3O3QA

Crystal structure of "l44f/m67i/l73v/a103g/deletion 104-106/f108y/v109l/l111i/c117v/r119g/deletion 120-122" mutant form of human acidic fibroblast growth factor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
123
structure length
123
Chain Sequence
b'KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQFQLSAESVGEVYIKSTETGQYLAIDTDGLVYGSQTPNEECLFLERLEENHYNTYISKKHGWYLGIKKNGSVKGTHYGQKAILFLPLPVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title A polypeptide "building block"top-down symmetric deconstruction".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Heparin-binding protein
total genus 31
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3o3qA00
3BRGC 2ZQNA 1QQLA 3B9UA 1EYLA 4IQPA 1TOOA 3QR5A 5FZZA 3BA4A 1R8NA 4GP0A 2ERMA 4G1RA 3V0BB 4OUJA 1TIEA 2WRYA 2VXTI 5D63A 1CVSA 2D44A 3V79C 4JRAA 1BFBA 1ISWA 2MLLB 1BLAA 4YOLA 2DS0A 1W3FA 3W9TA 3FJ8A 2VSAA 4ZFYB 4OEEA 1FMZA 1Q03A 1JLYA 4I4QA 3ZC9A 1S0FA 3C9ZA 3FJCA 4QKRA 3FJFA 4X3AA 2QYIB 1HIBA 1G9AA 1RG8A 2VLCA 4ZFUB 5BP5C 1NZKA 3IAGC 4I4UA 1SR4C 3CRGA 3ZXGA 3O4AA 4CJMA 4ZA3B 4FVVA 4JKQA 4D0ZA 3PHZA 1L2HA 2QN4A 5DSSB 1FV3A 4I3NA 2BFHA 3AJ5A 4A7KA 1JT5A 2Q9XA 1DQGA 4I4RA 2NM1A 3P53A 4I4OA 3EF2A 1BA7A 4IZXA 1KNMA 3FJBA 3UD7A 5BQUA 2RQ9A 1YBIA 1JT4A 3P6IA 1JY0A 3FJ9A 1S0GA 5GAQA 4EB2B 3WMVA 3AH4A 1BLDA 1PUMB 3BAQA 3UD9A 4H04A 3R4SA 4ZKTB 2F8XC 1ITBA 1WBAA 1JLXA 2Y9WC 1CE7B 3ILAA 4OWKA 2LIQA 4USOA 1E0OA 4X37A 3RSJA 2D7RA 4Q9GA 5EHAA 1OQLB 3KMVA 2HZ9A 3BA7A 4GAIA 5BOWA 1FN0A 3CRIA 3VT0A 3RTJB 1HWNB 4II0A 4KEJA 4D8HA 4JP0A 1S0CA 3FJKA 1EPWA 4I37A 1IJTA 5DZUA 2KH2A 4ZGRB 2WBCA 1T9FA 1II4A 2D22A 1HKNA 4L4HA 1RZOB 4G6JA 2L5XA 4LO0A 3BAOA 3O4CA 3O4BA 2ZQOA 3OJ2A 3NBDA 4KBBA 1AVXB 1PUUB 1TFMB 5BXTA 3AZWA 2KI6B 5F8SA 3RMXA 2I1BA 3TC2A 3OJMA 2Z48A 2D24A 2E4MC 3AH1A 3ZX7A 2D20A 5BXRA 4I4PA 1J0SA 4PC4A 1BFCA 1DZCA 1JTCA 4QD2C 41BIA 3HMYA 4QALA 1PZZA 1M2TB 3RTIB 1DQOA 4GP3A 4J2YA 1DJSB 2F2FA 4ZFWB 1EV2A 1RMLA 1TP0A 1T4QA 1ISYA 3N7MA 3UJ0A 3H6QA 1ISZA 4OEGA 5JMCA 1K5UA 2D43A 1BFFA 1DFQA 1DIWA 1YXWA 5E24E 3H6RA 3VSZA 2HWAA 2X2SA 4EFQA 3NBNA 3WO3A 4QBCA 4ZLBB 1WD4A 2NYYA 4EKXB 1YF8B 3F62B 3BRDA 4AN7B 1V6VA 1HCDA 4XFSA 4G9MA 1XYFA 4HR6C 3N7JA 4LO7C 1Q1UA 4EEEB 1V6UA 3FJIA 1HWPB 3R4UA 3A23A 3VWCA 4D0TA 4WBCA 1G82A 1S0EA 3NJ5A 2X2TA 3AKFA 1Z4SA 4I1BA 4I0YA 2NVHA 3OJVA 4JPZA 4X39A 4JKXB 1D0HA 3A22A 3CA6A 1AXMA 4QBVA 2DREA 4HA2A 31BIA 4QC4A 4GOVA 3IM6A 3OGFA 4XFUA 2IHOA 1YTOA 3I29B 3O4DA 4LO8B 2M49A 3N7KA 4OW4A 2P39A 4I4XA 4QKSA 3RMYA 5DVHA 4EFRA 4I7IA 4TLPA 2P23A 4G6MA 3MALA 3FJAA 6I1BA 4J2SA 1SR4A 1A8DA 1F31A 1ISXA 3CRHA 2FFVA 1GGPB 3S8KA 3WINC 1G9BA 2XOAA 3NBEA 4JQ0A 2FGFA 4XFTA 1V6WA 5D62A 4Z8SB 2D1ZA 3Q7WA 1IRPA 4FGFA 3AKHA 2ZR1B 3A07A 4H9WA 4J23B 4I8MA 4LO1C 3IM5A 3O44A 3BAGA 4JAWA 3VEQA 5I1BA 3N7LA 1HCEA 1I1EA 4IY8A 3FJHA 3WA1A 2AAIB 4F83A 3POKA 5F8WA 2MC2A 1XG6A 3ZXDA 3WINA 4ZBVB 5FNXA 1FWUA 3FJDA 5B2HA 3HOMA 2NP0A 3CA5A 3BB2A 3AH2A 3VUOA 3FJJA 3FGMA 1FGAA 2RG9B 3IM7A 3AZVA 4EFPA 1W3AA 3CQAA 1UPSA 3WMUA 1QQKA 4LO1A 1EVTA 3O49A 4KC3A 5FZYA 3UJ4A 3WO4A 1MC9A 1AVWB 2VSEA 3O4OA 1ILR1 4KEKA 4A7ZA 1SZ6B 1NUNA 3E8LC 1FV2A 3O3QA 1PC8B 3FFZA 3QYDA 3BTAA 2AXMA 2NTDA 2FO1A 3CA0A 3FJEA 3K1XA 2Y9FA 1FQ9A 2Z49A 2BEAA 1JQZA 2D7IA 3FUOA 1WD3A 4J2KA 2GO2A 2K8RA 1S0DA 1AVUA 2VUAA 3BX1C 1V6XA 2UUSA 2RSTA 3H6RB 4OWLA 1TWMA 1HWMB 2FFUA 1DZDA 3I2XA 3BAVA 3H6SE 4QD2B 4ISRA 1IILA 1W3GA 1JT3A 1Z0HA 1FMMS 2K4AB 2E4MA 3CA3A 2Y9GA 3T8SA 1TTUA 4GAFA 1QXMA 2YUGA 1BARA 4IYBA 4J2XA 3PG0A 4Q9PA 2D23A 2HW9A 3HN1A 2Y9XE 3BADA 1Q04A 1R8OA 3JRRA 5BP5A 4IONA 1S0BA 1MD6A 2IWTB 1K5VA 4P0KA 3VSFA 3UD8A 3BAUA 1YYNA 1VCLA 3LTQA 5EC5A 3S8JA 4P0JA 3VT1A 3V0BA 1RY7A 4GOYA 1IOBA 2KLLA 3CAHA 2LIEA 3OBTA 3VT2A 2GZBA 4OWJA 1BASA 4LO7B 5JLVA 3FUQA 4AN6A 1JT7A 3O5WB 5EG6C 5BQUC 3HSMA 3PUBA 4ISQA 4DEPA 1IT0A 4I4SA 3A21A 1S0LA 4LO3C 3BRFA 3P6JA 5BVPI 4X38A 1G9CA 4F34A 5F8YA 3OBRA 4R6UB 2DRYA 2J3PA 5D61A 2VXRA 3AJ6A 2R9KB 1ISVA 1I1BA 9ILBA 3V0AB 3BAHA 5DUYA 3SNVA 1AFCA 2MIBA 3CU1B 3HBWA 5FNWA 4P6AA 2K43A 4HJJA 3PMEA 3IIRA 4QO3A 3V0AA 2Q3NB 2HWMA 2VU9A 4IHZA 4LO2C 3WO2A 7I1BA 3UDAA 3AKIA 3AKGA 5BXPA 1XZZA 4LO3A 4I4YA 3ZC8A 4ZOTA 1AF9A 3I2AA 1XHBA 1DFCA 3BA5A 5F90A 4A7YA 1P63A 3HALA 2KKIA 3Q7XA 5BXSA 4LO0C 1G9DA 4L4IA 1BFGA 1N4KA 3LLPA 2FDBM 4DCKC 2ET2A 2KI4A 3F1RA 2AFGA 1PWAA 2DRZA 1WBCA 4IZEA 4LO2A 4ENDA 5G00A 8I1BA 3MPPG 3Q7YA 4IY9A 4USPA 4I6IA 4I1EA 1IRAX 1M16A 5FZUA 4I96A 4I2SA 4P0LA 1ONKB 3JUTA 2F2FC 4XKIA 3CA4A 5HPZA 3OGGA 2AQZA 1FWVA 21BIA 3CA1A 1TWEA 4I4VA 4G9NA 4OEFA 1ABRB 4Q91A 4KEIA 1HWOB 3D7WB 3NBCA 4Z9WB 1IHKA 1DLLA 1Z2VA 2ESUA 3N0KA 2NZ9A 1AVAC 2BEBA 4DENA
chains in the Genus database with same CATH superfamily
3BRGC 2ZQNA 1QQLA 3B9UA 1EYLA 4IQPA 1TOOA 3QR5A 5FZZA 3BA4A 1R8NA 4GP0A 2ERMA 4G1RA 3V0BB 4OUJA 1TIEA 2WRYA 2VXTI 5D63A 1CVSA 2D44A 3V79C 4JRAA 1BFBA 1ISWA 2MLLB 1BLAA 4YOLA 2DS0A 1W3FA 3W9TA 3FJ8A 2VSAA 4ZFYB 4OEEA 1FMZA 1Q03A 1JLYA 4I4QA 3ZC9A 1S0FA 3C9ZA 3FJCA 4QKRA 3FJFA 4X3AA 2QYIB 1HIBA 1G9AA 4MZFB 1RG8A 2NS2A 2VLCA 4ZFUB 5BP5C 1NZKA 3IAGC 4I4UA 1SR4C 3CRGA 3ZXGA 3O4AA 4CJMA 4ZA3B 4FVVA 4JKQA 4D0ZA 4MZHA 3PHZA 1L2HA 2QN4A 5DSSB 1FV3A 4I3NA 2BFHA 3AJ5A 4A7KA 1JT5A 2Q9XA 1DQGA 4I4RA 2NM1A 3P53A 4I4OA 3EF2A 1BA7A 4IZXA 1KNMA 3FJBA 3UD7A 5BQUA 2RQ9A 1YBIA 1JT4A 3P6IA 1JY0A 3FJ9A 1S0GA 5GAQA 4EB2B 3WMVA 3AH4A 1BLDA 1PUMB 3BAQA 3UD9A 4H04A 3R4SA 4ZKTB 2F8XC 1ITBA 1WBAA 1JLXA 2Y9WC 1CE7B 3ILAA 4OWKA 2LIQA 4USOA 1E0OA 4X37A 3RSJA 2D7RA 4Q9GA 5EHAA 1OQLB 3KMVA 2HZ9A 3BA7A 4GAIA 5BOWA 1FN0A 3CRIA 3VT0A 3RTJB 1HWNB 4II0A 4KEJA 4D8HA 4JP0A 1S0CA 3FJKA 1EPWA 4I37A 1IJTA 5DZUA 2KH2A 4ZGRB 2WBCA 1T9FA 1II4A 2D22A 1HKNA 4L4HA 4MZGB 1RZOB 4G6JA 2L5XA 4LO0A 3BAOA 3O4CA 3O4BA 2ZQOA 3OJ2A 3NBDA 4KBBA 1AVXB 1PUUB 1TFMB 5BXTA 3AZWA 2KI6B 5F8SA 3RMXA 2I1BA 3TC2A 3OJMA 2Z48A 2D24A 2E4MC 3AH1A 3ZX7A 2D20A 5BXRA 4I4PA 1J0SA 4PC4A 1BFCA 1DZCA 1JTCA 4QD2C 41BIA 3HMYA 4QALA 1PZZA 1M2TB 3RTIB 1DQOA 4GP3A 4J2YA 1DJSB 2F2FA 4ZFWB 1EV2A 1RMLA 1TP0A 1T4QA 1ISYA 3N7MA 3UJ0A 3H6QA 1ISZA 4OEGA 5JMCA 1K5UA 2D43A 1BFFA 1DFQA 1DIWA 1YXWA 5E24E 3H6RA 3VSZA 2HWAA 2X2SA 4EFQA 3NBNA 3WO3A 4QBCA 4ZLBB 1WD4A 2NYYA 4EKXB 1YF8B 3F62B 3BRDA 4AN7B 1V6VA 1HCDA 4XFSA 4G9MA 1XYFA 4HR6C 3N7JA 4LO7C 1Q1UA 4EEEB 1V6UA 3FJIA 1HWPB 3R4UA 3A23A 3VWCA 4D0TA 4WBCA 1G82A 1S0EA 3NJ5A 2X2TA 3AKFA 1Z4SA 4I1BA 4I0YA 2NVHA 3OJVA 4JPZA 4X39A 4JKXB 1D0HA 3A22A 3CA6A 1AXMA 4QBVA 2DREA 4HA2A 31BIA 4QC4A 4GOVA 3IM6A 3OGFA 4XFUA 2IHOA 1YTOA 3I29B 3O4DA 4LO8B 2M49A 3N7KA 4OW4A 2P39A 4I4XA 4QKSA 3RMYA 5DVHA 4EFRA 4I7IA 4TLPA 2P23A 4G6MA 3MALA 3FJAA 6I1BA 4J2SA 1SR4A 1A8DA 1F31A 1ISXA 3CRHA 2FFVA 1GGPB 3S8KA 3WINC 1G9BA 2XOAA 3NBEA 4JQ0A 2FGFA 4XFTA 1V6WA 5D62A 4Z8SB 2D1ZA 3Q7WA 1IRPA 4FGFA 3AKHA 2ZR1B 3A07A 4H9WA 4J23B 4I8MA 4LO1C 3IM5A 3O44A 3BAGA 4JAWA 3VEQA 5I1BA 3N7LA 1HCEA 1I1EA 4IY8A 3FJHA 3WA1A 2AAIB 4F83A 3POKA 5F8WA 2MC2A 1XG6A 3ZXDA 3WINA 4ZBVB 5FNXA 1FWUA 3FJDA 5B2HA 3HOMA 2NP0A 3CA5A 3BB2A 3AH2A 3VUOA 3FJJA 3FGMA 1FGAA 2RG9B 3IM7A 3AZVA 4EFPA 1W3AA 3CQAA 1UPSA 3WMUA 1QQKA 4LO1A 1EVTA 3O49A 4KC3A 5FZYA 3UJ4A 3WO4A 1MC9A 1AVWB 2VSEA 3O4OA 1ILR1 4KEKA 4A7ZA 1SZ6B 1NUNA 3E8LC 1FV2A 3O3QA 1PC8B 3FFZA 3QYDA 3BTAA 2AXMA 2NTDA 2FO1A 3CA0A 3FJEA 3K1XA 2Y9FA 1FQ9A 2Z49A 2BEAA 1JQZA 2D7IA 3FUOA 1WD3A 4J2KA 2GO2A 2K8RA 1S0DA 1AVUA 2VUAA 3BX1C 1V6XA 2UUSA 2RSTA 3H6RB 4OWLA 1TWMA 1HWMB 2FFUA 1DZDA 3I2XA 3BAVA 3H6SE 4QD2B 4ISRA 1IILA 1W3GA 1JT3A 1Z0HA 1FMMS 2K4AB 2E4MA 3CA3A 2Y9GA 3T8SA 1TTUA 4GAFA 1QXMA 2YUGA 1BARA 4IYBA 4J2XA 3PG0A 4Q9PA 2D23A 2HW9A 3HN1A 2Y9XE 3BADA 1Q04A 1R8OA 3JRRA 5BP5A 4IONA 1S0BA 1MD6A 2IWTB 1K5VA 4P0KA 3VSFA 3UD8A 3BAUA 1YYNA 1VCLA 3LTQA 5EC5A 3S8JA 4P0JA 3VT1A 3V0BA 1RY7A 4GOYA 1IOBA 2KLLA 3CAHA 2LIEA 3OBTA 3VT2A 2GZBA 4OWJA 1BASA 4LO7B 5JLVA 3FUQA 4AN6A 1JT7A 3O5WB 5EG6C 5BQUC 3HSMA 3PUBA 4ISQA 4DEPA 1IT0A 4I4SA 3A21A 1S0LA 4LO3C 4UY4A 3BRFA 3P6JA 5BVPI 4X38A 1G9CA 4F34A 5F8YA 3OBRA 4R6UB 2DRYA 2J3PA 5D61A 2VXRA 3AJ6A 2R9KB 1ISVA 1I1BA 9ILBA 3V0AB 3BAHA 5DUYA 3SNVA 1AFCA 2MIBA 3CU1B 3HBWA 5FNWA 4P6AA 2K43A 4HJJA 3PMEA 3IIRA 4QO3A 3V0AA 2Q3NB 2HWMA 2VU9A 4IHZA 4LO2C 3WO2A 7I1BA 3UDAA 3AKIA 3AKGA 5BXPA 1XZZA 4LO3A 4I4YA 3ZC8A 4ZOTA 1AF9A 3I2AA 1XHBA 1DFCA 3BA5A 5F90A 4A7YA 1P63A 3HALA 2KKIA 3Q7XA 4H75A 5BXSA 4LO0C 1G9DA 4L4IA 1BFGA 1N4KA 3LLPA 2FDBM 4DCKC 2ET2A 2KI4A 3F1RA 2AFGA 1PWAA 2DRZA 1WBCA 4IZEA 4LO2A 4ENDA 5G00A 8I1BA 3MPPG 3Q7YA 4IY9A 4USPA 4I6IA 4I1EA 1IRAX 1M16A 5FZUA 4I96A 4I2SA 4P0LA 1ONKB 3JUTA 2F2FC 4XKIA 3CA4A 5HPZA 3OGGA 2AQZA 1FWVA 21BIA 3CA1A 1TWEA 4I4VA 4G9NA 4OEFA 1ABRB 4Q91A 4KEIA 1HWOB 3D7WB 3NBCA 4Z9WB 1IHKA 1DLLA 1Z2VA 2ESUA 3N0KA 2NZ9A 1AVAC 2BEBA 4DENA
chains in the Genus database with same CATH topology
3BRGC 2ZQNA 1QQLA 3B9UA 1EYLA 4IQPA 1TOOA 3QR5A 5FZZA 3BA4A 1R8NA 4GP0A 2ERMA 4G1RA 3V0BB 4OUJA 1TIEA 2WRYA 2VXTI 5D63A 1CVSA 2D44A 3V79C 4JRAA 1BFBA 1ISWA 2MLLB 1BLAA 4YOLA 2DS0A 1W3FA 3W9TA 3FJ8A 2VSAA 4ZFYB 4OEEA 1FMZA 1Q03A 1JLYA 4I4QA 3ZC9A 1S0FA 3C9ZA 3FJCA 4QKRA 3FJFA 4X3AA 2QYIB 1HIBA 1G9AA 4MZFB 1RG8A 2NS2A 2VLCA 4ZFUB 5BP5C 1NZKA 3IAGC 4I4UA 1SR4C 3CRGA 3ZXGA 3O4AA 4CJMA 4ZA3B 4FVVA 4JKQA 4D0ZA 4MZHA 3PHZA 1L2HA 2QN4A 5DSSB 1FV3A 4I3NA 2BFHA 3AJ5A 4A7KA 1JT5A 2Q9XA 1DQGA 4I4RA 2NM1A 3P53A 4I4OA 3EF2A 1BA7A 4IZXA 1KNMA 3FJBA 3UD7A 5BQUA 2RQ9A 1YBIA 1JT4A 3P6IA 1JY0A 3FJ9A 1S0GA 5GAQA 4EB2B 3WMVA 3AH4A 1BLDA 1PUMB 3BAQA 3UD9A 4H04A 3R4SA 4ZKTB 2F8XC 1ITBA 1WBAA 1JLXA 2Y9WC 1CE7B 3ILAA 4OWKA 2LIQA 4USOA 1E0OA 4X37A 3RSJA 2D7RA 4Q9GA 5EHAA 1OQLB 3KMVA 2HZ9A 3BA7A 4GAIA 5BOWA 1FN0A 3CRIA 3VT0A 3RTJB 1HWNB 4II0A 4KEJA 4D8HA 4JP0A 1S0CA 3FJKA 1EPWA 4I37A 1IJTA 5DZUA 2KH2A 4ZGRB 2WBCA 1T9FA 1II4A 2D22A 1HKNA 4L4HA 4MZGB 1RZOB 4G6JA 2L5XA 4LO0A 3BAOA 3O4CA 3O4BA 2ZQOA 3OJ2A 3NBDA 4KBBA 1AVXB 1PUUB 1TFMB 5BXTA 3AZWA 2KI6B 5F8SA 3RMXA 2I1BA 3TC2A 3OJMA 2Z48A 2D24A 2E4MC 3AH1A 3ZX7A 2D20A 5BXRA 4I4PA 1J0SA 4PC4A 1BFCA 1DZCA 1JTCA 4QD2C 41BIA 3HMYA 4QALA 1PZZA 1M2TB 3RTIB 1DQOA 4GP3A 4J2YA 1DJSB 2F2FA 4ZFWB 1EV2A 1RMLA 1TP0A 1T4QA 1ISYA 3N7MA 3UJ0A 3H6QA 1ISZA 4OEGA 5JMCA 1K5UA 2D43A 1BFFA 1DFQA 1DIWA 1YXWA 5E24E 3H6RA 3VSZA 2HWAA 2X2SA 4EFQA 3NBNA 3WO3A 4QBCA 4ZLBB 1WD4A 2NYYA 4EKXB 1YF8B 3F62B 3BRDA 4AN7B 1V6VA 1HCDA 4XFSA 4G9MA 1XYFA 4HR6C 3N7JA 4LO7C 1Q1UA 4EEEB 1V6UA 3FJIA 1HWPB 3R4UA 3A23A 3VWCA 4D0TA 4WBCA 1G82A 1S0EA 3NJ5A 2X2TA 3AKFA 1Z4SA 4I1BA 4I0YA 2NVHA 3OJVA 4JPZA 4X39A 4JKXB 1D0HA 3A22A 3CA6A 1AXMA 4QBVA 2DREA 4HA2A 31BIA 4QC4A 4GOVA 3IM6A 3OGFA 4XFUA 2IHOA 1YTOA 3I29B 3O4DA 4LO8B 2M49A 3N7KA 4OW4A 2P39A 4I4XA 4QKSA 3RMYA 5DVHA 4EFRA 4I7IA 4TLPA 2P23A 4G6MA 3MALA 3FJAA 6I1BA 4J2SA 1SR4A 1A8DA 1F31A 1ISXA 3CRHA 2FFVA 1GGPB 3S8KA 3WINC 1G9BA 2XOAA 3NBEA 4JQ0A 2FGFA 4XFTA 1V6WA 5D62A 4Z8SB 2D1ZA 3Q7WA 1IRPA 4FGFA 3AKHA 2ZR1B 3A07A 4H9WA 4J23B 4I8MA 4LO1C 3IM5A 3O44A 3BAGA 4JAWA 3VEQA 5I1BA 3N7LA 1HCEA 1I1EA 4IY8A 3FJHA 3WA1A 2AAIB 4F83A 3POKA 5F8WA 2MC2A 1XG6A 3ZXDA 3WINA 4ZBVB 5FNXA 1FWUA 3FJDA 5B2HA 3HOMA 2NP0A 3CA5A 3BB2A 3AH2A 3VUOA 3FJJA 3FGMA 1FGAA 2RG9B 3IM7A 3AZVA 4EFPA 1W3AA 3CQAA 1UPSA 3WMUA 1QQKA 4LO1A 1EVTA 3O49A 4KC3A 5FZYA 3UJ4A 3WO4A 1MC9A 1AVWB 2VSEA 3O4OA 1ILR1 4KEKA 4A7ZA 1SZ6B 1NUNA 3E8LC 1FV2A 3O3QA 1PC8B 3FFZA 3QYDA 3BTAA 2AXMA 2NTDA 2FO1A 3CA0A 3FJEA 3K1XA 2Y9FA 1FQ9A 2Z49A 2BEAA 1JQZA 2D7IA 3FUOA 1WD3A 4J2KA 2GO2A 2K8RA 1S0DA 1AVUA 2VUAA 3BX1C 1V6XA 2UUSA 2RSTA 3H6RB 4OWLA 1TWMA 1HWMB 2FFUA 1DZDA 3I2XA 3BAVA 3H6SE 4QD2B 4ISRA 1IILA 1W3GA 1JT3A 1Z0HA 1FMMS 2K4AB 2E4MA 3CA3A 2Y9GA 3T8SA 1TTUA 4GAFA 1QXMA 2YUGA 1BARA 4IYBA 4J2XA 3PG0A 4Q9PA 2D23A 2HW9A 3HN1A 2Y9XE 3BADA 1Q04A 1R8OA 3JRRA 5BP5A 4IONA 1S0BA 1MD6A 2IWTB 1K5VA 4P0KA 3VSFA 3UD8A 3BAUA 1YYNA 1VCLA 3LTQA 5EC5A 3S8JA 4P0JA 3VT1A 3V0BA 1RY7A 4GOYA 1IOBA 2KLLA 3CAHA 2LIEA 3OBTA 3VT2A 2GZBA 4OWJA 1BASA 4LO7B 5JLVA 3FUQA 4AN6A 1JT7A 3O5WB 5EG6C 5BQUC 3HSMA 3PUBA 4ISQA 4DEPA 1IT0A 4I4SA 3A21A 1S0LA 4LO3C 4UY4A 3BRFA 3P6JA 5BVPI 4X38A 1G9CA 4F34A 5F8YA 3OBRA 4R6UB 2DRYA 2J3PA 5D61A 2VXRA 3AJ6A 2R9KB 1ISVA 1I1BA 9ILBA 3V0AB 3BAHA 5DUYA 3SNVA 1AFCA 2MIBA 3CU1B 3HBWA 5FNWA 4P6AA 2K43A 4HJJA 3PMEA 3IIRA 4QO3A 3V0AA 2Q3NB 2HWMA 2VU9A 4IHZA 4LO2C 3WO2A 7I1BA 3UDAA 3AKIA 3AKGA 5BXPA 1XZZA 4LO3A 4I4YA 3ZC8A 4ZOTA 1AF9A 3I2AA 1XHBA 1DFCA 3BA5A 5F90A 4A7YA 1P63A 3HALA 2KKIA 3Q7XA 4H75A 5BXSA 4LO0C 1G9DA 4L4IA 1BFGA 1N4KA 3LLPA 2FDBM 4DCKC 2ET2A 2KI4A 3F1RA 2AFGA 1PWAA 2DRZA 1WBCA 4IZEA 4LO2A 4ENDA 5G00A 8I1BA 3MPPG 3Q7YA 4IY9A 4USPA 4I6IA 4I1EA 1IRAX 1M16A 5FZUA 4I96A 4I2SA 4P0LA 1ONKB 3JUTA 2F2FC 4XKIA 3CA4A 5HPZA 3OGGA 2AQZA 1FWVA 21BIA 3CA1A 1TWEA 4I4VA 4G9NA 4OEFA 1ABRB 4Q91A 4KEIA 1HWOB 3D7WB 3NBCA 4Z9WB 1IHKA 1DLLA 1Z2VA 2ESUA 3N0KA 2NZ9A 1AVAC 2BEBA 4DENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRG C;  2ZQN A;  1QQL A;  3B9U A;  1EYL A;  4IQP A;  1TOO A;  3QR5 A;  5FZZ A;  3BA4 A;  1R8N A;  4GP0 A;  2ERM A;  4G1R A;  3V0B B;  4OUJ A;  1TIE A;  2WRY A;  2VXT I;  5D63 A;  1CVS A;  2D44 A;  3V79 C;  4JRA A;  1BFB A;  1ISW A;  2MLL B;  1BLA A;  4YOL A;  2DS0 A;  1W3F A;  3W9T A;  3FJ8 A;  2VSA A;  4ZFY B;  4OEE A;  1FMZ A;  1Q03 A;  1JLY A;  4I4Q A;  3ZC9 A;  1S0F A;  3C9Z A;  3FJC A;  4QKR A;  3FJF A;  4X3A A;  2QYI B;  1HIB A;  1G9A A;  1RG8 A;  2VLC A;  4ZFU B;  5BP5 C;  1NZK A;  3IAG C;  4I4U A;  1SR4 C;  3CRG A;  3ZXG A;  3O4A A;  4CJM A;  4ZA3 B;  4FVV A;  4JKQ A;  4D0Z A;  3PHZ A;  1L2H A;  2QN4 A;  5DSS B;  1FV3 A;  4I3N A;  2BFH A;  3AJ5 A;  4A7K A;  1JT5 A;  2Q9X A;  1DQG A;  4I4R A;  2NM1 A;  3P53 A;  4I4O A;  3EF2 A;  1BA7 A;  4IZX A;  1KNM A;  3FJB A;  3UD7 A;  5BQU A;  2RQ9 A;  1YBI A;  1JT4 A;  3P6I A;  1JY0 A;  3FJ9 A;  1S0G A;  5GAQ A;  4EB2 B;  3WMV A;  3AH4 A;  1BLD A;  1PUM B;  3BAQ A;  3UD9 A;  4H04 A;  3R4S A;  4ZKT B;  2F8X C;  1ITB A;  1WBA A;  1JLX A;  2Y9W C;  1CE7 B;  3ILA A;  4OWK A;  2LIQ A;  4USO A;  1E0O A;  4X37 A;  3RSJ A;  2D7R A;  4Q9G A;  5EHA A;  1OQL B;  3KMV A;  2HZ9 A;  3BA7 A;  4GAI A;  5BOW A;  1FN0 A;  3CRI A;  3VT0 A;  3RTJ B;  1HWN B;  4II0 A;  4KEJ A;  4D8H A;  4JP0 A;  1S0C A;  3FJK A;  1EPW A;  4I37 A;  1IJT A;  5DZU A;  2KH2 A;  4ZGR B;  2WBC A;  1T9F A;  1II4 A;  2D22 A;  1HKN A;  4L4H A;  1RZO B;  4G6J A;  2L5X A;  4LO0 A;  3BAO A;  3O4C A;  3O4B A;  2ZQO A;  3OJ2 A;  3NBD A;  4KBB A;  1AVX B;  1PUU B;  1TFM B;  5BXT A;  3AZW A;  2KI6 B;  5F8S A;  3RMX A;  2I1B A;  3TC2 A;  3OJM A;  2Z48 A;  2D24 A;  2E4M C;  3AH1 A;  3ZX7 A;  2D20 A;  5BXR A;  4I4P A;  1J0S A;  4PC4 A;  1BFC A;  1DZC A;  1JTC A;  4QD2 C;  41BI A;  3HMY A;  4QAL A;  1PZZ A;  1M2T B;  3RTI B;  1DQO A;  4GP3 A;  4J2Y A;  1DJS B;  2F2F A;  4ZFW B;  1EV2 A;  1RML A;  1TP0 A;  1T4Q A;  1ISY A;  3N7M A;  3UJ0 A;  3H6Q A;  1ISZ A;  4OEG A;  5JMC A;  1K5U A;  2D43 A;  1BFF A;  1DFQ A;  1DIW A;  1YXW A;  5E24 E;  3H6R A;  3VSZ A;  2HWA A;  2X2S A;  4EFQ A;  3NBN A;  3WO3 A;  4QBC A;  4ZLB B;  1WD4 A;  2NYY A;  4EKX B;  1YF8 B;  3F62 B;  3BRD A;  4AN7 B;  1V6V A;  1HCD A;  4XFS A;  4G9M A;  1XYF A;  4HR6 C;  3N7J A;  4LO7 C;  1Q1U A;  4EEE B;  1V6U A;  3FJI A;  1HWP B;  3R4U A;  3A23 A;  3VWC A;  4D0T A;  4WBC A;  1G82 A;  1S0E A;  3NJ5 A;  2X2T A;  3AKF A;  1Z4S A;  4I1B A;  4I0Y A;  2NVH A;  3OJV A;  4JPZ A;  4X39 A;  4JKX B;  1D0H A;  3A22 A;  3CA6 A;  1AXM A;  4QBV A;  2DRE A;  4HA2 A;  31BI A;  4QC4 A;  4GOV A;  3IM6 A;  3OGF A;  4XFU A;  2IHO A;  1YTO A;  3I29 B;  3O4D A;  4LO8 B;  2M49 A;  3N7K A;  4OW4 A;  2P39 A;  4I4X A;  4QKS A;  3RMY A;  5DVH A;  4EFR A;  4I7I A;  4TLP A;  2P23 A;  4G6M A;  3MAL A;  3FJA A;  6I1B A;  4J2S A;  1SR4 A;  1A8D A;  1F31 A;  1ISX A;  3CRH A;  2FFV A;  1GGP B;  3S8K A;  3WIN C;  1G9B A;  2XOA A;  3NBE A;  4JQ0 A;  2FGF A;  4XFT A;  1V6W A;  5D62 A;  4Z8S B;  2D1Z A;  3Q7W A;  1IRP A;  4FGF A;  3AKH A;  2ZR1 B;  3A07 A;  4H9W A;  4J23 B;  4I8M A;  4LO1 C;  3IM5 A;  3O44 A;  3BAG A;  4JAW A;  3VEQ A;  5I1B A;  3N7L A;  1HCE A;  1I1E A;  4IY8 A;  3FJH A;  3WA1 A;  2AAI B;  4F83 A;  3POK A;  5F8W A;  2MC2 A;  1XG6 A;  3ZXD A;  3WIN A;  4ZBV B;  5FNX A;  1FWU A;  3FJD A;  5B2H A;  3HOM A;  2NP0 A;  3CA5 A;  3BB2 A;  3AH2 A;  3VUO A;  3FJJ A;  3FGM A;  1FGA A;  2RG9 B;  3IM7 A;  3AZV A;  4EFP A;  1W3A A;  3CQA A;  1UPS A;  3WMU A;  1QQK A;  4LO1 A;  1EVT A;  3O49 A;  4KC3 A;  5FZY A;  3UJ4 A;  3WO4 A;  1MC9 A;  1AVW B;  2VSE A;  3O4O A;  1ILR 1;  4KEK A;  4A7Z A;  1SZ6 B;  1NUN A;  3E8L C;  1FV2 A;  3O3Q A;  1PC8 B;  3FFZ A;  3QYD A;  3BTA A;  2AXM A;  2NTD A;  2FO1 A;  3CA0 A;  3FJE A;  3K1X A;  2Y9F A;  1FQ9 A;  2Z49 A;  2BEA A;  1JQZ A;  2D7I A;  3FUO A;  1WD3 A;  4J2K A;  2GO2 A;  2K8R A;  1S0D A;  1AVU A;  2VUA A;  3BX1 C;  1V6X A;  2UUS A;  2RST A;  3H6R B;  4OWL A;  1TWM A;  1HWM B;  2FFU A;  1DZD A;  3I2X A;  3BAV A;  3H6S E;  4QD2 B;  4ISR A;  1IIL A;  1W3G A;  1JT3 A;  1Z0H A;  1FMM S;  2K4A B;  2E4M A;  3CA3 A;  2Y9G A;  3T8S A;  1TTU A;  4GAF A;  1QXM A;  2YUG A;  1BAR A;  4IYB A;  4J2X A;  3PG0 A;  4Q9P A;  2D23 A;  2HW9 A;  3HN1 A;  2Y9X E;  3BAD A;  1Q04 A;  1R8O A;  3JRR A;  5BP5 A;  4ION A;  1S0B A;  1MD6 A;  2IWT B;  1K5V A;  4P0K A;  3VSF A;  3UD8 A;  3BAU A;  1YYN A;  1VCL A;  3LTQ A;  5EC5 A;  3S8J A;  4P0J A;  3VT1 A;  3V0B A;  1RY7 A;  4GOY A;  1IOB A;  2KLL A;  3CAH A;  2LIE A;  3OBT A;  3VT2 A;  2GZB A;  4OWJ A;  1BAS A;  4LO7 B;  5JLV A;  3FUQ A;  4AN6 A;  1JT7 A;  3O5W B;  5EG6 C;  5BQU C;  3HSM A;  3PUB A;  4ISQ A;  4DEP A;  1IT0 A;  4I4S A;  3A21 A;  1S0L A;  4LO3 C;  3BRF A;  3P6J A;  5BVP I;  4X38 A;  1G9C A;  4F34 A;  5F8Y A;  3OBR A;  4R6U B;  2DRY A;  2J3P A;  5D61 A;  2VXR A;  3AJ6 A;  2R9K B;  1ISV A;  1I1B A;  9ILB A;  3V0A B;  3BAH A;  5DUY A;  3SNV A;  1AFC A;  2MIB A;  3CU1 B;  3HBW A;  5FNW A;  4P6A A;  2K43 A;  4HJJ A;  3PME A;  3IIR A;  4QO3 A;  3V0A A;  2Q3N B;  2HWM A;  2VU9 A;  4IHZ A;  4LO2 C;  3WO2 A;  7I1B A;  3UDA A;  3AKI A;  3AKG A;  5BXP A;  1XZZ A;  4LO3 A;  4I4Y A;  3ZC8 A;  4ZOT A;  1AF9 A;  3I2A A;  1XHB A;  1DFC A;  3BA5 A;  5F90 A;  4A7Y A;  1P63 A;  3HAL A;  2KKI A;  3Q7X A;  5BXS A;  4LO0 C;  1G9D A;  4L4I A;  1BFG A;  1N4K A;  3LLP A;  2FDB M;  4DCK C;  2ET2 A;  2KI4 A;  3F1R A;  2AFG A;  1PWA A;  2DRZ A;  1WBC A;  4IZE A;  4LO2 A;  4END A;  5G00 A;  8I1B A;  3MPP G;  3Q7Y A;  4IY9 A;  4USP A;  4I6I A;  4I1E A;  1IRA X;  1M16 A;  5FZU A;  4I96 A;  4I2S A;  4P0L A;  1ONK B;  3JUT A;  2F2F C;  4XKI A;  3CA4 A;  5HPZ A;  3OGG A;  2AQZ A;  1FWV A;  21BI A;  3CA1 A;  1TWE A;  4I4V A;  4G9N A;  4OEF A;  1ABR B;  4Q91 A;  4KEI A;  1HWO B;  3D7W B;  3NBC A;  4Z9W B;  1IHK A;  1DLL A;  1Z2V A;  2ESU A;  3N0K A;  2NZ9 A;  1AVA C;  2BEB A;  4DEN A; 
#chains in the Genus database with same CATH topology
 3BRG C;  2ZQN A;  1QQL A;  3B9U A;  1EYL A;  4IQP A;  1TOO A;  3QR5 A;  5FZZ A;  3BA4 A;  1R8N A;  4GP0 A;  2ERM A;  4G1R A;  3V0B B;  4OUJ A;  1TIE A;  2WRY A;  2VXT I;  5D63 A;  1CVS A;  2D44 A;  3V79 C;  4JRA A;  1BFB A;  1ISW A;  2MLL B;  1BLA A;  4YOL A;  2DS0 A;  1W3F A;  3W9T A;  3FJ8 A;  2VSA A;  4ZFY B;  4OEE A;  1FMZ A;  1Q03 A;  1JLY A;  4I4Q A;  3ZC9 A;  1S0F A;  3C9Z A;  3FJC A;  4QKR A;  3FJF A;  4X3A A;  2QYI B;  1HIB A;  1G9A A;  4MZF B;  1RG8 A;  2NS2 A;  2VLC A;  4ZFU B;  5BP5 C;  1NZK A;  3IAG C;  4I4U A;  1SR4 C;  3CRG A;  3ZXG A;  3O4A A;  4CJM A;  4ZA3 B;  4FVV A;  4JKQ A;  4D0Z A;  4MZH A;  3PHZ A;  1L2H A;  2QN4 A;  5DSS B;  1FV3 A;  4I3N A;  2BFH A;  3AJ5 A;  4A7K A;  1JT5 A;  2Q9X A;  1DQG A;  4I4R A;  2NM1 A;  3P53 A;  4I4O A;  3EF2 A;  1BA7 A;  4IZX A;  1KNM A;  3FJB A;  3UD7 A;  5BQU A;  2RQ9 A;  1YBI A;  1JT4 A;  3P6I A;  1JY0 A;  3FJ9 A;  1S0G A;  5GAQ A;  4EB2 B;  3WMV A;  3AH4 A;  1BLD A;  1PUM B;  3BAQ A;  3UD9 A;  4H04 A;  3R4S A;  4ZKT B;  2F8X C;  1ITB A;  1WBA A;  1JLX A;  2Y9W C;  1CE7 B;  3ILA A;  4OWK A;  2LIQ A;  4USO A;  1E0O A;  4X37 A;  3RSJ A;  2D7R A;  4Q9G A;  5EHA A;  1OQL B;  3KMV A;  2HZ9 A;  3BA7 A;  4GAI A;  5BOW A;  1FN0 A;  3CRI A;  3VT0 A;  3RTJ B;  1HWN B;  4II0 A;  4KEJ A;  4D8H A;  4JP0 A;  1S0C A;  3FJK A;  1EPW A;  4I37 A;  1IJT A;  5DZU A;  2KH2 A;  4ZGR B;  2WBC A;  1T9F A;  1II4 A;  2D22 A;  1HKN A;  4L4H A;  4MZG B;  1RZO B;  4G6J A;  2L5X A;  4LO0 A;  3BAO A;  3O4C A;  3O4B A;  2ZQO A;  3OJ2 A;  3NBD A;  4KBB A;  1AVX B;  1PUU B;  1TFM B;  5BXT A;  3AZW A;  2KI6 B;  5F8S A;  3RMX A;  2I1B A;  3TC2 A;  3OJM A;  2Z48 A;  2D24 A;  2E4M C;  3AH1 A;  3ZX7 A;  2D20 A;  5BXR A;  4I4P A;  1J0S A;  4PC4 A;  1BFC A;  1DZC A;  1JTC A;  4QD2 C;  41BI A;  3HMY A;  4QAL A;  1PZZ A;  1M2T B;  3RTI B;  1DQO A;  4GP3 A;  4J2Y A;  1DJS B;  2F2F A;  4ZFW B;  1EV2 A;  1RML A;  1TP0 A;  1T4Q A;  1ISY A;  3N7M A;  3UJ0 A;  3H6Q A;  1ISZ A;  4OEG A;  5JMC A;  1K5U A;  2D43 A;  1BFF A;  1DFQ A;  1DIW A;  1YXW A;  5E24 E;  3H6R A;  3VSZ A;  2HWA A;  2X2S A;  4EFQ A;  3NBN A;  3WO3 A;  4QBC A;  4ZLB B;  1WD4 A;  2NYY A;  4EKX B;  1YF8 B;  3F62 B;  3BRD A;  4AN7 B;  1V6V A;  1HCD A;  4XFS A;  4G9M A;  1XYF A;  4HR6 C;  3N7J A;  4LO7 C;  1Q1U A;  4EEE B;  1V6U A;  3FJI A;  1HWP B;  3R4U A;  3A23 A;  3VWC A;  4D0T A;  4WBC A;  1G82 A;  1S0E A;  3NJ5 A;  2X2T A;  3AKF A;  1Z4S A;  4I1B A;  4I0Y A;  2NVH A;  3OJV A;  4JPZ A;  4X39 A;  4JKX B;  1D0H A;  3A22 A;  3CA6 A;  1AXM A;  4QBV A;  2DRE A;  4HA2 A;  31BI A;  4QC4 A;  4GOV A;  3IM6 A;  3OGF A;  4XFU A;  2IHO A;  1YTO A;  3I29 B;  3O4D A;  4LO8 B;  2M49 A;  3N7K A;  4OW4 A;  2P39 A;  4I4X A;  4QKS A;  3RMY A;  5DVH A;  4EFR A;  4I7I A;  4TLP A;  2P23 A;  4G6M A;  3MAL A;  3FJA A;  6I1B A;  4J2S A;  1SR4 A;  1A8D A;  1F31 A;  1ISX A;  3CRH A;  2FFV A;  1GGP B;  3S8K A;  3WIN C;  1G9B A;  2XOA A;  3NBE A;  4JQ0 A;  2FGF A;  4XFT A;  1V6W A;  5D62 A;  4Z8S B;  2D1Z A;  3Q7W A;  1IRP A;  4FGF A;  3AKH A;  2ZR1 B;  3A07 A;  4H9W A;  4J23 B;  4I8M A;  4LO1 C;  3IM5 A;  3O44 A;  3BAG A;  4JAW A;  3VEQ A;  5I1B A;  3N7L A;  1HCE A;  1I1E A;  4IY8 A;  3FJH A;  3WA1 A;  2AAI B;  4F83 A;  3POK A;  5F8W A;  2MC2 A;  1XG6 A;  3ZXD A;  3WIN A;  4ZBV B;  5FNX A;  1FWU A;  3FJD A;  5B2H A;  3HOM A;  2NP0 A;  3CA5 A;  3BB2 A;  3AH2 A;  3VUO A;  3FJJ A;  3FGM A;  1FGA A;  2RG9 B;  3IM7 A;  3AZV A;  4EFP A;  1W3A A;  3CQA A;  1UPS A;  3WMU A;  1QQK A;  4LO1 A;  1EVT A;  3O49 A;  4KC3 A;  5FZY A;  3UJ4 A;  3WO4 A;  1MC9 A;  1AVW B;  2VSE A;  3O4O A;  1ILR 1;  4KEK A;  4A7Z A;  1SZ6 B;  1NUN A;  3E8L C;  1FV2 A;  3O3Q A;  1PC8 B;  3FFZ A;  3QYD A;  3BTA A;  2AXM A;  2NTD A;  2FO1 A;  3CA0 A;  3FJE A;  3K1X A;  2Y9F A;  1FQ9 A;  2Z49 A;  2BEA A;  1JQZ A;  2D7I A;  3FUO A;  1WD3 A;  4J2K A;  2GO2 A;  2K8R A;  1S0D A;  1AVU A;  2VUA A;  3BX1 C;  1V6X A;  2UUS A;  2RST A;  3H6R B;  4OWL A;  1TWM A;  1HWM B;  2FFU A;  1DZD A;  3I2X A;  3BAV A;  3H6S E;  4QD2 B;  4ISR A;  1IIL A;  1W3G A;  1JT3 A;  1Z0H A;  1FMM S;  2K4A B;  2E4M A;  3CA3 A;  2Y9G A;  3T8S A;  1TTU A;  4GAF A;  1QXM A;  2YUG A;  1BAR A;  4IYB A;  4J2X A;  3PG0 A;  4Q9P A;  2D23 A;  2HW9 A;  3HN1 A;  2Y9X E;  3BAD A;  1Q04 A;  1R8O A;  3JRR A;  5BP5 A;  4ION A;  1S0B A;  1MD6 A;  2IWT B;  1K5V A;  4P0K A;  3VSF A;  3UD8 A;  3BAU A;  1YYN A;  1VCL A;  3LTQ A;  5EC5 A;  3S8J A;  4P0J A;  3VT1 A;  3V0B A;  1RY7 A;  4GOY A;  1IOB A;  2KLL A;  3CAH A;  2LIE A;  3OBT A;  3VT2 A;  2GZB A;  4OWJ A;  1BAS A;  4LO7 B;  5JLV A;  3FUQ A;  4AN6 A;  1JT7 A;  3O5W B;  5EG6 C;  5BQU C;  3HSM A;  3PUB A;  4ISQ A;  4DEP A;  1IT0 A;  4I4S A;  3A21 A;  1S0L A;  4LO3 C;  4UY4 A;  3BRF A;  3P6J A;  5BVP I;  4X38 A;  1G9C A;  4F34 A;  5F8Y A;  3OBR A;  4R6U B;  2DRY A;  2J3P A;  5D61 A;  2VXR A;  3AJ6 A;  2R9K B;  1ISV A;  1I1B A;  9ILB A;  3V0A B;  3BAH A;  5DUY A;  3SNV A;  1AFC A;  2MIB A;  3CU1 B;  3HBW A;  5FNW A;  4P6A A;  2K43 A;  4HJJ A;  3PME A;  3IIR A;  4QO3 A;  3V0A A;  2Q3N B;  2HWM A;  2VU9 A;  4IHZ A;  4LO2 C;  3WO2 A;  7I1B A;  3UDA A;  3AKI A;  3AKG A;  5BXP A;  1XZZ A;  4LO3 A;  4I4Y A;  3ZC8 A;  4ZOT A;  1AF9 A;  3I2A A;  1XHB A;  1DFC A;  3BA5 A;  5F90 A;  4A7Y A;  1P63 A;  3HAL A;  2KKI A;  3Q7X A;  4H75 A;  5BXS A;  4LO0 C;  1G9D A;  4L4I A;  1BFG A;  1N4K A;  3LLP A;  2FDB M;  4DCK C;  2ET2 A;  2KI4 A;  3F1R A;  2AFG A;  1PWA A;  2DRZ A;  1WBC A;  4IZE A;  4LO2 A;  4END A;  5G00 A;  8I1B A;  3MPP G;  3Q7Y A;  4IY9 A;  4USP A;  4I6I A;  4I1E A;  1IRA X;  1M16 A;  5FZU A;  4I96 A;  4I2S A;  4P0L A;  1ONK B;  3JUT A;  2F2F C;  4XKI A;  3CA4 A;  5HPZ A;  3OGG A;  2AQZ A;  1FWV A;  21BI A;  3CA1 A;  1TWE A;  4I4V A;  4G9N A;  4OEF A;  1ABR B;  4Q91 A;  4KEI A;  1HWO B;  3D7W B;  3NBC A;  4Z9W B;  1IHK A;  1DLL A;  1Z2V A;  2ESU A;  3N0K A;  2NZ9 A;  1AVA C;  2BEB A;  4DEN A; 
#chains in the Genus database with same CATH homology
 3BRG C;  2ZQN A;  1QQL A;  3B9U A;  1EYL A;  4IQP A;  1TOO A;  3QR5 A;  5FZZ A;  3BA4 A;  1R8N A;  4GP0 A;  2ERM A;  4G1R A;  3V0B B;  4OUJ A;  1TIE A;  2WRY A;  2VXT I;  5D63 A;  1CVS A;  2D44 A;  3V79 C;  4JRA A;  1BFB A;  1ISW A;  2MLL B;  1BLA A;  4YOL A;  2DS0 A;  1W3F A;  3W9T A;  3FJ8 A;  2VSA A;  4ZFY B;  4OEE A;  1FMZ A;  1Q03 A;  1JLY A;  4I4Q A;  3ZC9 A;  1S0F A;  3C9Z A;  3FJC A;  4QKR A;  3FJF A;  4X3A A;  2QYI B;  1HIB A;  1G9A A;  4MZF B;  1RG8 A;  2NS2 A;  2VLC A;  4ZFU B;  5BP5 C;  1NZK A;  3IAG C;  4I4U A;  1SR4 C;  3CRG A;  3ZXG A;  3O4A A;  4CJM A;  4ZA3 B;  4FVV A;  4JKQ A;  4D0Z A;  4MZH A;  3PHZ A;  1L2H A;  2QN4 A;  5DSS B;  1FV3 A;  4I3N A;  2BFH A;  3AJ5 A;  4A7K A;  1JT5 A;  2Q9X A;  1DQG A;  4I4R A;  2NM1 A;  3P53 A;  4I4O A;  3EF2 A;  1BA7 A;  4IZX A;  1KNM A;  3FJB A;  3UD7 A;  5BQU A;  2RQ9 A;  1YBI A;  1JT4 A;  3P6I A;  1JY0 A;  3FJ9 A;  1S0G A;  5GAQ A;  4EB2 B;  3WMV A;  3AH4 A;  1BLD A;  1PUM B;  3BAQ A;  3UD9 A;  4H04 A;  3R4S A;  4ZKT B;  2F8X C;  1ITB A;  1WBA A;  1JLX A;  2Y9W C;  1CE7 B;  3ILA A;  4OWK A;  2LIQ A;  4USO A;  1E0O A;  4X37 A;  3RSJ A;  2D7R A;  4Q9G A;  5EHA A;  1OQL B;  3KMV A;  2HZ9 A;  3BA7 A;  4GAI A;  5BOW A;  1FN0 A;  3CRI A;  3VT0 A;  3RTJ B;  1HWN B;  4II0 A;  4KEJ A;  4D8H A;  4JP0 A;  1S0C A;  3FJK A;  1EPW A;  4I37 A;  1IJT A;  5DZU A;  2KH2 A;  4ZGR B;  2WBC A;  1T9F A;  1II4 A;  2D22 A;  1HKN A;  4L4H A;  4MZG B;  1RZO B;  4G6J A;  2L5X A;  4LO0 A;  3BAO A;  3O4C A;  3O4B A;  2ZQO A;  3OJ2 A;  3NBD A;  4KBB A;  1AVX B;  1PUU B;  1TFM B;  5BXT A;  3AZW A;  2KI6 B;  5F8S A;  3RMX A;  2I1B A;  3TC2 A;  3OJM A;  2Z48 A;  2D24 A;  2E4M C;  3AH1 A;  3ZX7 A;  2D20 A;  5BXR A;  4I4P A;  1J0S A;  4PC4 A;  1BFC A;  1DZC A;  1JTC A;  4QD2 C;  41BI A;  3HMY A;  4QAL A;  1PZZ A;  1M2T B;  3RTI B;  1DQO A;  4GP3 A;  4J2Y A;  1DJS B;  2F2F A;  4ZFW B;  1EV2 A;  1RML A;  1TP0 A;  1T4Q A;  1ISY A;  3N7M A;  3UJ0 A;  3H6Q A;  1ISZ A;  4OEG A;  5JMC A;  1K5U A;  2D43 A;  1BFF A;  1DFQ A;  1DIW A;  1YXW A;  5E24 E;  3H6R A;  3VSZ A;  2HWA A;  2X2S A;  4EFQ A;  3NBN A;  3WO3 A;  4QBC A;  4ZLB B;  1WD4 A;  2NYY A;  4EKX B;  1YF8 B;  3F62 B;  3BRD A;  4AN7 B;  1V6V A;  1HCD A;  4XFS A;  4G9M A;  1XYF A;  4HR6 C;  3N7J A;  4LO7 C;  1Q1U A;  4EEE B;  1V6U A;  3FJI A;  1HWP B;  3R4U A;  3A23 A;  3VWC A;  4D0T A;  4WBC A;  1G82 A;  1S0E A;  3NJ5 A;  2X2T A;  3AKF A;  1Z4S A;  4I1B A;  4I0Y A;  2NVH A;  3OJV A;  4JPZ A;  4X39 A;  4JKX B;  1D0H A;  3A22 A;  3CA6 A;  1AXM A;  4QBV A;  2DRE A;  4HA2 A;  31BI A;  4QC4 A;  4GOV A;  3IM6 A;  3OGF A;  4XFU A;  2IHO A;  1YTO A;  3I29 B;  3O4D A;  4LO8 B;  2M49 A;  3N7K A;  4OW4 A;  2P39 A;  4I4X A;  4QKS A;  3RMY A;  5DVH A;  4EFR A;  4I7I A;  4TLP A;  2P23 A;  4G6M A;  3MAL A;  3FJA A;  6I1B A;  4J2S A;  1SR4 A;  1A8D A;  1F31 A;  1ISX A;  3CRH A;  2FFV A;  1GGP B;  3S8K A;  3WIN C;  1G9B A;  2XOA A;  3NBE A;  4JQ0 A;  2FGF A;  4XFT A;  1V6W A;  5D62 A;  4Z8S B;  2D1Z A;  3Q7W A;  1IRP A;  4FGF A;  3AKH A;  2ZR1 B;  3A07 A;  4H9W A;  4J23 B;  4I8M A;  4LO1 C;  3IM5 A;  3O44 A;  3BAG A;  4JAW A;  3VEQ A;  5I1B A;  3N7L A;  1HCE A;  1I1E A;  4IY8 A;  3FJH A;  3WA1 A;  2AAI B;  4F83 A;  3POK A;  5F8W A;  2MC2 A;  1XG6 A;  3ZXD A;  3WIN A;  4ZBV B;  5FNX A;  1FWU A;  3FJD A;  5B2H A;  3HOM A;  2NP0 A;  3CA5 A;  3BB2 A;  3AH2 A;  3VUO A;  3FJJ A;  3FGM A;  1FGA A;  2RG9 B;  3IM7 A;  3AZV A;  4EFP A;  1W3A A;  3CQA A;  1UPS A;  3WMU A;  1QQK A;  4LO1 A;  1EVT A;  3O49 A;  4KC3 A;  5FZY A;  3UJ4 A;  3WO4 A;  1MC9 A;  1AVW B;  2VSE A;  3O4O A;  1ILR 1;  4KEK A;  4A7Z A;  1SZ6 B;  1NUN A;  3E8L C;  1FV2 A;  3O3Q A;  1PC8 B;  3FFZ A;  3QYD A;  3BTA A;  2AXM A;  2NTD A;  2FO1 A;  3CA0 A;  3FJE A;  3K1X A;  2Y9F A;  1FQ9 A;  2Z49 A;  2BEA A;  1JQZ A;  2D7I A;  3FUO A;  1WD3 A;  4J2K A;  2GO2 A;  2K8R A;  1S0D A;  1AVU A;  2VUA A;  3BX1 C;  1V6X A;  2UUS A;  2RST A;  3H6R B;  4OWL A;  1TWM A;  1HWM B;  2FFU A;  1DZD A;  3I2X A;  3BAV A;  3H6S E;  4QD2 B;  4ISR A;  1IIL A;  1W3G A;  1JT3 A;  1Z0H A;  1FMM S;  2K4A B;  2E4M A;  3CA3 A;  2Y9G A;  3T8S A;  1TTU A;  4GAF A;  1QXM A;  2YUG A;  1BAR A;  4IYB A;  4J2X A;  3PG0 A;  4Q9P A;  2D23 A;  2HW9 A;  3HN1 A;  2Y9X E;  3BAD A;  1Q04 A;  1R8O A;  3JRR A;  5BP5 A;  4ION A;  1S0B A;  1MD6 A;  2IWT B;  1K5V A;  4P0K A;  3VSF A;  3UD8 A;  3BAU A;  1YYN A;  1VCL A;  3LTQ A;  5EC5 A;  3S8J A;  4P0J A;  3VT1 A;  3V0B A;  1RY7 A;  4GOY A;  1IOB A;  2KLL A;  3CAH A;  2LIE A;  3OBT A;  3VT2 A;  2GZB A;  4OWJ A;  1BAS A;  4LO7 B;  5JLV A;  3FUQ A;  4AN6 A;  1JT7 A;  3O5W B;  5EG6 C;  5BQU C;  3HSM A;  3PUB A;  4ISQ A;  4DEP A;  1IT0 A;  4I4S A;  3A21 A;  1S0L A;  4LO3 C;  4UY4 A;  3BRF A;  3P6J A;  5BVP I;  4X38 A;  1G9C A;  4F34 A;  5F8Y A;  3OBR A;  4R6U B;  2DRY A;  2J3P A;  5D61 A;  2VXR A;  3AJ6 A;  2R9K B;  1ISV A;  1I1B A;  9ILB A;  3V0A B;  3BAH A;  5DUY A;  3SNV A;  1AFC A;  2MIB A;  3CU1 B;  3HBW A;  5FNW A;  4P6A A;  2K43 A;  4HJJ A;  3PME A;  3IIR A;  4QO3 A;  3V0A A;  2Q3N B;  2HWM A;  2VU9 A;  4IHZ A;  4LO2 C;  3WO2 A;  7I1B A;  3UDA A;  3AKI A;  3AKG A;  5BXP A;  1XZZ A;  4LO3 A;  4I4Y A;  3ZC8 A;  4ZOT A;  1AF9 A;  3I2A A;  1XHB A;  1DFC A;  3BA5 A;  5F90 A;  4A7Y A;  1P63 A;  3HAL A;  2KKI A;  3Q7X A;  4H75 A;  5BXS A;  4LO0 C;  1G9D A;  4L4I A;  1BFG A;  1N4K A;  3LLP A;  2FDB M;  4DCK C;  2ET2 A;  2KI4 A;  3F1R A;  2AFG A;  1PWA A;  2DRZ A;  1WBC A;  4IZE A;  4LO2 A;  4END A;  5G00 A;  8I1B A;  3MPP G;  3Q7Y A;  4IY9 A;  4USP A;  4I6I A;  4I1E A;  1IRA X;  1M16 A;  5FZU A;  4I96 A;  4I2S A;  4P0L A;  1ONK B;  3JUT A;  2F2F C;  4XKI A;  3CA4 A;  5HPZ A;  3OGG A;  2AQZ A;  1FWV A;  21BI A;  3CA1 A;  1TWE A;  4I4V A;  4G9N A;  4OEF A;  1ABR B;  4Q91 A;  4KEI A;  1HWO B;  3D7W B;  3NBC A;  4Z9W B;  1IHK A;  1DLL A;  1Z2V A;  2ESU A;  3N0K A;  2NZ9 A;  1AVA C;  2BEB A;  4DEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...