4I4QA

Bel beta-trefoil apo crystal form 3
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
146
structure length
146
Chain Sequence
VNFPNIPAEGVRFRLRARDSGYVIYSRTENDPLVWHYNGPPYDDQLFTLIHGTGSRLNLYAIKSVPNGRVLFSRNSASPTVGNIVGDGTYNDNWFQFIQDDNDANSFRIYSLASDSVLYSRTTGAPQFGNYTGPKFDDQLWHFEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BEL-beta trefoil
publication title BEL {beta}-trefoil: A novel lectin with antineoplastic properties in king bolete (Boletus edulis) mushrooms.
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 42
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4i4qA00
4DENA 4GP3A 3FJHA 4ZKTB 5DVHA 2DRYA 3H6SE 3ZXGA 2FFUA 2E4MA 4FVVA 2ESUA 3V0BA 2BEAA 1BASA 2FO1A 1RMLA 1W3AA 1I1EA 1YTOA 3FJDA 3W9TA 1FWVA 3B9UA 5D63A 1T4QA 2ZR1B 4EKXB 1BFBA 3FJEA 2K43A 2J3PA 3O49A 5BVPI 1HKNA 1PC8B 4XFSA 4QBCA 2ZQOA 1S0FA 3HN1A 2DREA 1AVUA 4A7ZA 2RQ9A 3BTAA 3RTJB 1DLLA 4I4OA 4OUJA 3FJIA 1G9CA 3V0AB 4ZFUB 4OEFA 4EEEB 3O4AA 1FV2A 5DSSB 3O4DA 2NP0A 1WBCA 4I0YA 1UPSA 2K8RA 3FJKA 1IOBA 3NBCA 5G00A 3A21A 3HALA 4ISQA 2ERMA 1JT7A 1D0HA 4OW4A 2Y9GA 1HWNB 2D7IA 5BXSA 4FGFA 3VWCA 1YXWA 3AKHA 2MC2A 3BA4A 2AQZA 2VXTI 1W3FA 5B2HA 1G9AA 1G82A 3OJMA 4LO2C 4A7YA 2NM1A 3ZC8A 3A07A 4LO3C 4I3NA 4A7KA 5FNXA 4YOLA 1RG8A 3BAQA 3RMXA 3N7MA 1S0EA 4ZFYB 3BB2A 3CA3A 3N7KA 1BLAA 1QQKA 1YF8B 2D1ZA 1S0DA 3FJFA 3OBRA 5F8SA 1EV2A 3UJ4A 2GZBA 3VSFA 5JMCA 4EB2B 1K5UA 2ZQNA 3RMYA 2Z48A 1DJSB 4IHZA 3E8LC 3F1RA 4LO7B 5D62A 4G1RA 4P0LA 1YYNA 3BA7A 3MALA 2R9KB 2FGFA 3PUBA 3I29B 5JLVA 2BFHA 4G9MA 4I4YA 4I37A 1PZZA 4X3AA 1SR4C 4ZLBB 3A23A 4LO1C 3BAHA 2HZ9A 1NUNA 5BQUC 3AH2A 1FMMS 2KI4A 3BRFA 2AAIB 1V6VA 3I2XA 3FFZA 1DQGA 1HIBA 2F2FC 3FJJA 1BFGA 2WRYA 4QBVA 3D7WB 1JQZA 1EVTA 3OJ2A 4XFUA 3I2AA 1XHBA 1JT4A 4AN7B 3O44A 3UD9A 3N0KA 1IRPA 3Q7YA 3CRIA 3PMEA 4OWLA 1GGPB 5F8YA 3O4CA 1V6XA 5DZUA 2VSAA 4LO2A 1CE7B 2P39A 2YUGA 8I1BA 4ENDA 3NBNA 2RSTA 3NBDA 4LO3A 2HWMA 3HMYA 7I1BA 2AFGA 4AN6A 1WBAA 1M2TB 2QN4A 4IY8A 5F90A 3NBEA 3WMVA 3EF2A 2NYYA 4JKQA 1TWEA 2MLLB 2Z49A 1FQ9A 3BRDA 3WO3A 1JT3A 3R4SA 1XYFA 1S0CA 9ILBA 2WBCA 5F8WA 3N7LA 1ILR1 1TOOA 4EFPA 4QD2C 1DFQA 4KBBA 2D7RA 4JKXB 4D0TA 3A22A 1V6WA 3ZXDA 1XZZA 2HW9A 1ISWA 1S0GA 4X37A 1NZKA 4USOA 4PC4A 4H04A 4G9NA 21BIA 4LO1A 5BQUA 3AZVA 2DRZA 3BAGA 2ET2A 2VUAA 3CA6A 4II0A 3CAHA 4EFRA 3V79C 4I4VA 2Y9FA 3BAOA 1G9DA 1SZ6B 4I1EA 5BP5C 4KEKA 3AH4A 3AH1A 3BAUA 3P6IA 1HWOB 1P63A 1QXMA 4I2SA 4F34A 1HCEA 3K1XA 3CQAA 4USPA 4P0KA 3FUOA 3HSMA 3QYDA 1IILA 5FZUA 3AJ5A 4X39A 3IAGC 1QQLA 5HPZA 1G9BA 3CA4A 3OBTA 3WINC 3BX1C 3UDAA 4I4RA 4EFQA 4GAIA 3VEQA 1PUUB 3LLPA 3IIRA 3ZX7A 3S8KA 4IQPA 2Q3NB 2HWAA 3ZC9A 4I96A 5FZZA 3CA5A 3CA0A 4QC4A 2AXMA 1DZCA 4R6UB 3AZWA 4ZFWB 4HA2A 3CA1A 1M16A 1PWAA 2M49A 4WBCA 4IONA 3BA5A 4QKRA 5D61A 4IZEA 1E0OA 5E24E 1AFCA 1TFMB 1BA7A 3WO2A 5FNWA 4ZGRB 2XOAA 3CU1B 3IM5A 4Z8SB 4GAFA 3RSJA 4H9WA 4GP0A 1N4KA 1AVAC 3VT2A 1ISZA 3R4UA 1ABRB 2D43A 2KI6B 3SNVA 3UD8A 2D24A 3UJ0A 1W3GA 2BEBA 1FGAA 3AKFA 2VLCA 1FV3A 4J2YA 4Q91A 4I1BA 1Z4SA 4TLPA 2Y9XE 4J2KA 4I4XA 1I1BA 4Q9PA 1OQLB 3WMUA 3VT1A 2LIQA 5BP5A 3BAVA 1BLDA 2FFVA 3HOMA 5EC5A 3IM7A 3IM6A 2X2TA 3FJAA 3HBWA 1ISYA 4JQ0A 4Q9GA 4HR6C 1DZDA 2D20A 4L4IA 1DFCA 3FGMA 3WINA 1BFFA 2Y9WC 1FWUA 2VXRA 1DIWA 4I4QA 5BXPA 4D8HA 3POKA 4XFTA 1A8DA 1CVSA 4OWKA 4L4HA 1EYLA 2DS0A 2IHOA 41BIA 4QD2B 1YBIA 3NJ5A 1AVWB 1Z0HA 3ILAA 1IHKA 3WO4A 2LIEA 1PUMB 2QYIB 4OWJA 5I1BA 1BFCA 2VSEA 5BXRA 1VCLA 4QKSA 4XKIA 31BIA 1TTUA 2MIBA 1IRAX 1WD3A 3VT0A 2RG9B 4IY9A 1ONKB 1S0BA 2NTDA 1SR4A 1AVXB 4D0ZA 1DQOA 3P53A 3RTIB 3FJ9A 1Q04A 3KMVA 3PHZA 3O4OA 1J0SA 2VU9A 4KC3A 5EG6C 2P23A 4I6IA 6I1BA 1L2HA 3O4BA 4X38A 1ITBA 3FUQA 3AKGA 1WD4A 3JRRA 5DUYA 5BXTA 3Q7XA 2X2SA 1BARA 2F2FA 1JTCA 3O3QA 3T8SA 4ISRA 3P6JA 2D23A 1R8NA 4I8MA 1AXMA 2NZ9A 4KEIA 5BOWA 3OJVA 1T9FA 3QR5A 1FMZA 1ISVA 3AJ6A 3S8JA 4JRAA 4DCKC 3BADA 4DEPA 4J2SA 2L5XA 4LO0C 2GO2A 3N7JA 3Q7WA 3H6RA 4ZA3B 3BRGC 3O5WB 4IYBA 4IZXA 2D22A 1TP0A 4KEJA 3OGGA 4I7IA 3V0BB 3LTQA 4P0JA 1RZOB 4GOYA 1Q1UA 1KNMA 3C9ZA 2KLLA 5EHAA 4J2XA 4I4PA 4JP0A 3H6QA 1AF9A 2E4MC 4P6AA 3VUOA 3WA1A 4ZOTA 2IWTB 1JY0A 4I4SA 1IJTA 3FJCA 4G6JA 4HJJA 5GAQA 1IT0A 1HWMB 4LO8B 1MD6A 3CRGA 2F8XC 2NVHA 3AKIA 1HWPB 3TC2A 2UUSA 3H6RB 1TIEA 4G6MA 2KKIA 3MPPG 3OGFA 1K5VA 3FJBA 2I1BA 4LO7C 5FZYA 2K4AB 1V6UA 2Q9XA 4J23B 1HCDA 4OEGA 1Z2VA 4JAWA 3VSZA 2KH2A 1II4A 4F83A 3UD7A 3PG0A 1FN0A 1ISXA 4LO0A 1XG6A 1JLXA 3FJ8A 4ZBVB 4Z9WB 2FDBM 3V0AA 4JPZA 1F31A 4QO3A 4I4UA 4GOVA 1Q03A 1R8OA 1MC9A 1RY7A 2D44A 1EPWA 4QALA 3JUTA 4CJMA 1S0LA 4OEEA 3F62B 1TWMA 3CRHA 1JT5A 1JLYA
chains in the Genus database with same CATH superfamily
4DENA 4GP3A 3FJHA 4ZKTB 5DVHA 2DRYA 3H6SE 3ZXGA 2FFUA 2E4MA 4FVVA 2ESUA 3V0BA 2BEAA 1BASA 2FO1A 1RMLA 1W3AA 1I1EA 1YTOA 3FJDA 3W9TA 1FWVA 3B9UA 5D63A 1T4QA 2ZR1B 4EKXB 1BFBA 3FJEA 2K43A 2J3PA 3O49A 5BVPI 1HKNA 1PC8B 4XFSA 4QBCA 2ZQOA 1S0FA 3HN1A 2DREA 1AVUA 4A7ZA 2RQ9A 3BTAA 3RTJB 1DLLA 4I4OA 4OUJA 3FJIA 1G9CA 3V0AB 4ZFUB 4OEFA 4EEEB 3O4AA 1FV2A 5DSSB 3O4DA 2NP0A 1WBCA 4I0YA 1UPSA 2K8RA 3FJKA 1IOBA 3NBCA 5G00A 3A21A 3HALA 4ISQA 2ERMA 1JT7A 1D0HA 4OW4A 2Y9GA 1HWNB 2D7IA 5BXSA 2NS2A 4FGFA 3VWCA 1YXWA 3AKHA 2MC2A 3BA4A 2AQZA 2VXTI 1W3FA 5B2HA 1G9AA 1G82A 3OJMA 4LO2C 4A7YA 2NM1A 3ZC8A 3A07A 4LO3C 4I3NA 4A7KA 5FNXA 4YOLA 1RG8A 3BAQA 3RMXA 3N7MA 1S0EA 4ZFYB 3BB2A 3CA3A 3N7KA 1BLAA 1QQKA 1YF8B 2D1ZA 1S0DA 3FJFA 3OBRA 5F8SA 1EV2A 3UJ4A 2GZBA 3VSFA 5JMCA 4EB2B 1K5UA 2ZQNA 3RMYA 2Z48A 1DJSB 4IHZA 3E8LC 3F1RA 4LO7B 5D62A 4G1RA 4P0LA 1YYNA 3BA7A 3MALA 2R9KB 2FGFA 3PUBA 3I29B 4MZFB 5JLVA 2BFHA 4G9MA 4I4YA 4I37A 1PZZA 4X3AA 1SR4C 4ZLBB 3A23A 4LO1C 3BAHA 2HZ9A 1NUNA 5BQUC 3AH2A 1FMMS 2KI4A 3BRFA 2AAIB 1V6VA 3I2XA 3FFZA 1DQGA 1HIBA 2F2FC 3FJJA 1BFGA 2WRYA 4QBVA 3D7WB 1JQZA 1EVTA 3OJ2A 4XFUA 3I2AA 1XHBA 1JT4A 4AN7B 3O44A 3UD9A 3N0KA 1IRPA 3Q7YA 3CRIA 3PMEA 4OWLA 1GGPB 5F8YA 3O4CA 1V6XA 5DZUA 2VSAA 4LO2A 1CE7B 2P39A 2YUGA 8I1BA 4ENDA 3NBNA 2RSTA 3NBDA 4LO3A 2HWMA 3HMYA 7I1BA 2AFGA 4AN6A 1WBAA 1M2TB 2QN4A 4IY8A 5F90A 3NBEA 3WMVA 3EF2A 2NYYA 4JKQA 1TWEA 2MLLB 2Z49A 1FQ9A 3BRDA 3WO3A 1JT3A 3R4SA 1XYFA 1S0CA 9ILBA 2WBCA 5F8WA 4MZGB 3N7LA 1ILR1 1TOOA 4EFPA 4QD2C 1DFQA 4KBBA 2D7RA 4JKXB 4D0TA 3A22A 1V6WA 3ZXDA 1XZZA 2HW9A 1ISWA 1S0GA 4X37A 1NZKA 4USOA 4PC4A 4H04A 4G9NA 21BIA 4LO1A 5BQUA 3AZVA 2DRZA 3BAGA 2ET2A 2VUAA 3CA6A 4II0A 3CAHA 4EFRA 3V79C 4I4VA 2Y9FA 3BAOA 1G9DA 1SZ6B 4I1EA 5BP5C 4KEKA 3AH4A 3AH1A 3BAUA 3P6IA 1HWOB 1P63A 1QXMA 4I2SA 4F34A 1HCEA 3K1XA 3CQAA 4USPA 4P0KA 3FUOA 3HSMA 3QYDA 1IILA 5FZUA 3AJ5A 4X39A 3IAGC 1QQLA 5HPZA 1G9BA 3CA4A 3OBTA 3WINC 3BX1C 3UDAA 4I4RA 4EFQA 4GAIA 3VEQA 1PUUB 3LLPA 3IIRA 3ZX7A 3S8KA 4IQPA 2Q3NB 2HWAA 3ZC9A 4I96A 5FZZA 3CA5A 3CA0A 4QC4A 2AXMA 1DZCA 4R6UB 3AZWA 4ZFWB 4HA2A 3CA1A 1M16A 1PWAA 2M49A 4WBCA 4IONA 3BA5A 4QKRA 5D61A 4IZEA 1E0OA 5E24E 1AFCA 1TFMB 1BA7A 3WO2A 5FNWA 4ZGRB 2XOAA 3CU1B 3IM5A 4Z8SB 4GAFA 3RSJA 4H9WA 4GP0A 1N4KA 1AVAC 3VT2A 1ISZA 3R4UA 1ABRB 2D43A 2KI6B 3SNVA 3UD8A 2D24A 3UJ0A 1W3GA 2BEBA 1FGAA 3AKFA 2VLCA 1FV3A 4J2YA 4Q91A 4I1BA 1Z4SA 4TLPA 2Y9XE 4J2KA 4I4XA 1I1BA 4Q9PA 1OQLB 3WMUA 3VT1A 2LIQA 5BP5A 3BAVA 1BLDA 2FFVA 4UY4A 3HOMA 5EC5A 3IM7A 3IM6A 2X2TA 3FJAA 3HBWA 1ISYA 4JQ0A 4Q9GA 4HR6C 1DZDA 2D20A 4L4IA 1DFCA 3FGMA 3WINA 1BFFA 2Y9WC 1FWUA 2VXRA 1DIWA 4I4QA 5BXPA 4D8HA 3POKA 4XFTA 1A8DA 1CVSA 4OWKA 4L4HA 1EYLA 2DS0A 2IHOA 41BIA 4QD2B 1YBIA 3NJ5A 1AVWB 1Z0HA 3ILAA 1IHKA 3WO4A 2LIEA 1PUMB 2QYIB 4OWJA 5I1BA 1BFCA 2VSEA 5BXRA 1VCLA 4QKSA 4XKIA 31BIA 1TTUA 2MIBA 1IRAX 1WD3A 3VT0A 2RG9B 4IY9A 1ONKB 1S0BA 2NTDA 1SR4A 1AVXB 4D0ZA 1DQOA 3P53A 3RTIB 3FJ9A 1Q04A 3KMVA 3PHZA 3O4OA 1J0SA 2VU9A 4KC3A 5EG6C 2P23A 4I6IA 6I1BA 1L2HA 3O4BA 4X38A 1ITBA 3FUQA 3AKGA 1WD4A 3JRRA 5DUYA 5BXTA 3Q7XA 2X2SA 1BARA 2F2FA 1JTCA 3O3QA 3T8SA 4ISRA 3P6JA 2D23A 1R8NA 4I8MA 1AXMA 2NZ9A 4KEIA 5BOWA 3OJVA 1T9FA 3QR5A 1FMZA 1ISVA 3AJ6A 3S8JA 4JRAA 4DCKC 3BADA 4DEPA 4J2SA 2L5XA 4LO0C 2GO2A 3N7JA 3Q7WA 3H6RA 4ZA3B 3BRGC 3O5WB 4IYBA 4IZXA 2D22A 1TP0A 4KEJA 3OGGA 4I7IA 3V0BB 3LTQA 4P0JA 1RZOB 4GOYA 1Q1UA 4H75A 1KNMA 3C9ZA 2KLLA 5EHAA 4J2XA 4I4PA 4JP0A 3H6QA 1AF9A 2E4MC 4P6AA 3VUOA 3WA1A 4ZOTA 2IWTB 1JY0A 4I4SA 1IJTA 3FJCA 4G6JA 4HJJA 5GAQA 1IT0A 1HWMB 4LO8B 1MD6A 3CRGA 2F8XC 2NVHA 3AKIA 1HWPB 3TC2A 2UUSA 3H6RB 1TIEA 4G6MA 2KKIA 3MPPG 3OGFA 1K5VA 3FJBA 2I1BA 4LO7C 5FZYA 2K4AB 1V6UA 2Q9XA 4J23B 1HCDA 4OEGA 1Z2VA 4JAWA 3VSZA 2KH2A 1II4A 4F83A 4MZHA 3UD7A 3PG0A 1FN0A 1ISXA 4LO0A 1XG6A 1JLXA 3FJ8A 4ZBVB 4Z9WB 2FDBM 3V0AA 4JPZA 1F31A 4QO3A 4I4UA 4GOVA 1Q03A 1R8OA 1MC9A 1RY7A 2D44A 1EPWA 4QALA 3JUTA 4CJMA 1S0LA 4OEEA 3F62B 1TWMA 3CRHA 1JT5A 1JLYA
chains in the Genus database with same CATH topology
4DENA 4GP3A 3FJHA 4ZKTB 5DVHA 2DRYA 3H6SE 3ZXGA 2FFUA 2E4MA 4FVVA 2ESUA 3V0BA 2BEAA 1BASA 2FO1A 1RMLA 1W3AA 1I1EA 1YTOA 3FJDA 3W9TA 1FWVA 3B9UA 5D63A 1T4QA 2ZR1B 4EKXB 1BFBA 3FJEA 2K43A 2J3PA 3O49A 5BVPI 1HKNA 1PC8B 4XFSA 4QBCA 2ZQOA 1S0FA 3HN1A 2DREA 1AVUA 4A7ZA 2RQ9A 3BTAA 3RTJB 1DLLA 4I4OA 4OUJA 3FJIA 1G9CA 3V0AB 4ZFUB 4OEFA 4EEEB 3O4AA 1FV2A 5DSSB 3O4DA 2NP0A 1WBCA 4I0YA 1UPSA 2K8RA 3FJKA 1IOBA 3NBCA 5G00A 3A21A 3HALA 4ISQA 2ERMA 1JT7A 1D0HA 4OW4A 2Y9GA 1HWNB 2D7IA 5BXSA 2NS2A 4FGFA 3VWCA 1YXWA 3AKHA 2MC2A 3BA4A 2AQZA 2VXTI 1W3FA 5B2HA 1G9AA 1G82A 3OJMA 4LO2C 4A7YA 2NM1A 3ZC8A 3A07A 4LO3C 4I3NA 4A7KA 5FNXA 4YOLA 1RG8A 3BAQA 3RMXA 3N7MA 1S0EA 4ZFYB 3BB2A 3CA3A 3N7KA 1BLAA 1QQKA 1YF8B 2D1ZA 1S0DA 3FJFA 3OBRA 5F8SA 1EV2A 3UJ4A 2GZBA 3VSFA 5JMCA 4EB2B 1K5UA 2ZQNA 3RMYA 2Z48A 1DJSB 4IHZA 3E8LC 3F1RA 4LO7B 5D62A 4G1RA 4P0LA 1YYNA 3BA7A 3MALA 2R9KB 2FGFA 3PUBA 3I29B 4MZFB 5JLVA 2BFHA 4G9MA 4I4YA 4I37A 1PZZA 4X3AA 1SR4C 4ZLBB 3A23A 4LO1C 3BAHA 2HZ9A 1NUNA 5BQUC 3AH2A 1FMMS 2KI4A 3BRFA 2AAIB 1V6VA 3I2XA 3FFZA 1DQGA 1HIBA 2F2FC 3FJJA 1BFGA 2WRYA 4QBVA 3D7WB 1JQZA 1EVTA 3OJ2A 4XFUA 3I2AA 1XHBA 1JT4A 4AN7B 3O44A 3UD9A 3N0KA 1IRPA 3Q7YA 3CRIA 3PMEA 4OWLA 1GGPB 5F8YA 3O4CA 1V6XA 5DZUA 2VSAA 4LO2A 1CE7B 2P39A 2YUGA 8I1BA 4ENDA 3NBNA 2RSTA 3NBDA 4LO3A 2HWMA 3HMYA 7I1BA 2AFGA 4AN6A 1WBAA 1M2TB 2QN4A 4IY8A 5F90A 3NBEA 3WMVA 3EF2A 2NYYA 4JKQA 1TWEA 2MLLB 2Z49A 1FQ9A 3BRDA 3WO3A 1JT3A 3R4SA 1XYFA 1S0CA 9ILBA 2WBCA 5F8WA 4MZGB 3N7LA 1ILR1 1TOOA 4EFPA 4QD2C 1DFQA 4KBBA 2D7RA 4JKXB 4D0TA 3A22A 1V6WA 3ZXDA 1XZZA 2HW9A 1ISWA 1S0GA 4X37A 1NZKA 4USOA 4PC4A 4H04A 4G9NA 21BIA 4LO1A 5BQUA 3AZVA 2DRZA 3BAGA 2ET2A 2VUAA 3CA6A 4II0A 3CAHA 4EFRA 3V79C 4I4VA 2Y9FA 3BAOA 1G9DA 1SZ6B 4I1EA 5BP5C 4KEKA 3AH4A 3AH1A 3BAUA 3P6IA 1HWOB 1P63A 1QXMA 4I2SA 4F34A 1HCEA 3K1XA 3CQAA 4USPA 4P0KA 3FUOA 3HSMA 3QYDA 1IILA 5FZUA 3AJ5A 4X39A 3IAGC 1QQLA 5HPZA 1G9BA 3CA4A 3OBTA 3WINC 3BX1C 3UDAA 4I4RA 4EFQA 4GAIA 3VEQA 1PUUB 3LLPA 3IIRA 3ZX7A 3S8KA 4IQPA 2Q3NB 2HWAA 3ZC9A 4I96A 5FZZA 3CA5A 3CA0A 4QC4A 2AXMA 1DZCA 4R6UB 3AZWA 4ZFWB 4HA2A 3CA1A 1M16A 1PWAA 2M49A 4WBCA 4IONA 3BA5A 4QKRA 5D61A 4IZEA 1E0OA 5E24E 1AFCA 1TFMB 1BA7A 3WO2A 5FNWA 4ZGRB 2XOAA 3CU1B 3IM5A 4Z8SB 4GAFA 3RSJA 4H9WA 4GP0A 1N4KA 1AVAC 3VT2A 1ISZA 3R4UA 1ABRB 2D43A 2KI6B 3SNVA 3UD8A 2D24A 3UJ0A 1W3GA 2BEBA 1FGAA 3AKFA 2VLCA 1FV3A 4J2YA 4Q91A 4I1BA 1Z4SA 4TLPA 2Y9XE 4J2KA 4I4XA 1I1BA 4Q9PA 1OQLB 3WMUA 3VT1A 2LIQA 5BP5A 3BAVA 1BLDA 2FFVA 4UY4A 3HOMA 5EC5A 3IM7A 3IM6A 2X2TA 3FJAA 3HBWA 1ISYA 4JQ0A 4Q9GA 4HR6C 1DZDA 2D20A 4L4IA 1DFCA 3FGMA 3WINA 1BFFA 2Y9WC 1FWUA 2VXRA 1DIWA 4I4QA 5BXPA 4D8HA 3POKA 4XFTA 1A8DA 1CVSA 4OWKA 4L4HA 1EYLA 2DS0A 2IHOA 41BIA 4QD2B 1YBIA 3NJ5A 1AVWB 1Z0HA 3ILAA 1IHKA 3WO4A 2LIEA 1PUMB 2QYIB 4OWJA 5I1BA 1BFCA 2VSEA 5BXRA 1VCLA 4QKSA 4XKIA 31BIA 1TTUA 2MIBA 1IRAX 1WD3A 3VT0A 2RG9B 4IY9A 1ONKB 1S0BA 2NTDA 1SR4A 1AVXB 4D0ZA 1DQOA 3P53A 3RTIB 3FJ9A 1Q04A 3KMVA 3PHZA 3O4OA 1J0SA 2VU9A 4KC3A 5EG6C 2P23A 4I6IA 6I1BA 1L2HA 3O4BA 4X38A 1ITBA 3FUQA 3AKGA 1WD4A 3JRRA 5DUYA 5BXTA 3Q7XA 2X2SA 1BARA 2F2FA 1JTCA 3O3QA 3T8SA 4ISRA 3P6JA 2D23A 1R8NA 4I8MA 1AXMA 2NZ9A 4KEIA 5BOWA 3OJVA 1T9FA 3QR5A 1FMZA 1ISVA 3AJ6A 3S8JA 4JRAA 4DCKC 3BADA 4DEPA 4J2SA 2L5XA 4LO0C 2GO2A 3N7JA 3Q7WA 3H6RA 4ZA3B 3BRGC 3O5WB 4IYBA 4IZXA 2D22A 1TP0A 4KEJA 3OGGA 4I7IA 3V0BB 3LTQA 4P0JA 1RZOB 4GOYA 1Q1UA 4H75A 1KNMA 3C9ZA 2KLLA 5EHAA 4J2XA 4I4PA 4JP0A 3H6QA 1AF9A 2E4MC 4P6AA 3VUOA 3WA1A 4ZOTA 2IWTB 1JY0A 4I4SA 1IJTA 3FJCA 4G6JA 4HJJA 5GAQA 1IT0A 1HWMB 4LO8B 1MD6A 3CRGA 2F8XC 2NVHA 3AKIA 1HWPB 3TC2A 2UUSA 3H6RB 1TIEA 4G6MA 2KKIA 3MPPG 3OGFA 1K5VA 3FJBA 2I1BA 4LO7C 5FZYA 2K4AB 1V6UA 2Q9XA 4J23B 1HCDA 4OEGA 1Z2VA 4JAWA 3VSZA 2KH2A 1II4A 4F83A 4MZHA 3UD7A 3PG0A 1FN0A 1ISXA 4LO0A 1XG6A 1JLXA 3FJ8A 4ZBVB 4Z9WB 2FDBM 3V0AA 4JPZA 1F31A 4QO3A 4I4UA 4GOVA 1Q03A 1R8OA 1MC9A 1RY7A 2D44A 1EPWA 4QALA 3JUTA 4CJMA 1S0LA 4OEEA 3F62B 1TWMA 3CRHA 1JT5A 1JLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DEN A;  4GP3 A;  3FJH A;  4ZKT B;  5DVH A;  2DRY A;  3H6S E;  3ZXG A;  2FFU A;  2E4M A;  4FVV A;  2ESU A;  3V0B A;  2BEA A;  1BAS A;  2FO1 A;  1RML A;  1W3A A;  1I1E A;  1YTO A;  3FJD A;  3W9T A;  1FWV A;  3B9U A;  5D63 A;  1T4Q A;  2ZR1 B;  4EKX B;  1BFB A;  3FJE A;  2K43 A;  2J3P A;  3O49 A;  5BVP I;  1HKN A;  1PC8 B;  4XFS A;  4QBC A;  2ZQO A;  1S0F A;  3HN1 A;  2DRE A;  1AVU A;  4A7Z A;  2RQ9 A;  3BTA A;  3RTJ B;  1DLL A;  4I4O A;  4OUJ A;  3FJI A;  1G9C A;  3V0A B;  4ZFU B;  4OEF A;  4EEE B;  3O4A A;  1FV2 A;  5DSS B;  3O4D A;  2NP0 A;  1WBC A;  4I0Y A;  1UPS A;  2K8R A;  3FJK A;  1IOB A;  3NBC A;  5G00 A;  3A21 A;  3HAL A;  4ISQ A;  2ERM A;  1JT7 A;  1D0H A;  4OW4 A;  2Y9G A;  1HWN B;  2D7I A;  5BXS A;  4FGF A;  3VWC A;  1YXW A;  3AKH A;  2MC2 A;  3BA4 A;  2AQZ A;  2VXT I;  1W3F A;  5B2H A;  1G9A A;  1G82 A;  3OJM A;  4LO2 C;  4A7Y A;  2NM1 A;  3ZC8 A;  3A07 A;  4LO3 C;  4I3N A;  4A7K A;  5FNX A;  4YOL A;  1RG8 A;  3BAQ A;  3RMX A;  3N7M A;  1S0E A;  4ZFY B;  3BB2 A;  3CA3 A;  3N7K A;  1BLA A;  1QQK A;  1YF8 B;  2D1Z A;  1S0D A;  3FJF A;  3OBR A;  5F8S A;  1EV2 A;  3UJ4 A;  2GZB A;  3VSF A;  5JMC A;  4EB2 B;  1K5U A;  2ZQN A;  3RMY A;  2Z48 A;  1DJS B;  4IHZ A;  3E8L C;  3F1R A;  4LO7 B;  5D62 A;  4G1R A;  4P0L A;  1YYN A;  3BA7 A;  3MAL A;  2R9K B;  2FGF A;  3PUB A;  3I29 B;  5JLV A;  2BFH A;  4G9M A;  4I4Y A;  4I37 A;  1PZZ A;  4X3A A;  1SR4 C;  4ZLB B;  3A23 A;  4LO1 C;  3BAH A;  2HZ9 A;  1NUN A;  5BQU C;  3AH2 A;  1FMM S;  2KI4 A;  3BRF A;  2AAI B;  1V6V A;  3I2X A;  3FFZ A;  1DQG A;  1HIB A;  2F2F C;  3FJJ A;  1BFG A;  2WRY A;  4QBV A;  3D7W B;  1JQZ A;  1EVT A;  3OJ2 A;  4XFU A;  3I2A A;  1XHB A;  1JT4 A;  4AN7 B;  3O44 A;  3UD9 A;  3N0K A;  1IRP A;  3Q7Y A;  3CRI A;  3PME A;  4OWL A;  1GGP B;  5F8Y A;  3O4C A;  1V6X A;  5DZU A;  2VSA A;  4LO2 A;  1CE7 B;  2P39 A;  2YUG A;  8I1B A;  4END A;  3NBN A;  2RST A;  3NBD A;  4LO3 A;  2HWM A;  3HMY A;  7I1B A;  2AFG A;  4AN6 A;  1WBA A;  1M2T B;  2QN4 A;  4IY8 A;  5F90 A;  3NBE A;  3WMV A;  3EF2 A;  2NYY A;  4JKQ A;  1TWE A;  2MLL B;  2Z49 A;  1FQ9 A;  3BRD A;  3WO3 A;  1JT3 A;  3R4S A;  1XYF A;  1S0C A;  9ILB A;  2WBC A;  5F8W A;  3N7L A;  1ILR 1;  1TOO A;  4EFP A;  4QD2 C;  1DFQ A;  4KBB A;  2D7R A;  4JKX B;  4D0T A;  3A22 A;  1V6W A;  3ZXD A;  1XZZ A;  2HW9 A;  1ISW A;  1S0G A;  4X37 A;  1NZK A;  4USO A;  4PC4 A;  4H04 A;  4G9N A;  21BI A;  4LO1 A;  5BQU A;  3AZV A;  2DRZ A;  3BAG A;  2ET2 A;  2VUA A;  3CA6 A;  4II0 A;  3CAH A;  4EFR A;  3V79 C;  4I4V A;  2Y9F A;  3BAO A;  1G9D A;  1SZ6 B;  4I1E A;  5BP5 C;  4KEK A;  3AH4 A;  3AH1 A;  3BAU A;  3P6I A;  1HWO B;  1P63 A;  1QXM A;  4I2S A;  4F34 A;  1HCE A;  3K1X A;  3CQA A;  4USP A;  4P0K A;  3FUO A;  3HSM A;  3QYD A;  1IIL A;  5FZU A;  3AJ5 A;  4X39 A;  3IAG C;  1QQL A;  5HPZ A;  1G9B A;  3CA4 A;  3OBT A;  3WIN C;  3BX1 C;  3UDA A;  4I4R A;  4EFQ A;  4GAI A;  3VEQ A;  1PUU B;  3LLP A;  3IIR A;  3ZX7 A;  3S8K A;  4IQP A;  2Q3N B;  2HWA A;  3ZC9 A;  4I96 A;  5FZZ A;  3CA5 A;  3CA0 A;  4QC4 A;  2AXM A;  1DZC A;  4R6U B;  3AZW A;  4ZFW B;  4HA2 A;  3CA1 A;  1M16 A;  1PWA A;  2M49 A;  4WBC A;  4ION A;  3BA5 A;  4QKR A;  5D61 A;  4IZE A;  1E0O A;  5E24 E;  1AFC A;  1TFM B;  1BA7 A;  3WO2 A;  5FNW A;  4ZGR B;  2XOA A;  3CU1 B;  3IM5 A;  4Z8S B;  4GAF A;  3RSJ A;  4H9W A;  4GP0 A;  1N4K A;  1AVA C;  3VT2 A;  1ISZ A;  3R4U A;  1ABR B;  2D43 A;  2KI6 B;  3SNV A;  3UD8 A;  2D24 A;  3UJ0 A;  1W3G A;  2BEB A;  1FGA A;  3AKF A;  2VLC A;  1FV3 A;  4J2Y A;  4Q91 A;  4I1B A;  1Z4S A;  4TLP A;  2Y9X E;  4J2K A;  4I4X A;  1I1B A;  4Q9P A;  1OQL B;  3WMU A;  3VT1 A;  2LIQ A;  5BP5 A;  3BAV A;  1BLD A;  2FFV A;  3HOM A;  5EC5 A;  3IM7 A;  3IM6 A;  2X2T A;  3FJA A;  3HBW A;  1ISY A;  4JQ0 A;  4Q9G A;  4HR6 C;  1DZD A;  2D20 A;  4L4I A;  1DFC A;  3FGM A;  3WIN A;  1BFF A;  2Y9W C;  1FWU A;  2VXR A;  1DIW A;  4I4Q A;  5BXP A;  4D8H A;  3POK A;  4XFT A;  1A8D A;  1CVS A;  4OWK A;  4L4H A;  1EYL A;  2DS0 A;  2IHO A;  41BI A;  4QD2 B;  1YBI A;  3NJ5 A;  1AVW B;  1Z0H A;  3ILA A;  1IHK A;  3WO4 A;  2LIE A;  1PUM B;  2QYI B;  4OWJ A;  5I1B A;  1BFC A;  2VSE A;  5BXR A;  1VCL A;  4QKS A;  4XKI A;  31BI A;  1TTU A;  2MIB A;  1IRA X;  1WD3 A;  3VT0 A;  2RG9 B;  4IY9 A;  1ONK B;  1S0B A;  2NTD A;  1SR4 A;  1AVX B;  4D0Z A;  1DQO A;  3P53 A;  3RTI B;  3FJ9 A;  1Q04 A;  3KMV A;  3PHZ A;  3O4O A;  1J0S A;  2VU9 A;  4KC3 A;  5EG6 C;  2P23 A;  4I6I A;  6I1B A;  1L2H A;  3O4B A;  4X38 A;  1ITB A;  3FUQ A;  3AKG A;  1WD4 A;  3JRR A;  5DUY A;  5BXT A;  3Q7X A;  2X2S A;  1BAR A;  2F2F A;  1JTC A;  3O3Q A;  3T8S A;  4ISR A;  3P6J A;  2D23 A;  1R8N A;  4I8M A;  1AXM A;  2NZ9 A;  4KEI A;  5BOW A;  3OJV A;  1T9F A;  3QR5 A;  1FMZ A;  1ISV A;  3AJ6 A;  3S8J A;  4JRA A;  4DCK C;  3BAD A;  4DEP A;  4J2S A;  2L5X A;  4LO0 C;  2GO2 A;  3N7J A;  3Q7W A;  3H6R A;  4ZA3 B;  3BRG C;  3O5W B;  4IYB A;  4IZX A;  2D22 A;  1TP0 A;  4KEJ A;  3OGG A;  4I7I A;  3V0B B;  3LTQ A;  4P0J A;  1RZO B;  4GOY A;  1Q1U A;  1KNM A;  3C9Z A;  2KLL A;  5EHA A;  4J2X A;  4I4P A;  4JP0 A;  3H6Q A;  1AF9 A;  2E4M C;  4P6A A;  3VUO A;  3WA1 A;  4ZOT A;  2IWT B;  1JY0 A;  4I4S A;  1IJT A;  3FJC A;  4G6J A;  4HJJ A;  5GAQ A;  1IT0 A;  1HWM B;  4LO8 B;  1MD6 A;  3CRG A;  2F8X C;  2NVH A;  3AKI A;  1HWP B;  3TC2 A;  2UUS A;  3H6R B;  1TIE A;  4G6M A;  2KKI A;  3MPP G;  3OGF A;  1K5V A;  3FJB A;  2I1B A;  4LO7 C;  5FZY A;  2K4A B;  1V6U A;  2Q9X A;  4J23 B;  1HCD A;  4OEG A;  1Z2V A;  4JAW A;  3VSZ A;  2KH2 A;  1II4 A;  4F83 A;  3UD7 A;  3PG0 A;  1FN0 A;  1ISX A;  4LO0 A;  1XG6 A;  1JLX A;  3FJ8 A;  4ZBV B;  4Z9W B;  2FDB M;  3V0A A;  4JPZ A;  1F31 A;  4QO3 A;  4I4U A;  4GOV A;  1Q03 A;  1R8O A;  1MC9 A;  1RY7 A;  2D44 A;  1EPW A;  4QAL A;  3JUT A;  4CJM A;  1S0L A;  4OEE A;  3F62 B;  1TWM A;  3CRH A;  1JT5 A;  1JLY A; 
#chains in the Genus database with same CATH topology
 4DEN A;  4GP3 A;  3FJH A;  4ZKT B;  5DVH A;  2DRY A;  3H6S E;  3ZXG A;  2FFU A;  2E4M A;  4FVV A;  2ESU A;  3V0B A;  2BEA A;  1BAS A;  2FO1 A;  1RML A;  1W3A A;  1I1E A;  1YTO A;  3FJD A;  3W9T A;  1FWV A;  3B9U A;  5D63 A;  1T4Q A;  2ZR1 B;  4EKX B;  1BFB A;  3FJE A;  2K43 A;  2J3P A;  3O49 A;  5BVP I;  1HKN A;  1PC8 B;  4XFS A;  4QBC A;  2ZQO A;  1S0F A;  3HN1 A;  2DRE A;  1AVU A;  4A7Z A;  2RQ9 A;  3BTA A;  3RTJ B;  1DLL A;  4I4O A;  4OUJ A;  3FJI A;  1G9C A;  3V0A B;  4ZFU B;  4OEF A;  4EEE B;  3O4A A;  1FV2 A;  5DSS B;  3O4D A;  2NP0 A;  1WBC A;  4I0Y A;  1UPS A;  2K8R A;  3FJK A;  1IOB A;  3NBC A;  5G00 A;  3A21 A;  3HAL A;  4ISQ A;  2ERM A;  1JT7 A;  1D0H A;  4OW4 A;  2Y9G A;  1HWN B;  2D7I A;  5BXS A;  2NS2 A;  4FGF A;  3VWC A;  1YXW A;  3AKH A;  2MC2 A;  3BA4 A;  2AQZ A;  2VXT I;  1W3F A;  5B2H A;  1G9A A;  1G82 A;  3OJM A;  4LO2 C;  4A7Y A;  2NM1 A;  3ZC8 A;  3A07 A;  4LO3 C;  4I3N A;  4A7K A;  5FNX A;  4YOL A;  1RG8 A;  3BAQ A;  3RMX A;  3N7M A;  1S0E A;  4ZFY B;  3BB2 A;  3CA3 A;  3N7K A;  1BLA A;  1QQK A;  1YF8 B;  2D1Z A;  1S0D A;  3FJF A;  3OBR A;  5F8S A;  1EV2 A;  3UJ4 A;  2GZB A;  3VSF A;  5JMC A;  4EB2 B;  1K5U A;  2ZQN A;  3RMY A;  2Z48 A;  1DJS B;  4IHZ A;  3E8L C;  3F1R A;  4LO7 B;  5D62 A;  4G1R A;  4P0L A;  1YYN A;  3BA7 A;  3MAL A;  2R9K B;  2FGF A;  3PUB A;  3I29 B;  4MZF B;  5JLV A;  2BFH A;  4G9M A;  4I4Y A;  4I37 A;  1PZZ A;  4X3A A;  1SR4 C;  4ZLB B;  3A23 A;  4LO1 C;  3BAH A;  2HZ9 A;  1NUN A;  5BQU C;  3AH2 A;  1FMM S;  2KI4 A;  3BRF A;  2AAI B;  1V6V A;  3I2X A;  3FFZ A;  1DQG A;  1HIB A;  2F2F C;  3FJJ A;  1BFG A;  2WRY A;  4QBV A;  3D7W B;  1JQZ A;  1EVT A;  3OJ2 A;  4XFU A;  3I2A A;  1XHB A;  1JT4 A;  4AN7 B;  3O44 A;  3UD9 A;  3N0K A;  1IRP A;  3Q7Y A;  3CRI A;  3PME A;  4OWL A;  1GGP B;  5F8Y A;  3O4C A;  1V6X A;  5DZU A;  2VSA A;  4LO2 A;  1CE7 B;  2P39 A;  2YUG A;  8I1B A;  4END A;  3NBN A;  2RST A;  3NBD A;  4LO3 A;  2HWM A;  3HMY A;  7I1B A;  2AFG A;  4AN6 A;  1WBA A;  1M2T B;  2QN4 A;  4IY8 A;  5F90 A;  3NBE A;  3WMV A;  3EF2 A;  2NYY A;  4JKQ A;  1TWE A;  2MLL B;  2Z49 A;  1FQ9 A;  3BRD A;  3WO3 A;  1JT3 A;  3R4S A;  1XYF A;  1S0C A;  9ILB A;  2WBC A;  5F8W A;  4MZG B;  3N7L A;  1ILR 1;  1TOO A;  4EFP A;  4QD2 C;  1DFQ A;  4KBB A;  2D7R A;  4JKX B;  4D0T A;  3A22 A;  1V6W A;  3ZXD A;  1XZZ A;  2HW9 A;  1ISW A;  1S0G A;  4X37 A;  1NZK A;  4USO A;  4PC4 A;  4H04 A;  4G9N A;  21BI A;  4LO1 A;  5BQU A;  3AZV A;  2DRZ A;  3BAG A;  2ET2 A;  2VUA A;  3CA6 A;  4II0 A;  3CAH A;  4EFR A;  3V79 C;  4I4V A;  2Y9F A;  3BAO A;  1G9D A;  1SZ6 B;  4I1E A;  5BP5 C;  4KEK A;  3AH4 A;  3AH1 A;  3BAU A;  3P6I A;  1HWO B;  1P63 A;  1QXM A;  4I2S A;  4F34 A;  1HCE A;  3K1X A;  3CQA A;  4USP A;  4P0K A;  3FUO A;  3HSM A;  3QYD A;  1IIL A;  5FZU A;  3AJ5 A;  4X39 A;  3IAG C;  1QQL A;  5HPZ A;  1G9B A;  3CA4 A;  3OBT A;  3WIN C;  3BX1 C;  3UDA A;  4I4R A;  4EFQ A;  4GAI A;  3VEQ A;  1PUU B;  3LLP A;  3IIR A;  3ZX7 A;  3S8K A;  4IQP A;  2Q3N B;  2HWA A;  3ZC9 A;  4I96 A;  5FZZ A;  3CA5 A;  3CA0 A;  4QC4 A;  2AXM A;  1DZC A;  4R6U B;  3AZW A;  4ZFW B;  4HA2 A;  3CA1 A;  1M16 A;  1PWA A;  2M49 A;  4WBC A;  4ION A;  3BA5 A;  4QKR A;  5D61 A;  4IZE A;  1E0O A;  5E24 E;  1AFC A;  1TFM B;  1BA7 A;  3WO2 A;  5FNW A;  4ZGR B;  2XOA A;  3CU1 B;  3IM5 A;  4Z8S B;  4GAF A;  3RSJ A;  4H9W A;  4GP0 A;  1N4K A;  1AVA C;  3VT2 A;  1ISZ A;  3R4U A;  1ABR B;  2D43 A;  2KI6 B;  3SNV A;  3UD8 A;  2D24 A;  3UJ0 A;  1W3G A;  2BEB A;  1FGA A;  3AKF A;  2VLC A;  1FV3 A;  4J2Y A;  4Q91 A;  4I1B A;  1Z4S A;  4TLP A;  2Y9X E;  4J2K A;  4I4X A;  1I1B A;  4Q9P A;  1OQL B;  3WMU A;  3VT1 A;  2LIQ A;  5BP5 A;  3BAV A;  1BLD A;  2FFV A;  4UY4 A;  3HOM A;  5EC5 A;  3IM7 A;  3IM6 A;  2X2T A;  3FJA A;  3HBW A;  1ISY A;  4JQ0 A;  4Q9G A;  4HR6 C;  1DZD A;  2D20 A;  4L4I A;  1DFC A;  3FGM A;  3WIN A;  1BFF A;  2Y9W C;  1FWU A;  2VXR A;  1DIW A;  4I4Q A;  5BXP A;  4D8H A;  3POK A;  4XFT A;  1A8D A;  1CVS A;  4OWK A;  4L4H A;  1EYL A;  2DS0 A;  2IHO A;  41BI A;  4QD2 B;  1YBI A;  3NJ5 A;  1AVW B;  1Z0H A;  3ILA A;  1IHK A;  3WO4 A;  2LIE A;  1PUM B;  2QYI B;  4OWJ A;  5I1B A;  1BFC A;  2VSE A;  5BXR A;  1VCL A;  4QKS A;  4XKI A;  31BI A;  1TTU A;  2MIB A;  1IRA X;  1WD3 A;  3VT0 A;  2RG9 B;  4IY9 A;  1ONK B;  1S0B A;  2NTD A;  1SR4 A;  1AVX B;  4D0Z A;  1DQO A;  3P53 A;  3RTI B;  3FJ9 A;  1Q04 A;  3KMV A;  3PHZ A;  3O4O A;  1J0S A;  2VU9 A;  4KC3 A;  5EG6 C;  2P23 A;  4I6I A;  6I1B A;  1L2H A;  3O4B A;  4X38 A;  1ITB A;  3FUQ A;  3AKG A;  1WD4 A;  3JRR A;  5DUY A;  5BXT A;  3Q7X A;  2X2S A;  1BAR A;  2F2F A;  1JTC A;  3O3Q A;  3T8S A;  4ISR A;  3P6J A;  2D23 A;  1R8N A;  4I8M A;  1AXM A;  2NZ9 A;  4KEI A;  5BOW A;  3OJV A;  1T9F A;  3QR5 A;  1FMZ A;  1ISV A;  3AJ6 A;  3S8J A;  4JRA A;  4DCK C;  3BAD A;  4DEP A;  4J2S A;  2L5X A;  4LO0 C;  2GO2 A;  3N7J A;  3Q7W A;  3H6R A;  4ZA3 B;  3BRG C;  3O5W B;  4IYB A;  4IZX A;  2D22 A;  1TP0 A;  4KEJ A;  3OGG A;  4I7I A;  3V0B B;  3LTQ A;  4P0J A;  1RZO B;  4GOY A;  1Q1U A;  4H75 A;  1KNM A;  3C9Z A;  2KLL A;  5EHA A;  4J2X A;  4I4P A;  4JP0 A;  3H6Q A;  1AF9 A;  2E4M C;  4P6A A;  3VUO A;  3WA1 A;  4ZOT A;  2IWT B;  1JY0 A;  4I4S A;  1IJT A;  3FJC A;  4G6J A;  4HJJ A;  5GAQ A;  1IT0 A;  1HWM B;  4LO8 B;  1MD6 A;  3CRG A;  2F8X C;  2NVH A;  3AKI A;  1HWP B;  3TC2 A;  2UUS A;  3H6R B;  1TIE A;  4G6M A;  2KKI A;  3MPP G;  3OGF A;  1K5V A;  3FJB A;  2I1B A;  4LO7 C;  5FZY A;  2K4A B;  1V6U A;  2Q9X A;  4J23 B;  1HCD A;  4OEG A;  1Z2V A;  4JAW A;  3VSZ A;  2KH2 A;  1II4 A;  4F83 A;  4MZH A;  3UD7 A;  3PG0 A;  1FN0 A;  1ISX A;  4LO0 A;  1XG6 A;  1JLX A;  3FJ8 A;  4ZBV B;  4Z9W B;  2FDB M;  3V0A A;  4JPZ A;  1F31 A;  4QO3 A;  4I4U A;  4GOV A;  1Q03 A;  1R8O A;  1MC9 A;  1RY7 A;  2D44 A;  1EPW A;  4QAL A;  3JUT A;  4CJM A;  1S0L A;  4OEE A;  3F62 B;  1TWM A;  3CRH A;  1JT5 A;  1JLY A; 
#chains in the Genus database with same CATH homology
 4DEN A;  4GP3 A;  3FJH A;  4ZKT B;  5DVH A;  2DRY A;  3H6S E;  3ZXG A;  2FFU A;  2E4M A;  4FVV A;  2ESU A;  3V0B A;  2BEA A;  1BAS A;  2FO1 A;  1RML A;  1W3A A;  1I1E A;  1YTO A;  3FJD A;  3W9T A;  1FWV A;  3B9U A;  5D63 A;  1T4Q A;  2ZR1 B;  4EKX B;  1BFB A;  3FJE A;  2K43 A;  2J3P A;  3O49 A;  5BVP I;  1HKN A;  1PC8 B;  4XFS A;  4QBC A;  2ZQO A;  1S0F A;  3HN1 A;  2DRE A;  1AVU A;  4A7Z A;  2RQ9 A;  3BTA A;  3RTJ B;  1DLL A;  4I4O A;  4OUJ A;  3FJI A;  1G9C A;  3V0A B;  4ZFU B;  4OEF A;  4EEE B;  3O4A A;  1FV2 A;  5DSS B;  3O4D A;  2NP0 A;  1WBC A;  4I0Y A;  1UPS A;  2K8R A;  3FJK A;  1IOB A;  3NBC A;  5G00 A;  3A21 A;  3HAL A;  4ISQ A;  2ERM A;  1JT7 A;  1D0H A;  4OW4 A;  2Y9G A;  1HWN B;  2D7I A;  5BXS A;  2NS2 A;  4FGF A;  3VWC A;  1YXW A;  3AKH A;  2MC2 A;  3BA4 A;  2AQZ A;  2VXT I;  1W3F A;  5B2H A;  1G9A A;  1G82 A;  3OJM A;  4LO2 C;  4A7Y A;  2NM1 A;  3ZC8 A;  3A07 A;  4LO3 C;  4I3N A;  4A7K A;  5FNX A;  4YOL A;  1RG8 A;  3BAQ A;  3RMX A;  3N7M A;  1S0E A;  4ZFY B;  3BB2 A;  3CA3 A;  3N7K A;  1BLA A;  1QQK A;  1YF8 B;  2D1Z A;  1S0D A;  3FJF A;  3OBR A;  5F8S A;  1EV2 A;  3UJ4 A;  2GZB A;  3VSF A;  5JMC A;  4EB2 B;  1K5U A;  2ZQN A;  3RMY A;  2Z48 A;  1DJS B;  4IHZ A;  3E8L C;  3F1R A;  4LO7 B;  5D62 A;  4G1R A;  4P0L A;  1YYN A;  3BA7 A;  3MAL A;  2R9K B;  2FGF A;  3PUB A;  3I29 B;  4MZF B;  5JLV A;  2BFH A;  4G9M A;  4I4Y A;  4I37 A;  1PZZ A;  4X3A A;  1SR4 C;  4ZLB B;  3A23 A;  4LO1 C;  3BAH A;  2HZ9 A;  1NUN A;  5BQU C;  3AH2 A;  1FMM S;  2KI4 A;  3BRF A;  2AAI B;  1V6V A;  3I2X A;  3FFZ A;  1DQG A;  1HIB A;  2F2F C;  3FJJ A;  1BFG A;  2WRY A;  4QBV A;  3D7W B;  1JQZ A;  1EVT A;  3OJ2 A;  4XFU A;  3I2A A;  1XHB A;  1JT4 A;  4AN7 B;  3O44 A;  3UD9 A;  3N0K A;  1IRP A;  3Q7Y A;  3CRI A;  3PME A;  4OWL A;  1GGP B;  5F8Y A;  3O4C A;  1V6X A;  5DZU A;  2VSA A;  4LO2 A;  1CE7 B;  2P39 A;  2YUG A;  8I1B A;  4END A;  3NBN A;  2RST A;  3NBD A;  4LO3 A;  2HWM A;  3HMY A;  7I1B A;  2AFG A;  4AN6 A;  1WBA A;  1M2T B;  2QN4 A;  4IY8 A;  5F90 A;  3NBE A;  3WMV A;  3EF2 A;  2NYY A;  4JKQ A;  1TWE A;  2MLL B;  2Z49 A;  1FQ9 A;  3BRD A;  3WO3 A;  1JT3 A;  3R4S A;  1XYF A;  1S0C A;  9ILB A;  2WBC A;  5F8W A;  4MZG B;  3N7L A;  1ILR 1;  1TOO A;  4EFP A;  4QD2 C;  1DFQ A;  4KBB A;  2D7R A;  4JKX B;  4D0T A;  3A22 A;  1V6W A;  3ZXD A;  1XZZ A;  2HW9 A;  1ISW A;  1S0G A;  4X37 A;  1NZK A;  4USO A;  4PC4 A;  4H04 A;  4G9N A;  21BI A;  4LO1 A;  5BQU A;  3AZV A;  2DRZ A;  3BAG A;  2ET2 A;  2VUA A;  3CA6 A;  4II0 A;  3CAH A;  4EFR A;  3V79 C;  4I4V A;  2Y9F A;  3BAO A;  1G9D A;  1SZ6 B;  4I1E A;  5BP5 C;  4KEK A;  3AH4 A;  3AH1 A;  3BAU A;  3P6I A;  1HWO B;  1P63 A;  1QXM A;  4I2S A;  4F34 A;  1HCE A;  3K1X A;  3CQA A;  4USP A;  4P0K A;  3FUO A;  3HSM A;  3QYD A;  1IIL A;  5FZU A;  3AJ5 A;  4X39 A;  3IAG C;  1QQL A;  5HPZ A;  1G9B A;  3CA4 A;  3OBT A;  3WIN C;  3BX1 C;  3UDA A;  4I4R A;  4EFQ A;  4GAI A;  3VEQ A;  1PUU B;  3LLP A;  3IIR A;  3ZX7 A;  3S8K A;  4IQP A;  2Q3N B;  2HWA A;  3ZC9 A;  4I96 A;  5FZZ A;  3CA5 A;  3CA0 A;  4QC4 A;  2AXM A;  1DZC A;  4R6U B;  3AZW A;  4ZFW B;  4HA2 A;  3CA1 A;  1M16 A;  1PWA A;  2M49 A;  4WBC A;  4ION A;  3BA5 A;  4QKR A;  5D61 A;  4IZE A;  1E0O A;  5E24 E;  1AFC A;  1TFM B;  1BA7 A;  3WO2 A;  5FNW A;  4ZGR B;  2XOA A;  3CU1 B;  3IM5 A;  4Z8S B;  4GAF A;  3RSJ A;  4H9W A;  4GP0 A;  1N4K A;  1AVA C;  3VT2 A;  1ISZ A;  3R4U A;  1ABR B;  2D43 A;  2KI6 B;  3SNV A;  3UD8 A;  2D24 A;  3UJ0 A;  1W3G A;  2BEB A;  1FGA A;  3AKF A;  2VLC A;  1FV3 A;  4J2Y A;  4Q91 A;  4I1B A;  1Z4S A;  4TLP A;  2Y9X E;  4J2K A;  4I4X A;  1I1B A;  4Q9P A;  1OQL B;  3WMU A;  3VT1 A;  2LIQ A;  5BP5 A;  3BAV A;  1BLD A;  2FFV A;  4UY4 A;  3HOM A;  5EC5 A;  3IM7 A;  3IM6 A;  2X2T A;  3FJA A;  3HBW A;  1ISY A;  4JQ0 A;  4Q9G A;  4HR6 C;  1DZD A;  2D20 A;  4L4I A;  1DFC A;  3FGM A;  3WIN A;  1BFF A;  2Y9W C;  1FWU A;  2VXR A;  1DIW A;  4I4Q A;  5BXP A;  4D8H A;  3POK A;  4XFT A;  1A8D A;  1CVS A;  4OWK A;  4L4H A;  1EYL A;  2DS0 A;  2IHO A;  41BI A;  4QD2 B;  1YBI A;  3NJ5 A;  1AVW B;  1Z0H A;  3ILA A;  1IHK A;  3WO4 A;  2LIE A;  1PUM B;  2QYI B;  4OWJ A;  5I1B A;  1BFC A;  2VSE A;  5BXR A;  1VCL A;  4QKS A;  4XKI A;  31BI A;  1TTU A;  2MIB A;  1IRA X;  1WD3 A;  3VT0 A;  2RG9 B;  4IY9 A;  1ONK B;  1S0B A;  2NTD A;  1SR4 A;  1AVX B;  4D0Z A;  1DQO A;  3P53 A;  3RTI B;  3FJ9 A;  1Q04 A;  3KMV A;  3PHZ A;  3O4O A;  1J0S A;  2VU9 A;  4KC3 A;  5EG6 C;  2P23 A;  4I6I A;  6I1B A;  1L2H A;  3O4B A;  4X38 A;  1ITB A;  3FUQ A;  3AKG A;  1WD4 A;  3JRR A;  5DUY A;  5BXT A;  3Q7X A;  2X2S A;  1BAR A;  2F2F A;  1JTC A;  3O3Q A;  3T8S A;  4ISR A;  3P6J A;  2D23 A;  1R8N A;  4I8M A;  1AXM A;  2NZ9 A;  4KEI A;  5BOW A;  3OJV A;  1T9F A;  3QR5 A;  1FMZ A;  1ISV A;  3AJ6 A;  3S8J A;  4JRA A;  4DCK C;  3BAD A;  4DEP A;  4J2S A;  2L5X A;  4LO0 C;  2GO2 A;  3N7J A;  3Q7W A;  3H6R A;  4ZA3 B;  3BRG C;  3O5W B;  4IYB A;  4IZX A;  2D22 A;  1TP0 A;  4KEJ A;  3OGG A;  4I7I A;  3V0B B;  3LTQ A;  4P0J A;  1RZO B;  4GOY A;  1Q1U A;  4H75 A;  1KNM A;  3C9Z A;  2KLL A;  5EHA A;  4J2X A;  4I4P A;  4JP0 A;  3H6Q A;  1AF9 A;  2E4M C;  4P6A A;  3VUO A;  3WA1 A;  4ZOT A;  2IWT B;  1JY0 A;  4I4S A;  1IJT A;  3FJC A;  4G6J A;  4HJJ A;  5GAQ A;  1IT0 A;  1HWM B;  4LO8 B;  1MD6 A;  3CRG A;  2F8X C;  2NVH A;  3AKI A;  1HWP B;  3TC2 A;  2UUS A;  3H6R B;  1TIE A;  4G6M A;  2KKI A;  3MPP G;  3OGF A;  1K5V A;  3FJB A;  2I1B A;  4LO7 C;  5FZY A;  2K4A B;  1V6U A;  2Q9X A;  4J23 B;  1HCD A;  4OEG A;  1Z2V A;  4JAW A;  3VSZ A;  2KH2 A;  1II4 A;  4F83 A;  4MZH A;  3UD7 A;  3PG0 A;  1FN0 A;  1ISX A;  4LO0 A;  1XG6 A;  1JLX A;  3FJ8 A;  4ZBV B;  4Z9W B;  2FDB M;  3V0A A;  4JPZ A;  1F31 A;  4QO3 A;  4I4U A;  4GOV A;  1Q03 A;  1R8O A;  1MC9 A;  1RY7 A;  2D44 A;  1EPW A;  4QAL A;  3JUT A;  4CJM A;  1S0L A;  4OEE A;  3F62 B;  1TWM A;  3CRH A;  1JT5 A;  1JLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...