  2FO1 A;  4LO1 A;  4J2X A;  4LO3 A;  5BQU A;  2F8X C;  1AVA C;  1S0E A;  3CRG A;  1S0G A;  3V0B A;  1ONK B;  2GZB A;  3FGM A;  4ISQ A;  4EFQ A;  2QN4 A;  4LO7 C;  1DFQ A;  2P23 A;  1Q04 A;  3PUB A;  3BA7 A;  5BOW A;  1QQL A;  2MC2 A;  3Q7Y A;  3P53 A;  7I1B A;  1VCL A;  5EG6 C;  3R4S A;  4GOV A;  5BVP I;  3FUO A;  3F1R A;  4JAW A;  3B9U A;  3FJ9 A;  2D44 A;  1W3F A;  4IQP A;  4A7Y A;  1ISX A;  1M16 A;  3V79 C;  4H04 A;  3WO2 A;  3FJK A;  2FFV A;  2Q9X A;  3P6J A;  3N7M A;  1YYN A;  1JQZ A;  2D24 A;  4G1R A;  2MLL B;  4D0T A;  2HWA A;  2ZQN A;  3O49 A;  1W3G A;  3ZC8 A;  5B2H A;  5BP5 A;  3IM6 A;  3N7L A;  3BRG C;  1ITB A;  3BAD A;  3W9T A;  3NBD A;  3NBE A;  4A7Z A;  3CA5 A;  4P0J A;  3S8J A;  3IM7 A;  4OEE A;  4USO A;  1V6U A;  2M49 A;  4AN6 A;  5JLV A;  1HCE A;  1XHB A;  1EVT A;  2Y9F A;  1JT7 A;  5EC5 A;  3OGG A;  4QD2 B;  4QKR A;  5FZZ A;  3NBC A;  3H6Q A;  3FJC A;  3PHZ A;  4EFP A;  3FJB A;  4G6J A;  1BLA A;  5JMC A;  3AH4 A;  21BI A;  2ESU A;  1FGA A;  4IYB A;  1IJT A;  4OUJ A;  4X39 A;  2E4M C;  3AKG A;  3IM5 A;  1SR4 A;  3PG0 A;  3V0A A;  1Z2V A;  5EHA A;  2QYI B;  3CRI A;  4ZA3 B;  3VT0 A;  2Y9W C;  3AZV A;  4D0Z A;  1JT4 A;  2NVH A;  2IHO A;  3ILA A;  1TFM B;  1RZO B;  4QC4 A;  4JKX B;  2F2F C;  3K1X A;  2VU9 A;  3O4B A;  4HA2 A;  4IY9 A;  1S0C A;  1P63 A;  1TP0 A;  3S8K A;  1ISV A;  4G9N A;  4XFU A;  4OEG A;  3AJ5 A;  5BXP A;  3KMV A;  2WRY A;  3R4U A;  5DZU A;  2NM1 A;  2HWM A;  4Z9W B;  4R6U B;  3FJF A;  3VT1 A;  1EV2 A;  1Z0H A;  5FNX A;  1ILR 1;  2VSA A;  3WMU A;  1BLD A;  4X37 A;  3UJ4 A;  3N7K A;  1T4Q A;  4XKI A;  1WD3 A;  5E24 E;  3AKH A;  3UD7 A;  3AH2 A;  4AN7 B;  5F8S A;  1QXM A;  3RTI B;  4F34 A;  1WBC A;  2D20 A;  5F90 A;  3AJ6 A;  1DJS B;  2AFG A;  3A07 A;  1PC8 B;  4Q91 A;  3FFZ A;  4I0Y A;  5BXR A;  1IRA X;  1UPS A;  3BAQ A;  9ILB A;  3BA4 A;  4CJM A; 
#chains in the Genus database with same CATH topology
 1JT3 A;  5I1B A;  2KKI A;  4H9W A;  4J23 B;  3V0B B;  3VWC A;  3WMV A;  4II0 A;  4IZE A;  4JP0 A;  1BA7 A;  1JT5 A;  3ZXD A;  4D8H A;  1BAS A;  1IHK A;  4I4R A;  2F2F A;  4OWK A;  1TTU A;  1EPW A;  4WBC A;  3BRF A;  3NJ5 A;  3OBT A;  5GAQ A;  1G9D A;  1HWO B;  1L2H A;  3BX1 C;  3RSJ A;  2NYY A;  1HWM B;  1JLY A;  3UD8 A;  4LO2 C;  1G9A A;  1PUU B;  3OJ2 A;  2D7R A;  1TIE A;  4I4V A;  1PZZ A;  3O3Q A;  4JQ0 A;  1F31 A;  4P0K A;  4KBB A;  1QQK A;  1AVW B;  5HPZ A;  3O4A A;  1I1B A;  3UJ0 A;  2KH2 A;  3AH1 A;  1Q03 A;  3OJM A;  4P0L A;  4GP3 A;  2ZR1 B;  3I2A A;  3RTJ B;  5D63 A;  1S0D A;  2UUS A;  2K8R A;  3OBR A;  2DRY A;  1TWE A;  2AXM A;  1YBI A;  2RQ9 A;  1YXW A;  3ZC9 A;  5D61 A;  2NZ9 A;  1FMZ A;  3A22 A;  1I1E A;  3Q7W A;  5FZU A;  3CQA A;  2VLC A;  1RML A;  3CA4 A;  2D1Z A;  3JUT A;  1T9F A;  4KEK A;  3PME A;  2Q3N B;  4ZOT A;  3FJ8 A;  4TLP A;  4LO7 B;  4Z8S B;  4XFS A;  4YOL A;  3QYD A;  2P39 A;  3FJA A;  3VEQ A;  2D7I A;  2VXT I;  4QAL A;  1KNM A;  3FJD A;  3CAH A;  3HAL A;  1OQL B;  2Y9G A;  4L4I A;  2L5X A;  1DQG A;  1CVS A;  2AAI B;  3O44 A;  1BFF A;  3WO4 A;  1SZ6 B;  3V0A B;  4DEN A;  3LLP A;  4PC4 A;  3UDA A;  1GGP B;  2VXR A;  4USP A;  3EF2 A;  4MZF B;  3BRD A;  4QBV A;  3CU1 B;  4I4Q A;  5BXT A;  4I7I A;  1HIB A;  4DCK C;  1E0O A;  3C9Z A;  5G00 A;  3O4O A;  4I4X A;  3BAV A;  3IAG C;  3CRH A;  1A8D A;  1M2T B;  2D23 A;  3FJH A;  2KLL A;  3MAL A;  3RMX A;  3BTA A;  1PUM B;  2Z48 A;  3FJJ A;  4ISR A;  2X2S A;  1HWN B;  1NZK A;  3BAH A;  3OJV A;  1CE7 B;  3MPP G;  4Q9G A;  31BI A;  1JY0 A;  4I3N A;  4ION A;  2R9K B;  3BB2 A;  1W3A A;  2ET2 A;  3Q7X A;  1FQ9 A;  3H6R A;  4LO0 C;  1IIL A;  1WD4 A;  2FFU A;  3H6R B;  1XYF A;  4X38 A;  1Z4S A;  4EKX B;  1BFC A;  4GOY A;  8I1B A;  3FJI A;  3TC2 A;  2Z49 A;  3F62 B;  3SNV A;  4I1E A;  4EEE B;  4I8M A;  2E4M A;  1JTC A;  4IHZ A;  1V6W A;  1NUN A;  3CA3 A;  3AKF A;  2BEB A;  2GO2 A;  3CA1 A;  4I4Y A;  4MZG B;  3ZX7 A;  4I4S A;  3I2X A;  1RG8 A;  5BP5 C;  3NBN A;  3A21 A;  2DRZ A;  1DZD A;  41BI A;  1S0F A;  2FDB M;  4EB2 B;  1AF9 A;  1ISW A;  1S0L A;  4IY8 A;  5FZY A;  4A7K A;  3VSZ A;  1G9C A;  3O4D A;  1FN0 A;  4I1B A;  1XZZ A;  4ZLB B;  4L4H A;  4KC3 A;  2I1B A;  4G9M A;  3E8L C;  4END A;  1II4 A;  2DRE A;  3CA0 A;  1AXM A;  4I4U A;  3FUQ A;  2BFH A;  4QD2 C;  1JLX A;  1IT0 A;  2KI6 B;  3T8S A;  1XG6 A;  1ABR B;  4FGF A;  2XOA A;  2VSE A;  1DQO A;  1BAR A;  3QR5 A;  1N4K A;  2LIQ A;  1J0S A;  1TWM A;  4HR6 C;  3LTQ A;  4I4O A;  1IRP A;  4LO0 A;  1SR4 C;  2AQZ A;  1ISZ A;  3FJE A;  3VUO A;  1AFC A;  1YTO A;  2YUG A;  4P6A A;  3WO3 A;  4I4P A;  2Y9X E;  5F8Y A;  1AVU A;  4JKQ A;  4UY4 A;  1DFC A;  1BFB A;  3CA6 A;  1HWP B;  1MC9 A;  2MIB A;  4QO3 A;  4FVV A;  3BAU A;  4Q9P A;  1PWA A;  3POK A;  2LIE A;  4HJJ A;  3HOM A;  6I1B A;  4OWJ A;  2K4A B;  5DSS B;  4X3A A;  1DIW A;  4I2S A;  1FV2 A;  3VT2 A;  2BEA A;  4GAI A;  3H6S E;  2KI4 A;  1V6X A;  3O4C A;  4OEF A;  1Q1U A;  3WA1 A;  4ZGR B;  4QBC A;  2FGF A;  5D62 A;  3WIN C;  4JRA A;  4ZFW B;  5DUY A;  2RST A;  2NTD A;  2VUA A;  3IIR A;  2X2T A;  4GP0 A;  1FMM S;  3RMY A;  1FWU A;  4LO2 A;  1G9B A;  1AVX B;  4I6I A;  4G6M A;  2K43 A;  2ZQO A;  1IOB A;  1FWV A;  2ERM A;  4OWL A;  4KEI A;  3JRR A;  1TOO A;  4LO1 C;  4DEP A;  4LO3 C;  4ZKT B;  5BQU C;  1R8O A;  3UD9 A;  3OGF A;  1K5V A;  1RY7 A;  1V6V A;  4IZX A;  3N7J A;  4KEJ A;  3AKI A;  3O5W B;  4ZBV B;  2IWT B;  1D0H A;  1ISY A;  2J3P A;  1DZC A;  3I29 B;  4I96 A;  2HZ9 A;  5BXS A;  3BAO A;  3ZXG A;  5DVH A;  3HBW A;  1YF8 B;  1FV3 A;  3P6I A;  2DS0 A;  3VSF A;  1K5U A;  1S0B A;  3D7W B;  3HN1 A;  5FNW A;  2D22 A;  3HSM A;  3A23 A;  1WBA A;  4J2K A;  4JPZ A;  1MD6 A;  4J2Y A;  4I37 A;  2RG9 B;  2D43 A;  4EFR A;  2HW9 A;  5F8W A;  4ZFU B;  3WIN A;  4J2S A;  3BAG A;  2NP0 A;  1R8N A;  4OW4 A;  3HMY A;  4XFT A;  1EYL A;  1HCD A;  4QKS A;  3BA5 A;  3N0K A;  4F83 A;  1BFG A;  1DLL A;  1G82 A;  4ZFY B;  3AZW A;  1HKN A;  2WBC A;  4GAF A;  4LO8 B;  2FO1 A;  4LO1 A;  4J2X A;  4LO3 A;  5BQU A;  2F8X C;  1AVA C;  1S0E A;  3CRG A;  1S0G A;  3V0B A;  1ONK B;  2GZB A;  3FGM A;  4ISQ A;  4EFQ A;  2QN4 A;  4LO7 C;  1DFQ A;  2P23 A;  1Q04 A;  3PUB A;  3BA7 A;  5BOW A;  1QQL A;  2MC2 A;  3Q7Y A;  3P53 A;  7I1B A;  1VCL A;  5EG6 C;  4H75 A;  3R4S A;  4GOV A;  5BVP I;  3FUO A;  3F1R A;  4JAW A;  3B9U A;  3FJ9 A;  2D44 A;  1W3F A;  4IQP A;  4A7Y A;  1ISX A;  1M16 A;  3V79 C;  2NS2 A;  4H04 A;  3WO2 A;  3FJK A;  2FFV A;  4MZH A;  2Q9X A;  3P6J A;  3N7M A;  1YYN A;  1JQZ A;  2D24 A;  4G1R A;  2MLL B;  4D0T A;  2HWA A;  2ZQN A;  3O49 A;  1W3G A;  3ZC8 A;  5B2H A;  5BP5 A;  3IM6 A;  3N7L A;  3BRG C;  1ITB A;  3BAD A;  3W9T A;  3NBD A;  3NBE A;  4A7Z A;  3CA5 A;  4P0J A;  3S8J A;  3IM7 A;  4OEE A;  4USO A;  1V6U A;  2M49 A;  4AN6 A;  5JLV A;  1HCE A;  1XHB A;  1EVT A;  2Y9F A;  1JT7 A;  5EC5 A;  3OGG A;  4QD2 B;  4QKR A;  5FZZ A;  3NBC A;  3H6Q A;  3FJC A;  3PHZ A;  4EFP A;  3FJB A;  4G6J A;  1BLA A;  5JMC A;  3AH4 A;  21BI A;  2ESU A;  1FGA A;  4IYB A;  1IJT A;  4OUJ A;  4X39 A;  2E4M C;  3AKG A;  3IM5 A;  1SR4 A;  3PG0 A;  3V0A A;  1Z2V A;  5EHA A;  2QYI B;  3CRI A;  4ZA3 B;  3VT0 A;  2Y9W C;  3AZV A;  4D0Z A;  1JT4 A;  2NVH A;  2IHO A;  3ILA A;  1TFM B;  1RZO B;  4QC4 A;  4JKX B;  2F2F C;  3K1X A;  2VU9 A;  3O4B A;  4HA2 A;  4IY9 A;  1S0C A;  1P63 A;  1TP0 A;  3S8K A;  1ISV A;  4G9N A;  4XFU A;  4OEG A;  3AJ5 A;  5BXP A;  3KMV A;  2WRY A;  3R4U A;  5DZU A;  2NM1 A;  2HWM A;  4Z9W B;  4R6U B;  3FJF A;  3VT1 A;  1EV2 A;  1Z0H A;  5FNX A;  1ILR 1;  2VSA A;  3WMU A;  1BLD A;  4X37 A;  3UJ4 A;  3N7K A;  1T4Q A;  4XKI A;  1WD3 A;  5E24 E;  3AKH A;  3UD7 A;  3AH2 A;  4AN7 B;  5F8S A;  1QXM A;  3RTI B;  4F34 A;  1WBC A;  2D20 A;  5F90 A;  3AJ6 A;  1DJS B;  2AFG A;  3A07 A;  1PC8 B;  4Q91 A;  3FFZ A;  4I0Y A;  5BXR A;  1IRA X;  1UPS A;  3BAQ A;  9ILB A;  3BA4 A;  4CJM A; 
#chains in the Genus database with same CATH homology
 1JT3 A;  5I1B A;  2KKI A;  4H9W A;  4J23 B;  3V0B B;  3VWC A;  3WMV A;  4II0 A;  4IZE A;  4JP0 A;  1BA7 A;  1JT5 A;  3ZXD A;  4D8H A;  1BAS A;  1IHK A;  4I4R A;  2F2F A;  4OWK A;  1TTU A;  1EPW A;  4WBC A;  3BRF A;  3NJ5 A;  3OBT A;  5GAQ A;  1G9D A;  1HWO B;  1L2H A;  3BX1 C;  3RSJ A;  2NYY A;  1HWM B;  1JLY A;  3UD8 A;  4LO2 C;  1G9A A;  1PUU B;  3OJ2 A;  2D7R A;  1TIE A;  4I4V A;  1PZZ A;  3O3Q A;  4JQ0 A;  1F31 A;  4P0K A;  4KBB A;  1QQK A;  1AVW B;  5HPZ A;  3O4A A;  1I1B A;  3UJ0 A;  2KH2 A;  3AH1 A;  1Q03 A;  3OJM A;  4P0L A;  4GP3 A;  2ZR1 B;  3I2A A;  3RTJ B;  5D63 A;  1S0D A;  2UUS A;  2K8R A;  3OBR A;  2DRY A;  1TWE A;  2AXM A;  1YBI A;  2RQ9 A;  1YXW A;  3ZC9 A;  5D61 A;  2NZ9 A;  1FMZ A;  3A22 A;  1I1E A;  3Q7W A;  5FZU A;  3CQA A;  2VLC A;  1RML A;  3CA4 A;  2D1Z A;  3JUT A;  1T9F A;  4KEK A;  3PME A;  2Q3N B;  4ZOT A;  3FJ8 A;  4TLP A;  4LO7 B;  4Z8S B;  4XFS A;  4YOL A;  3QYD A;  2P39 A;  3FJA A;  3VEQ A;  2D7I A;  2VXT I;  4QAL A;  1KNM A;  3FJD A;  3CAH A;  3HAL A;  1OQL B;  2Y9G A;  4L4I A;  2L5X A;  1DQG A;  1CVS A;  2AAI B;  3O44 A;  1BFF A;  3WO4 A;  1SZ6 B;  3V0A B;  4DEN A;  3LLP A;  4PC4 A;  3UDA A;  1GGP B;  2VXR A;  4USP A;  3EF2 A;  4MZF B;  3BRD A;  4QBV A;  3CU1 B;  4I4Q A;  5BXT A;  4I7I A;  1HIB A;  4DCK C;  1E0O A;  3C9Z A;  5G00 A;  3O4O A;  4I4X A;  3BAV A;  3IAG C;  3CRH A;  1A8D A;  1M2T B;  2D23 A;  3FJH A;  2KLL A;  3MAL A;  3RMX A;  3BTA A;  1PUM B;  2Z48 A;  3FJJ A;  4ISR A;  2X2S A;  1HWN B;  1NZK A;  3BAH A;  3OJV A;  1CE7 B;  3MPP G;  4Q9G A;  31BI A;  1JY0 A;  4I3N A;  4ION A;  2R9K B;  3BB2 A;  1W3A A;  2ET2 A;  3Q7X A;  1FQ9 A;  3H6R A;  4LO0 C;  1IIL A;  1WD4 A;  2FFU A;  3H6R B;  1XYF A;  4X38 A;  1Z4S A;  4EKX B;  1BFC A;  4GOY A;  8I1B A;  3FJI A;  3TC2 A;  2Z49 A;  3F62 B;  3SNV A;  4I1E A;  4EEE B;  4I8M A;  2E4M A;  1JTC A;  4IHZ A;  1V6W A;  1NUN A;  3CA3 A;  3AKF A;  2BEB A;  2GO2 A;  3CA1 A;  4I4Y A;  4MZG B;  3ZX7 A;  4I4S A;  3I2X A;  1RG8 A;  5BP5 C;  3NBN A;  3A21 A;  2DRZ A;  1DZD A;  41BI A;  1S0F A;  2FDB M;  4EB2 B;  1AF9 A;  1ISW A;  1S0L A;  4IY8 A;  5FZY A;  4A7K A;  3VSZ A;  1G9C A;  3O4D A;  1FN0 A;  4I1B A;  1XZZ A;  4ZLB B;  4L4H A;  4KC3 A;  2I1B A;  4G9M A;  3E8L C;  4END A;  1II4 A;  2DRE A;  3CA0 A;  1AXM A;  4I4U A;  3FUQ A;  2BFH A;  4QD2 C;  1JLX A;  1IT0 A;  2KI6 B;  3T8S A;  1XG6 A;  1ABR B;  4FGF A;  2XOA A;  2VSE A;  1DQO A;  1BAR A;  3QR5 A;  1N4K A;  2LIQ A;  1J0S A;  1TWM A;  4HR6 C;  3LTQ A;  4I4O A;  1IRP A;  4LO0 A;  1SR4 C;  2AQZ A;  1ISZ A;  3FJE A;  3VUO A;  1AFC A;  1YTO A;  2YUG A;  4P6A A;  3WO3 A;  4I4P A;  2Y9X E;  5F8Y A;  1AVU A;  4JKQ A;  4UY4 A;  1DFC A;  1BFB A;  3CA6 A;  1HWP B;  1MC9 A;  2MIB A;  4QO3 A;  4FVV A;  3BAU A;  4Q9P A;  1PWA A;  3POK A;  2LIE A;  4HJJ A;  3HOM A;  6I1B A;  4OWJ A;  2K4A B;  5DSS B;  4X3A A;  1DIW A;  4I2S A;  1FV2 A;  3VT2 A;  2BEA A;  4GAI A;  3H6S E;  2KI4 A;  1V6X A;  3O4C A;  4OEF A;  1Q1U A;  3WA1 A;  4ZGR B;  4QBC A;  2FGF A;  5D62 A;  3WIN C;  4JRA A;  4ZFW B;  5DUY A;  2RST A;  2NTD A;  2VUA A;  3IIR A;  2X2T A;  4GP0 A;  1FMM S;  3RMY A;  1FWU A;  4LO2 A;  1G9B A;  1AVX B;  4I6I A;  4G6M A;  2K43 A;  2ZQO A;  1IOB A;  1FWV A;  2ERM A;  4OWL A;  4KEI A;  3JRR A;  1TOO A;  4LO1 C;  4DEP A;  4LO3 C;  4ZKT B;  5BQU C;  1R8O A;  3UD9 A;  3OGF A;  1K5V A;  1RY7 A;  1V6V A;  4IZX A;  3N7J A;  4KEJ A;  3AKI A;  3O5W B;  4ZBV B;  2IWT B;  1D0H A;  1ISY A;  2J3P A;  1DZC A;  3I29 B;  4I96 A;  2HZ9 A;  5BXS A;  3BAO A;  3ZXG A;  5DVH A;  3HBW A;  1YF8 B;  1FV3 A;  3P6I A;  2DS0 A;  3VSF A;  1K5U A;  1S0B A;  3D7W B;  3HN1 A;  5FNW A;  2D22 A;  3HSM A;  3A23 A;  1WBA A;  4J2K A;  4JPZ A;  1MD6 A;  4J2Y A;  4I37 A;  2RG9 B;  2D43 A;  4EFR A;  2HW9 A;  5F8W A;  4ZFU B;  3WIN A;  4J2S A;  3BAG A;  2NP0 A;  1R8N A;  4OW4 A;  3HMY A;  4XFT A;  1EYL A;  1HCD A;  4QKS A;  3BA5 A;  3N0K A;  4F83 A;  1BFG A;  1DLL A;  1G82 A;  4ZFY B;  3AZW A;  1HKN A;  2WBC A;  4GAF A;  4LO8 B;  2FO1 A;  4LO1 A;  4J2X A;  4LO3 A;  5BQU A;  2F8X C;  1AVA C;  1S0E A;  3CRG A;  1S0G A;  3V0B A;  1ONK B;  2GZB A;  3FGM A;  4ISQ A;  4EFQ A;  2QN4 A;  4LO7 C;  1DFQ A;  2P23 A;  1Q04 A;  3PUB A;  3BA7 A;  5BOW A;  1QQL A;  2MC2 A;  3Q7Y A;  3P53 A;  7I1B A;  1VCL A;  5EG6 C;  4H75 A;  3R4S A;  4GOV A;  5BVP I;  3FUO A;  3F1R A;  4JAW A;  3B9U A;  3FJ9 A;  2D44 A;  1W3F A;  4IQP A;  4A7Y A;  1ISX A;  1M16 A;  3V79 C;  2NS2 A;  4H04 A;  3WO2 A;  3FJK A;  2FFV A;  4MZH A;  2Q9X A;  3P6J A;  3N7M A;  1YYN A;  1JQZ A;  2D24 A;  4G1R A;  2MLL B;  4D0T A;  2HWA A;  2ZQN A;  3O49 A;  1W3G A;  3ZC8 A;  5B2H A;  5BP5 A;  3IM6 A;  3N7L A;  3BRG C;  1ITB A;  3BAD A;  3W9T A;  3NBD A;  3NBE A;  4A7Z A;  3CA5 A;  4P0J A;  3S8J A;  3IM7 A;  4OEE A;  4USO A;  1V6U A;  2M49 A;  4AN6 A;  5JLV A;  1HCE A;  1XHB A;  1EVT A;  2Y9F A;  1JT7 A;  5EC5 A;  3OGG A;  4QD2 B;  4QKR A;  5FZZ A;  3NBC A;  3H6Q A;  3FJC A;  3PHZ A;  4EFP A;  3FJB A;  4G6J A;  1BLA A;  5JMC A;  3AH4 A;  21BI A;  2ESU A;  1FGA A;  4IYB A;  1IJT A;  4OUJ A;  4X39 A;  2E4M C;  3AKG A;  3IM5 A;  1SR4 A;  3PG0 A;  3V0A A;  1Z2V A;  5EHA A;  2QYI B;  3CRI A;  4ZA3 B;  3VT0 A;  2Y9W C;  3AZV A;  4D0Z A;  1JT4 A;  2NVH A;  2IHO A;  3ILA A;  1TFM B;  1RZO B;  4QC4 A;  4JKX B;  2F2F C;  3K1X A;  2VU9 A;  3O4B A;  4HA2 A;  4IY9 A;  1S0C A;  1P63 A;  1TP0 A;  3S8K A;  1ISV A;  4G9N A;  4XFU A;  4OEG A;  3AJ5 A;  5BXP A;  3KMV A;  2WRY A;  3R4U A;  5DZU A;  2NM1 A;  2HWM A;  4Z9W B;  4R6U B;  3FJF A;  3VT1 A;  1EV2 A;  1Z0H A;  5FNX A;  1ILR 1;  2VSA A;  3WMU A;  1BLD A;  4X37 A;  3UJ4 A;  3N7K A;  1T4Q A;  4XKI A;  1WD3 A;  5E24 E;  3AKH A;  3UD7 A;  3AH2 A;  4AN7 B;  5F8S A;  1QXM A;  3RTI B;  4F34 A;  1WBC A;  2D20 A;  5F90 A;  3AJ6 A;  1DJS B;  2AFG A;  3A07 A;  1PC8 B;  4Q91 A;  3FFZ A;  4I0Y A;  5BXR A;  1IRA X;  1UPS A;  3BAQ A;  9ILB A;  3BA4 A;  4CJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...