3NJ5A

Crystal structure of chicken il-1 hydrophobic cavity mutant 157
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
159
structure length
152
Chain Sequence
b'AFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQGPSSSQKVRLNIALYRPRGPQMPVALGIKGYKLYMSCVMSGTEPTLQLEEADVMRDIDSVELTRFIFYRLDSPTEGTTRFESAAFPGWFICTSLQPRQPVGITNQPDQVNIATFKLSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IL-1 beta
publication title Structural and functional comparison of cytokine interleukin-1 beta from chicken and human
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cytokine
total genus 30
structure length 152
sequence length 159
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3nj5A00
4ENDA 2NYYA 3I29B 1HIBA 3OGFA 1VCLA 2AFGA 9ILBA 2Y9XE 1ISVA 2K4AB 3UD8A 1UPSA 3TC2A 4CJMA 3HN1A 3NBEA 1EV2A 3UJ4A 2FFUA 3WA1A 1QXMA 2L5XA 1DZCA 3NBCA 5BXSA 2IHOA 4PC4A 5DVHA 4I8MA 4LO1A 2AXMA 3Q7XA 8I1BA 5DSSB 3UD7A 1PUUB 3A22A 3BAUA 4GAIA 2ZR1B 4P0LA 5F8YA 1DFCA 1Q04A 3KMVA 1PZZA 3BRDA 1JY0A 5F8SA 4A7ZA 1OQLB 4I4OA 4ZFYB 4ZFWB 4H9WA 4JPZA 4I4UA 2D20A 1M2TB 3K1XA 3RMYA 5BP5C 3CA1A 3AZWA 1L2HA 2KI4A 5G00A 4J2KA 1EPWA 2DS0A 1XHBA 4AN7B 3N7LA 1W3FA 3CRHA 3WO4A 1BARA 3ZXGA 1S0CA 1N4KA 3CAHA 1J0SA 1YTOA 1PWAA 3NBNA 4I37A 4KEKA 3AKIA 2VXRA 5FZZA 1HKNA 4I6IA 1SR4A 4Q9GA 4TLPA 2D1ZA 3T8SA 4XKIA 4QBVA 4D8HA 1JT3A 1YF8B 4L4HA 3CA0A 1W3GA 3QYDA 4I1BA 3WINA 5BOWA 4L4IA 1EVTA 1TTUA 4X39A 4EFPA 4I4XA 1S0FA 1ISWA 4LO7B 4JRAA 1A8DA 1E0OA 1TOOA 3FJ8A 1BA7A 1JT4A 2BEAA 3RSJA 1IRPA 1G9AA 3FJDA 3HMYA 4I4QA 4D0TA 1ONKB 3AKFA 1FQ9A 3OGGA 4EFQA 2VUAA 4JKQA 2NTDA 3IM6A 3VSZA 1RG8A 3LTQA 1V6VA 3N7JA 4Z8SB 1V6WA 3BRFA 2KH2A 3W9TA 4JKXB 3CA6A 2VXTI 4EFRA 4J2SA 5D62A 2NP0A 6I1BA 4LO0C 4OW4A 1YXWA 2NVHA 2DREA 5FNWA 3VT0A 1G82A 2WRYA 2RSTA 1IRAX 3FJKA 1FMZA 1AVUA 2P23A 3AH1A 4YOLA 3NJ5A 41BIA 3RTJB 3BRGC 4Z9WB 1ISZA 1BFFA 2KI6B 2Q3NB 4QKSA 2ZQOA 3AJ5A 1XG6A 1PUMB 1QQKA 1Z4SA 1DLLA 3FJIA 3A07A 1BFBA 1RMLA 1BFGA 1TWMA 3FUOA 3BTAA 3IIRA 4XFUA 2ESUA 4XFTA 4G9NA 1BFCA 1IT0A 3EF2A 4JAWA 4OEFA 1KNMA 4DEPA 4I0YA 4ZFUB 1GGPB 1Q03A 4HJJA 4OWJA 3A21A 4FVVA 3CU1B 3BA4A 1S0DA 1CVSA 3E8LC 1AXMA 3S8KA 4GAFA 4ZOTA 4D0ZA 3AH4A 3ZC8A 1YYNA 4IONA 3P53A 5FZYA 3PUBA 4QD2B 3B9UA 2FGFA 3BAHA 5DUYA 2NM1A 1ISYA 4DCKC 1P63A 2FDBM 1Z0HA 1DJSB 1R8NA 4IY8A 2FO1A 2QN4A 4IY9A 1AF9A 1V6UA 1AFCA 1SZ6B 1MC9A 1ISXA 31BIA 3CA3A 4G1RA 5D63A 4KBBA 3JUTA 3BAGA 1DQGA 4I3NA 1S0BA 1S0LA 3H6SE 2Z48A 3AH2A 5HPZA 4I4VA 3SNVA 4GOYA 4KEIA 2P39A 4II0A 3O4OA 7I1BA 3LLPA 2RQ9A 2BEBA 1G9BA 1IOBA 4EB2B 4LO3A 4ZGRB 3BB2A 4OWKA 2I1BA 4QO3A 2Y9FA 4X37A 3HSMA 1TWEA 5BVPI 5B2HA 2D22A 4WBCA 3PHZA 1WD4A 2M49A 4LO0A 3ILAA 3PMEA 4X3AA 5BXPA 5BXRA 1AVXB 3FJEA 2BFHA 1DIWA 3O44A 4AN6A 4X38A 2R9KB 3JRRA 3OJVA 5GAQA 4DENA 3HBWA 1PC8B 3BA5A 1HCDA 3MPPG 1JT7A 4I4RA 4LO2C 2HZ9A 2FFVA 3FJCA 1BASA 3Q7YA 3RMXA 2X2SA 3WMUA 2IWTB 4QD2C 2ERMA 4OEGA 4EKXB 1NZKA 4GOVA 2D7IA 4I4YA 2NZ9A 5BXTA 3FJBA 2D44A 4IYBA 1AVWB 3VT1A 1Q1UA 1JQZA 2GO2A 1V6XA 2D7RA 1ITBA 2VU9A 4A7YA 1FWVA 1DZDA 3FJFA 4JP0A 2MIBA 1FWUA 1WBAA 1HCEA 2VSEA 3P6IA 1G9DA 3CRIA 3HALA 1BLAA 2K43A 1MD6A 3V79C 2D23A 2K8RA 4ISQA 4QC4A 3BADA 3UD9A 1XYFA 4IZEA 4I96A 1ABRB 2F2FC 5BQUC 1JLYA 3AZVA 1NUNA 1EYLA 2HW9A 3ZX7A 5E24E 5EG6C 3AKGA 2D43A 3P6JA 5BP5A 2E4MC 5D61A 3RTIB 1TFMB 1WBCA 2HWAA 4QBCA 1M16A 4I4PA 2WBCA 3FJJA 1AVAC 3V0BA 1F31A 2D24A 4LO7C 1HWMB 3O4CA 5F8WA 4ZKTB 3H6RA 3S8JA 2Q9XA 4IHZA 4EEEB 1FV3A 2GZBA 2RG9B 3WO2A 5F90A 4QKRA 1CE7B 5JMCA 4Q91A 1XZZA 3OBTA 4XFSA 1W3AA 3N7KA 1FMMS 1DFQA 1HWNB 4USOA 3OBRA 3VEQA 3V0AA 3BAOA 3O5WB 2DRZA 1HWPB 3UDAA 4H04A 2XOAA 1D0HA 4USPA 4P0JA 4J23B 4HR6C 4I7IA 4I4SA 1HWOB 3R4SA 2LIQA 3POKA 3OJMA 3AJ6A 4I1EA 5DZUA 4ZBVB 3O4BA 4G6MA 2KKIA 4HA2A 3I2AA 3O4DA 2ET2A 3O4AA 2Z49A 2ZQNA 4FGFA 4G6JA 4IZXA 1FGAA 4KC3A 1R8OA 1I1EA 5I1BA 3F62B 3HOMA 1IHKA 3AKHA 2VLCA 4LO8B 5EC5A 1FN0A 4LO1C 4A7KA 1IILA 1RY7A 2Y9GA 3CQAA 3FJHA 4F83A 3A23A 3C9ZA 5FNXA 1K5VA 3CA5A 3CA4A 4LO2A 1DQOA 21BIA 3UJ0A 4Q9PA 4F34A 3QR5A 3FJ9A 1ILR1 3R4UA 3WMVA 3BX1C 1QQLA 2HWMA 2MC2A 2UUSA 3IM7A 3FFZA 2Y9WC 3OJ2A 4OWLA 2MLLB 2LIEA 1TIEA 3O3QA 3VT2A 1II4A 3ZXDA 2X2TA 1WD3A 2DRYA 3FGMA 3ZC9A 1K5UA 1TP0A 1S0EA 3VUOA 1BLDA 4JQ0A 3N7MA 4G9MA 1T4QA 4IQPA 1IJTA 2F2FA 3BA7A 4OEEA 5BQUA 1JT5A 3VWCA 1Z2VA 4ZA3B 1YBIA 2F8XC 2AQZA 4P6AA 4ZLBB 1JLXA 4GP3A 5FZUA 4J2YA 1S0GA 1SR4C 4J2XA 4I2SA 2E4MA 3IAGC 3BAVA 3FJAA 1JTCA 2KLLA 3NBDA 2VSAA 1FV2A 4QALA 3BAQA 3O49A 1RZOB 4LO3C 4KEJA 3FUQA 1I1BA 3WINC 3PG0A 3F1RA 4ISRA 4P0KA 3D7WB 3H6QA 3VSFA 3WO3A 3V0BB 2YUGA 4R6UB 1G9CA 5EHAA 3MALA 3N0KA 3CRGA 3H6RB 2AAIB 2J3PA 5JLVA 3IM5A 4GP0A 4OUJA 1T9FA 3Q7WA 2QYIB 3I2XA 3V0AB
chains in the Genus database with same CATH superfamily
4ENDA 2NYYA 3I29B 1HIBA 3OGFA 1VCLA 2AFGA 9ILBA 2Y9XE 1ISVA 2K4AB 3UD8A 1UPSA 3TC2A 4CJMA 3HN1A 3NBEA 1EV2A 3UJ4A 2FFUA 3WA1A 1QXMA 2L5XA 1DZCA 3NBCA 5BXSA 2IHOA 4PC4A 5DVHA 4I8MA 4LO1A 2AXMA 3Q7XA 8I1BA 5DSSB 3UD7A 1PUUB 3A22A 3BAUA 4GAIA 2ZR1B 4P0LA 5F8YA 1DFCA 1Q04A 3KMVA 1PZZA 3BRDA 1JY0A 5F8SA 4A7ZA 1OQLB 4I4OA 4ZFYB 4ZFWB 4H9WA 4JPZA 4I4UA 2D20A 1M2TB 3K1XA 3RMYA 5BP5C 3CA1A 3AZWA 1L2HA 2KI4A 5G00A 4J2KA 1EPWA 2DS0A 1XHBA 4AN7B 3N7LA 1W3FA 3CRHA 3WO4A 1BARA 3ZXGA 1S0CA 1N4KA 3CAHA 1J0SA 1YTOA 1PWAA 3NBNA 4I37A 4KEKA 3AKIA 2VXRA 5FZZA 1HKNA 4I6IA 1SR4A 4Q9GA 4TLPA 2D1ZA 3T8SA 4XKIA 4QBVA 4D8HA 1JT3A 1YF8B 4L4HA 3CA0A 1W3GA 3QYDA 4I1BA 3WINA 5BOWA 4L4IA 1EVTA 1TTUA 4X39A 4EFPA 4I4XA 1S0FA 1ISWA 4LO7B 4JRAA 1A8DA 1E0OA 1TOOA 3FJ8A 1BA7A 1JT4A 2BEAA 3RSJA 1IRPA 1G9AA 3FJDA 3HMYA 4I4QA 4D0TA 1ONKB 3AKFA 1FQ9A 3OGGA 4EFQA 2VUAA 4JKQA 2NTDA 3IM6A 3VSZA 1RG8A 3LTQA 1V6VA 3N7JA 4Z8SB 1V6WA 3BRFA 2KH2A 3W9TA 4MZGB 4JKXB 3CA6A 2VXTI 4EFRA 4J2SA 5D62A 2NP0A 6I1BA 4LO0C 4OW4A 1YXWA 2NVHA 2DREA 5FNWA 3VT0A 1G82A 2WRYA 2RSTA 1IRAX 3FJKA 1FMZA 1AVUA 2P23A 3AH1A 4YOLA 3NJ5A 41BIA 3RTJB 3BRGC 4Z9WB 1ISZA 1BFFA 2KI6B 2Q3NB 4QKSA 2ZQOA 3AJ5A 1XG6A 1PUMB 1QQKA 1Z4SA 1DLLA 3FJIA 3A07A 1BFBA 1RMLA 1BFGA 1TWMA 3FUOA 3BTAA 3IIRA 4XFUA 2ESUA 4XFTA 4G9NA 1BFCA 1IT0A 3EF2A 4JAWA 4OEFA 1KNMA 4DEPA 4I0YA 4ZFUB 1GGPB 1Q03A 4HJJA 4OWJA 3A21A 4FVVA 3CU1B 3BA4A 1S0DA 1CVSA 3E8LC 1AXMA 3S8KA 4GAFA 4ZOTA 4D0ZA 3AH4A 3ZC8A 1YYNA 4UY4A 4IONA 3P53A 5FZYA 3PUBA 4QD2B 3B9UA 2FGFA 3BAHA 5DUYA 2NM1A 1ISYA 4DCKC 1P63A 2FDBM 1Z0HA 1DJSB 1R8NA 4IY8A 2FO1A 2QN4A 4IY9A 1AF9A 1V6UA 1AFCA 1SZ6B 1MC9A 1ISXA 31BIA 3CA3A 4G1RA 5D63A 4KBBA 3JUTA 3BAGA 1DQGA 4I3NA 1S0BA 1S0LA 3H6SE 2Z48A 3AH2A 5HPZA 4I4VA 3SNVA 4GOYA 4KEIA 2P39A 4II0A 3O4OA 7I1BA 3LLPA 2RQ9A 2BEBA 1G9BA 1IOBA 4EB2B 4LO3A 4ZGRB 3BB2A 4OWKA 2I1BA 4QO3A 2Y9FA 4X37A 3HSMA 1TWEA 5BVPI 5B2HA 2D22A 4WBCA 3PHZA 1WD4A 2M49A 4LO0A 3ILAA 3PMEA 4X3AA 5BXPA 5BXRA 1AVXB 3FJEA 2BFHA 1DIWA 3O44A 4AN6A 4X38A 2R9KB 3JRRA 3OJVA 5GAQA 4DENA 3HBWA 1PC8B 3BA5A 1HCDA 3MPPG 1JT7A 4I4RA 4LO2C 2HZ9A 2FFVA 3FJCA 1BASA 3Q7YA 3RMXA 2X2SA 3WMUA 2IWTB 4QD2C 2ERMA 4OEGA 4EKXB 1NZKA 4GOVA 2D7IA 4I4YA 2NZ9A 5BXTA 3FJBA 2D44A 4IYBA 1AVWB 3VT1A 1Q1UA 1JQZA 2GO2A 1V6XA 2D7RA 1ITBA 2VU9A 4A7YA 1FWVA 1DZDA 3FJFA 4JP0A 2MIBA 1FWUA 1WBAA 1HCEA 2VSEA 3P6IA 1G9DA 3CRIA 3HALA 1BLAA 2K43A 1MD6A 3V79C 2D23A 2K8RA 4ISQA 4QC4A 3BADA 3UD9A 1XYFA 4IZEA 4I96A 1ABRB 2F2FC 5BQUC 1JLYA 3AZVA 1NUNA 1EYLA 2HW9A 3ZX7A 5E24E 5EG6C 3AKGA 2D43A 3P6JA 5BP5A 2E4MC 5D61A 3RTIB 1TFMB 1WBCA 2HWAA 4QBCA 1M16A 4I4PA 2WBCA 3FJJA 1AVAC 3V0BA 1F31A 2D24A 4LO7C 1HWMB 3O4CA 5F8WA 4ZKTB 3H6RA 3S8JA 2Q9XA 4IHZA 4EEEB 1FV3A 2GZBA 2RG9B 3WO2A 5F90A 4QKRA 1CE7B 5JMCA 4Q91A 1XZZA 3OBTA 4XFSA 1W3AA 3N7KA 1FMMS 1DFQA 1HWNB 4USOA 3OBRA 3VEQA 3V0AA 3BAOA 3O5WB 2DRZA 1HWPB 3UDAA 4H04A 2XOAA 1D0HA 4USPA 4P0JA 4J23B 4HR6C 4I7IA 4I4SA 1HWOB 3R4SA 2LIQA 3POKA 3OJMA 3AJ6A 4I1EA 5DZUA 4ZBVB 3O4BA 4G6MA 2KKIA 4HA2A 3I2AA 3O4DA 2ET2A 3O4AA 2Z49A 2ZQNA 4FGFA 4G6JA 4IZXA 1FGAA 4KC3A 1R8OA 1I1EA 5I1BA 3F62B 3HOMA 1IHKA 3AKHA 4MZFB 2VLCA 4LO8B 5EC5A 1FN0A 4LO1C 4A7KA 1IILA 1RY7A 2Y9GA 3CQAA 3FJHA 4F83A 3A23A 3C9ZA 5FNXA 1K5VA 3CA5A 3CA4A 4LO2A 1DQOA 21BIA 3UJ0A 4Q9PA 4F34A 3QR5A 3FJ9A 1ILR1 3R4UA 3WMVA 3BX1C 1QQLA 2HWMA 2MC2A 2UUSA 3IM7A 3FFZA 2Y9WC 3OJ2A 4OWLA 2MLLB 2LIEA 1TIEA 3O3QA 3VT2A 1II4A 3ZXDA 2X2TA 1WD3A 2DRYA 3FGMA 3ZC9A 1K5UA 1TP0A 1S0EA 3VUOA 1BLDA 4JQ0A 3N7MA 4G9MA 1T4QA 4IQPA 1IJTA 2NS2A 2F2FA 3BA7A 4OEEA 5BQUA 1JT5A 3VWCA 1Z2VA 4ZA3B 1YBIA 2F8XC 2AQZA 4P6AA 4ZLBB 1JLXA 4GP3A 5FZUA 4J2YA 1S0GA 1SR4C 4J2XA 4I2SA 2E4MA 3IAGC 3BAVA 3FJAA 1JTCA 2KLLA 3NBDA 2VSAA 1FV2A 4H75A 4QALA 3BAQA 3O49A 1RZOB 4LO3C 4KEJA 3FUQA 1I1BA 3WINC 3PG0A 3F1RA 4ISRA 4P0KA 3D7WB 3H6QA 3VSFA 3WO3A 3V0BB 2YUGA 4R6UB 1G9CA 5EHAA 3MALA 3N0KA 3CRGA 3H6RB 2AAIB 2J3PA 4MZHA 3IM5A 5JLVA 4GP0A 4OUJA 1T9FA 3Q7WA 2QYIB 3I2XA 3V0AB
chains in the Genus database with same CATH topology
4ENDA 2NYYA 3I29B 1HIBA 3OGFA 1VCLA 2AFGA 9ILBA 2Y9XE 1ISVA 2K4AB 3UD8A 1UPSA 3TC2A 4CJMA 3HN1A 3NBEA 1EV2A 3UJ4A 2FFUA 3WA1A 1QXMA 2L5XA 1DZCA 3NBCA 5BXSA 2IHOA 4PC4A 5DVHA 4I8MA 4LO1A 2AXMA 3Q7XA 8I1BA 5DSSB 3UD7A 1PUUB 3A22A 3BAUA 4GAIA 2ZR1B 4P0LA 5F8YA 1DFCA 1Q04A 3KMVA 1PZZA 3BRDA 1JY0A 5F8SA 4A7ZA 1OQLB 4I4OA 4ZFYB 4ZFWB 4H9WA 4JPZA 4I4UA 2D20A 1M2TB 3K1XA 3RMYA 5BP5C 3CA1A 3AZWA 1L2HA 2KI4A 5G00A 4J2KA 1EPWA 2DS0A 1XHBA 4AN7B 3N7LA 1W3FA 3CRHA 3WO4A 1BARA 3ZXGA 1S0CA 1N4KA 3CAHA 1J0SA 1YTOA 1PWAA 3NBNA 4I37A 4KEKA 3AKIA 2VXRA 5FZZA 1HKNA 4I6IA 1SR4A 4Q9GA 4TLPA 2D1ZA 3T8SA 4XKIA 4QBVA 4D8HA 1JT3A 1YF8B 4L4HA 3CA0A 1W3GA 3QYDA 4I1BA 3WINA 5BOWA 4L4IA 1EVTA 1TTUA 4X39A 4EFPA 4I4XA 1S0FA 1ISWA 4LO7B 4JRAA 1A8DA 1E0OA 1TOOA 3FJ8A 1BA7A 1JT4A 2BEAA 3RSJA 1IRPA 1G9AA 3FJDA 3HMYA 4I4QA 4D0TA 1ONKB 3AKFA 1FQ9A 3OGGA 4EFQA 2VUAA 4JKQA 2NTDA 3IM6A 3VSZA 1RG8A 3LTQA 1V6VA 3N7JA 4Z8SB 1V6WA 3BRFA 2KH2A 3W9TA 4MZGB 4JKXB 3CA6A 2VXTI 4EFRA 4J2SA 5D62A 2NP0A 6I1BA 4LO0C 4OW4A 1YXWA 2NVHA 2DREA 5FNWA 3VT0A 1G82A 2WRYA 2RSTA 1IRAX 3FJKA 1FMZA 1AVUA 2P23A 3AH1A 4YOLA 3NJ5A 41BIA 3RTJB 3BRGC 4Z9WB 1ISZA 1BFFA 2KI6B 2Q3NB 4QKSA 2ZQOA 3AJ5A 1XG6A 1PUMB 1QQKA 1Z4SA 1DLLA 3FJIA 3A07A 1BFBA 1RMLA 1BFGA 1TWMA 3FUOA 3BTAA 3IIRA 4XFUA 2ESUA 4XFTA 4G9NA 1BFCA 1IT0A 3EF2A 4JAWA 4OEFA 1KNMA 4DEPA 4I0YA 4ZFUB 1GGPB 1Q03A 4HJJA 4OWJA 3A21A 4FVVA 3CU1B 3BA4A 1S0DA 1CVSA 3E8LC 1AXMA 3S8KA 4GAFA 4ZOTA 4D0ZA 3AH4A 3ZC8A 1YYNA 4UY4A 4IONA 3P53A 5FZYA 3PUBA 4QD2B 3B9UA 2FGFA 3BAHA 5DUYA 2NM1A 1ISYA 4DCKC 1P63A 2FDBM 1Z0HA 1DJSB 1R8NA 4IY8A 2FO1A 2QN4A 4IY9A 1AF9A 1V6UA 1AFCA 1SZ6B 1MC9A 1ISXA 31BIA 3CA3A 4G1RA 5D63A 4KBBA 3JUTA 3BAGA 1DQGA 4I3NA 1S0BA 1S0LA 3H6SE 2Z48A 3AH2A 5HPZA 4I4VA 3SNVA 4GOYA 4KEIA 2P39A 4II0A 3O4OA 7I1BA 3LLPA 2RQ9A 2BEBA 1G9BA 1IOBA 4EB2B 4LO3A 4ZGRB 3BB2A 4OWKA 2I1BA 4QO3A 2Y9FA 4X37A 3HSMA 1TWEA 5BVPI 5B2HA 2D22A 4WBCA 3PHZA 1WD4A 2M49A 4LO0A 3ILAA 3PMEA 4X3AA 5BXPA 5BXRA 1AVXB 3FJEA 2BFHA 1DIWA 3O44A 4AN6A 4X38A 2R9KB 3JRRA 3OJVA 5GAQA 4DENA 3HBWA 1PC8B 3BA5A 1HCDA 3MPPG 1JT7A 4I4RA 4LO2C 2HZ9A 2FFVA 3FJCA 1BASA 3Q7YA 3RMXA 2X2SA 3WMUA 2IWTB 4QD2C 2ERMA 4OEGA 4EKXB 1NZKA 4GOVA 2D7IA 4I4YA 2NZ9A 5BXTA 3FJBA 2D44A 4IYBA 1AVWB 3VT1A 1Q1UA 1JQZA 2GO2A 1V6XA 2D7RA 1ITBA 2VU9A 4A7YA 1FWVA 1DZDA 3FJFA 4JP0A 2MIBA 1FWUA 1WBAA 1HCEA 2VSEA 3P6IA 1G9DA 3CRIA 3HALA 1BLAA 2K43A 1MD6A 3V79C 2D23A 2K8RA 4ISQA 4QC4A 3BADA 3UD9A 1XYFA 4IZEA 4I96A 1ABRB 2F2FC 5BQUC 1JLYA 3AZVA 1NUNA 1EYLA 2HW9A 3ZX7A 5E24E 5EG6C 3AKGA 2D43A 3P6JA 5BP5A 2E4MC 5D61A 3RTIB 1TFMB 1WBCA 2HWAA 4QBCA 1M16A 4I4PA 2WBCA 3FJJA 1AVAC 3V0BA 1F31A 2D24A 4LO7C 1HWMB 3O4CA 5F8WA 4ZKTB 3H6RA 3S8JA 2Q9XA 4IHZA 4EEEB 1FV3A 2GZBA 2RG9B 3WO2A 5F90A 4QKRA 1CE7B 5JMCA 4Q91A 1XZZA 3OBTA 4XFSA 1W3AA 3N7KA 1FMMS 1DFQA 1HWNB 4USOA 3OBRA 3VEQA 3V0AA 3BAOA 3O5WB 2DRZA 1HWPB 3UDAA 4H04A 2XOAA 1D0HA 4USPA 4P0JA 4J23B 4HR6C 4I7IA 4I4SA 1HWOB 3R4SA 2LIQA 3POKA 3OJMA 3AJ6A 4I1EA 5DZUA 4ZBVB 3O4BA 4G6MA 2KKIA 4HA2A 3I2AA 3O4DA 2ET2A 3O4AA 2Z49A 2ZQNA 4FGFA 4G6JA 4IZXA 1FGAA 4KC3A 1R8OA 1I1EA 5I1BA 3F62B 3HOMA 1IHKA 3AKHA 4MZFB 2VLCA 4LO8B 5EC5A 1FN0A 4LO1C 4A7KA 1IILA 1RY7A 2Y9GA 3CQAA 3FJHA 4F83A 3A23A 3C9ZA 5FNXA 1K5VA 3CA5A 3CA4A 4LO2A 1DQOA 21BIA 3UJ0A 4Q9PA 4F34A 3QR5A 3FJ9A 1ILR1 3R4UA 3WMVA 3BX1C 1QQLA 2HWMA 2MC2A 2UUSA 3IM7A 3FFZA 2Y9WC 3OJ2A 4OWLA 2MLLB 2LIEA 1TIEA 3O3QA 3VT2A 1II4A 3ZXDA 2X2TA 1WD3A 2DRYA 3FGMA 3ZC9A 1K5UA 1TP0A 1S0EA 3VUOA 1BLDA 4JQ0A 3N7MA 4G9MA 1T4QA 4IQPA 1IJTA 2NS2A 2F2FA 3BA7A 4OEEA 5BQUA 1JT5A 3VWCA 1Z2VA 4ZA3B 1YBIA 2F8XC 2AQZA 4P6AA 4ZLBB 1JLXA 4GP3A 5FZUA 4J2YA 1S0GA 1SR4C 4J2XA 4I2SA 2E4MA 3IAGC 3BAVA 3FJAA 1JTCA 2KLLA 3NBDA 2VSAA 1FV2A 4H75A 4QALA 3BAQA 3O49A 1RZOB 4LO3C 4KEJA 3FUQA 1I1BA 3WINC 3PG0A 3F1RA 4ISRA 4P0KA 3D7WB 3H6QA 3VSFA 3WO3A 3V0BB 2YUGA 4R6UB 1G9CA 5EHAA 3MALA 3N0KA 3CRGA 3H6RB 2AAIB 2J3PA 4MZHA 3IM5A 5JLVA 4GP0A 4OUJA 1T9FA 3Q7WA 2QYIB 3I2XA 3V0AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4END A;  2NYY A;  3I29 B;  1HIB A;  3OGF A;  1VCL A;  2AFG A;  9ILB A;  2Y9X E;  1ISV A;  2K4A B;  3UD8 A;  1UPS A;  3TC2 A;  4CJM A;  3HN1 A;  3NBE A;  1EV2 A;  3UJ4 A;  2FFU A;  3WA1 A;  1QXM A;  2L5X A;  1DZC A;  3NBC A;  5BXS A;  2IHO A;  4PC4 A;  5DVH A;  4I8M A;  4LO1 A;  2AXM A;  3Q7X A;  8I1B A;  5DSS B;  3UD7 A;  1PUU B;  3A22 A;  3BAU A;  4GAI A;  2ZR1 B;  4P0L A;  5F8Y A;  1DFC A;  1Q04 A;  3KMV A;  1PZZ A;  3BRD A;  1JY0 A;  5F8S A;  4A7Z A;  1OQL B;  4I4O A;  4ZFY B;  4ZFW B;  4H9W A;  4JPZ A;  4I4U A;  2D20 A;  1M2T B;  3K1X A;  3RMY A;  5BP5 C;  3CA1 A;  3AZW A;  1L2H A;  2KI4 A;  5G00 A;  4J2K A;  1EPW A;  2DS0 A;  1XHB A;  4AN7 B;  3N7L A;  1W3F A;  3CRH A;  3WO4 A;  1BAR A;  3ZXG A;  1S0C A;  1N4K A;  3CAH A;  1J0S A;  1YTO A;  1PWA A;  3NBN A;  4I37 A;  4KEK A;  3AKI A;  2VXR A;  5FZZ A;  1HKN A;  4I6I A;  1SR4 A;  4Q9G A;  4TLP A;  2D1Z A;  3T8S A;  4XKI A;  4QBV A;  4D8H A;  1JT3 A;  1YF8 B;  4L4H A;  3CA0 A;  1W3G A;  3QYD A;  4I1B A;  3WIN A;  5BOW A;  4L4I A;  1EVT A;  1TTU A;  4X39 A;  4EFP A;  4I4X A;  1S0F A;  1ISW A;  4LO7 B;  4JRA A;  1A8D A;  1E0O A;  1TOO A;  3FJ8 A;  1BA7 A;  1JT4 A;  2BEA A;  3RSJ A;  1IRP A;  1G9A A;  3FJD A;  3HMY A;  4I4Q A;  4D0T A;  1ONK B;  3AKF A;  1FQ9 A;  3OGG A;  4EFQ A;  2VUA A;  4JKQ A;  2NTD A;  3IM6 A;  3VSZ A;  1RG8 A;  3LTQ A;  1V6V A;  3N7J A;  4Z8S B;  1V6W A;  3BRF A;  2KH2 A;  3W9T A;  4JKX B;  3CA6 A;  2VXT I;  4EFR A;  4J2S A;  5D62 A;  2NP0 A;  6I1B A;  4LO0 C;  4OW4 A;  1YXW A;  2NVH A;  2DRE A;  5FNW A;  3VT0 A;  1G82 A;  2WRY A;  2RST A;  1IRA X;  3FJK A;  1FMZ A;  1AVU A;  2P23 A;  3AH1 A;  4YOL A;  3NJ5 A;  41BI A;  3RTJ B;  3BRG C;  4Z9W B;  1ISZ A;  1BFF A;  2KI6 B;  2Q3N B;  4QKS A;  2ZQO A;  3AJ5 A;  1XG6 A;  1PUM B;  1QQK A;  1Z4S A;  1DLL A;  3FJI A;  3A07 A;  1BFB A;  1RML A;  1BFG A;  1TWM A;  3FUO A;  3BTA A;  3IIR A;  4XFU A;  2ESU A;  4XFT A;  4G9N A;  1BFC A;  1IT0 A;  3EF2 A;  4JAW A;  4OEF A;  1KNM A;  4DEP A;  4I0Y A;  4ZFU B;  1GGP B;  1Q03 A;  4HJJ A;  4OWJ A;  3A21 A;  4FVV A;  3CU1 B;  3BA4 A;  1S0D A;  1CVS A;  3E8L C;  1AXM A;  3S8K A;  4GAF A;  4ZOT A;  4D0Z A;  3AH4 A;  3ZC8 A;  1YYN A;  4ION A;  3P53 A;  5FZY A;  3PUB A;  4QD2 B;  3B9U A;  2FGF A;  3BAH A;  5DUY A;  2NM1 A;  1ISY A;  4DCK C;  1P63 A;  2FDB M;  1Z0H A;  1DJS B;  1R8N A;  4IY8 A;  2FO1 A;  2QN4 A;  4IY9 A;  1AF9 A;  1V6U A;  1AFC A;  1SZ6 B;  1MC9 A;  1ISX A;  31BI A;  3CA3 A;  4G1R A;  5D63 A;  4KBB A;  3JUT A;  3BAG A;  1DQG A;  4I3N A;  1S0B A;  1S0L A;  3H6S E;  2Z48 A;  3AH2 A;  5HPZ A;  4I4V A;  3SNV A;  4GOY A;  4KEI A;  2P39 A;  4II0 A;  3O4O A;  7I1B A;  3LLP A;  2RQ9 A;  2BEB A;  1G9B A;  1IOB A;  4EB2 B;  4LO3 A;  4ZGR B;  3BB2 A;  4OWK A;  2I1B A;  4QO3 A;  2Y9F A;  4X37 A;  3HSM A;  1TWE A;  5BVP I;  5B2H A;  2D22 A;  4WBC A;  3PHZ A;  1WD4 A;  2M49 A;  4LO0 A;  3ILA A;  3PME A;  4X3A A;  5BXP A;  5BXR A;  1AVX B;  3FJE A;  2BFH A;  1DIW A;  3O44 A;  4AN6 A;  4X38 A;  2R9K B;  3JRR A;  3OJV A;  5GAQ A;  4DEN A;  3HBW A;  1PC8 B;  3BA5 A;  1HCD A;  3MPP G;  1JT7 A;  4I4R A;  4LO2 C;  2HZ9 A;  2FFV A;  3FJC A;  1BAS A;  3Q7Y A;  3RMX A;  2X2S A;  3WMU A;  2IWT B;  4QD2 C;  2ERM A;  4OEG A;  4EKX B;  1NZK A;  4GOV A;  2D7I A;  4I4Y A;  2NZ9 A;  5BXT A;  3FJB A;  2D44 A;  4IYB A;  1AVW B;  3VT1 A;  1Q1U A;  1JQZ A;  2GO2 A;  1V6X A;  2D7R A;  1ITB A;  2VU9 A;  4A7Y A;  1FWV A;  1DZD A;  3FJF A;  4JP0 A;  2MIB A;  1FWU A;  1WBA A;  1HCE A;  2VSE A;  3P6I A;  1G9D A;  3CRI A;  3HAL A;  1BLA A;  2K43 A;  1MD6 A;  3V79 C;  2D23 A;  2K8R A;  4ISQ A;  4QC4 A;  3BAD A;  3UD9 A;  1XYF A;  4IZE A;  4I96 A;  1ABR B;  2F2F C;  5BQU C;  1JLY A;  3AZV A;  1NUN A;  1EYL A;  2HW9 A;  3ZX7 A;  5E24 E;  5EG6 C;  3AKG A;  2D43 A;  3P6J A;  5BP5 A;  2E4M C;  5D61 A;  3RTI B;  1TFM B;  1WBC A;  2HWA A;  4QBC A;  1M16 A;  4I4P A;  2WBC A;  3FJJ A;  1AVA C;  3V0B A;  1F31 A;  2D24 A;  4LO7 C;  1HWM B;  3O4C A;  5F8W A;  4ZKT B;  3H6R A;  3S8J A;  2Q9X A;  4IHZ A;  4EEE B;  1FV3 A;  2GZB A;  2RG9 B;  3WO2 A;  5F90 A;  4QKR A;  1CE7 B;  5JMC A;  4Q91 A;  1XZZ A;  3OBT A;  4XFS A;  1W3A A;  3N7K A;  1FMM S;  1DFQ A;  1HWN B;  4USO A;  3OBR A;  3VEQ A;  3V0A A;  3BAO A;  3O5W B;  2DRZ A;  1HWP B;  3UDA A;  4H04 A;  2XOA A;  1D0H A;  4USP A;  4P0J A;  4J23 B;  4HR6 C;  4I7I A;  4I4S A;  1HWO B;  3R4S A;  2LIQ A;  3POK A;  3OJM A;  3AJ6 A;  4I1E A;  5DZU A;  4ZBV B;  3O4B A;  4G6M A;  2KKI A;  4HA2 A;  3I2A A;  3O4D A;  2ET2 A;  3O4A A;  2Z49 A;  2ZQN A;  4FGF A;  4G6J A;  4IZX A;  1FGA A;  4KC3 A;  1R8O A;  1I1E A;  5I1B A;  3F62 B;  3HOM A;  1IHK A;  3AKH A;  2VLC A;  4LO8 B;  5EC5 A;  1FN0 A;  4LO1 C;  4A7K A;  1IIL A;  1RY7 A;  2Y9G A;  3CQA A;  3FJH A;  4F83 A;  3A23 A;  3C9Z A;  5FNX A;  1K5V A;  3CA5 A;  3CA4 A;  4LO2 A;  1DQO A;  21BI A;  3UJ0 A;  4Q9P A;  4F34 A;  3QR5 A;  3FJ9 A;  1ILR 1;  3R4U A;  3WMV A;  3BX1 C;  1QQL A;  2HWM A;  2MC2 A;  2UUS A;  3IM7 A;  3FFZ A;  2Y9W C;  3OJ2 A;  4OWL A;  2MLL B;  2LIE A;  1TIE A;  3O3Q A;  3VT2 A;  1II4 A;  3ZXD A;  2X2T A;  1WD3 A;  2DRY A;  3FGM A;  3ZC9 A;  1K5U A;  1TP0 A;  1S0E A;  3VUO A;  1BLD A;  4JQ0 A;  3N7M A;  4G9M A;  1T4Q A;  4IQP A;  1IJT A;  2F2F A;  3BA7 A;  4OEE A;  5BQU A;  1JT5 A;  3VWC A;  1Z2V A;  4ZA3 B;  1YBI A;  2F8X C;  2AQZ A;  4P6A A;  4ZLB B;  1JLX A;  4GP3 A;  5FZU A;  4J2Y A;  1S0G A;  1SR4 C;  4J2X A;  4I2S A;  2E4M A;  3IAG C;  3BAV A;  3FJA A;  1JTC A;  2KLL A;  3NBD A;  2VSA A;  1FV2 A;  4QAL A;  3BAQ A;  3O49 A;  1RZO B;  4LO3 C;  4KEJ A;  3FUQ A;  1I1B A;  3WIN C;  3PG0 A;  3F1R A;  4ISR A;  4P0K A;  3D7W B;  3H6Q A;  3VSF A;  3WO3 A;  3V0B B;  2YUG A;  4R6U B;  1G9C A;  5EHA A;  3MAL A;  3N0K A;  3CRG A;  3H6R B;  2AAI B;  2J3P A;  5JLV A;  3IM5 A;  4GP0 A;  4OUJ A;  1T9F A;  3Q7W A;  2QYI B;  3I2X A;  3V0A B; 
#chains in the Genus database with same CATH topology
 4END A;  2NYY A;  3I29 B;  1HIB A;  3OGF A;  1VCL A;  2AFG A;  9ILB A;  2Y9X E;  1ISV A;  2K4A B;  3UD8 A;  1UPS A;  3TC2 A;  4CJM A;  3HN1 A;  3NBE A;  1EV2 A;  3UJ4 A;  2FFU A;  3WA1 A;  1QXM A;  2L5X A;  1DZC A;  3NBC A;  5BXS A;  2IHO A;  4PC4 A;  5DVH A;  4I8M A;  4LO1 A;  2AXM A;  3Q7X A;  8I1B A;  5DSS B;  3UD7 A;  1PUU B;  3A22 A;  3BAU A;  4GAI A;  2ZR1 B;  4P0L A;  5F8Y A;  1DFC A;  1Q04 A;  3KMV A;  1PZZ A;  3BRD A;  1JY0 A;  5F8S A;  4A7Z A;  1OQL B;  4I4O A;  4ZFY B;  4ZFW B;  4H9W A;  4JPZ A;  4I4U A;  2D20 A;  1M2T B;  3K1X A;  3RMY A;  5BP5 C;  3CA1 A;  3AZW A;  1L2H A;  2KI4 A;  5G00 A;  4J2K A;  1EPW A;  2DS0 A;  1XHB A;  4AN7 B;  3N7L A;  1W3F A;  3CRH A;  3WO4 A;  1BAR A;  3ZXG A;  1S0C A;  1N4K A;  3CAH A;  1J0S A;  1YTO A;  1PWA A;  3NBN A;  4I37 A;  4KEK A;  3AKI A;  2VXR A;  5FZZ A;  1HKN A;  4I6I A;  1SR4 A;  4Q9G A;  4TLP A;  2D1Z A;  3T8S A;  4XKI A;  4QBV A;  4D8H A;  1JT3 A;  1YF8 B;  4L4H A;  3CA0 A;  1W3G A;  3QYD A;  4I1B A;  3WIN A;  5BOW A;  4L4I A;  1EVT A;  1TTU A;  4X39 A;  4EFP A;  4I4X A;  1S0F A;  1ISW A;  4LO7 B;  4JRA A;  1A8D A;  1E0O A;  1TOO A;  3FJ8 A;  1BA7 A;  1JT4 A;  2BEA A;  3RSJ A;  1IRP A;  1G9A A;  3FJD A;  3HMY A;  4I4Q A;  4D0T A;  1ONK B;  3AKF A;  1FQ9 A;  3OGG A;  4EFQ A;  2VUA A;  4JKQ A;  2NTD A;  3IM6 A;  3VSZ A;  1RG8 A;  3LTQ A;  1V6V A;  3N7J A;  4Z8S B;  1V6W A;  3BRF A;  2KH2 A;  3W9T A;  4MZG B;  4JKX B;  3CA6 A;  2VXT I;  4EFR A;  4J2S A;  5D62 A;  2NP0 A;  6I1B A;  4LO0 C;  4OW4 A;  1YXW A;  2NVH A;  2DRE A;  5FNW A;  3VT0 A;  1G82 A;  2WRY A;  2RST A;  1IRA X;  3FJK A;  1FMZ A;  1AVU A;  2P23 A;  3AH1 A;  4YOL A;  3NJ5 A;  41BI A;  3RTJ B;  3BRG C;  4Z9W B;  1ISZ A;  1BFF A;  2KI6 B;  2Q3N B;  4QKS A;  2ZQO A;  3AJ5 A;  1XG6 A;  1PUM B;  1QQK A;  1Z4S A;  1DLL A;  3FJI A;  3A07 A;  1BFB A;  1RML A;  1BFG A;  1TWM A;  3FUO A;  3BTA A;  3IIR A;  4XFU A;  2ESU A;  4XFT A;  4G9N A;  1BFC A;  1IT0 A;  3EF2 A;  4JAW A;  4OEF A;  1KNM A;  4DEP A;  4I0Y A;  4ZFU B;  1GGP B;  1Q03 A;  4HJJ A;  4OWJ A;  3A21 A;  4FVV A;  3CU1 B;  3BA4 A;  1S0D A;  1CVS A;  3E8L C;  1AXM A;  3S8K A;  4GAF A;  4ZOT A;  4D0Z A;  3AH4 A;  3ZC8 A;  1YYN A;  4UY4 A;  4ION A;  3P53 A;  5FZY A;  3PUB A;  4QD2 B;  3B9U A;  2FGF A;  3BAH A;  5DUY A;  2NM1 A;  1ISY A;  4DCK C;  1P63 A;  2FDB M;  1Z0H A;  1DJS B;  1R8N A;  4IY8 A;  2FO1 A;  2QN4 A;  4IY9 A;  1AF9 A;  1V6U A;  1AFC A;  1SZ6 B;  1MC9 A;  1ISX A;  31BI A;  3CA3 A;  4G1R A;  5D63 A;  4KBB A;  3JUT A;  3BAG A;  1DQG A;  4I3N A;  1S0B A;  1S0L A;  3H6S E;  2Z48 A;  3AH2 A;  5HPZ A;  4I4V A;  3SNV A;  4GOY A;  4KEI A;  2P39 A;  4II0 A;  3O4O A;  7I1B A;  3LLP A;  2RQ9 A;  2BEB A;  1G9B A;  1IOB A;  4EB2 B;  4LO3 A;  4ZGR B;  3BB2 A;  4OWK A;  2I1B A;  4QO3 A;  2Y9F A;  4X37 A;  3HSM A;  1TWE A;  5BVP I;  5B2H A;  2D22 A;  4WBC A;  3PHZ A;  1WD4 A;  2M49 A;  4LO0 A;  3ILA A;  3PME A;  4X3A A;  5BXP A;  5BXR A;  1AVX B;  3FJE A;  2BFH A;  1DIW A;  3O44 A;  4AN6 A;  4X38 A;  2R9K B;  3JRR A;  3OJV A;  5GAQ A;  4DEN A;  3HBW A;  1PC8 B;  3BA5 A;  1HCD A;  3MPP G;  1JT7 A;  4I4R A;  4LO2 C;  2HZ9 A;  2FFV A;  3FJC A;  1BAS A;  3Q7Y A;  3RMX A;  2X2S A;  3WMU A;  2IWT B;  4QD2 C;  2ERM A;  4OEG A;  4EKX B;  1NZK A;  4GOV A;  2D7I A;  4I4Y A;  2NZ9 A;  5BXT A;  3FJB A;  2D44 A;  4IYB A;  1AVW B;  3VT1 A;  1Q1U A;  1JQZ A;  2GO2 A;  1V6X A;  2D7R A;  1ITB A;  2VU9 A;  4A7Y A;  1FWV A;  1DZD A;  3FJF A;  4JP0 A;  2MIB A;  1FWU A;  1WBA A;  1HCE A;  2VSE A;  3P6I A;  1G9D A;  3CRI A;  3HAL A;  1BLA A;  2K43 A;  1MD6 A;  3V79 C;  2D23 A;  2K8R A;  4ISQ A;  4QC4 A;  3BAD A;  3UD9 A;  1XYF A;  4IZE A;  4I96 A;  1ABR B;  2F2F C;  5BQU C;  1JLY A;  3AZV A;  1NUN A;  1EYL A;  2HW9 A;  3ZX7 A;  5E24 E;  5EG6 C;  3AKG A;  2D43 A;  3P6J A;  5BP5 A;  2E4M C;  5D61 A;  3RTI B;  1TFM B;  1WBC A;  2HWA A;  4QBC A;  1M16 A;  4I4P A;  2WBC A;  3FJJ A;  1AVA C;  3V0B A;  1F31 A;  2D24 A;  4LO7 C;  1HWM B;  3O4C A;  5F8W A;  4ZKT B;  3H6R A;  3S8J A;  2Q9X A;  4IHZ A;  4EEE B;  1FV3 A;  2GZB A;  2RG9 B;  3WO2 A;  5F90 A;  4QKR A;  1CE7 B;  5JMC A;  4Q91 A;  1XZZ A;  3OBT A;  4XFS A;  1W3A A;  3N7K A;  1FMM S;  1DFQ A;  1HWN B;  4USO A;  3OBR A;  3VEQ A;  3V0A A;  3BAO A;  3O5W B;  2DRZ A;  1HWP B;  3UDA A;  4H04 A;  2XOA A;  1D0H A;  4USP A;  4P0J A;  4J23 B;  4HR6 C;  4I7I A;  4I4S A;  1HWO B;  3R4S A;  2LIQ A;  3POK A;  3OJM A;  3AJ6 A;  4I1E A;  5DZU A;  4ZBV B;  3O4B A;  4G6M A;  2KKI A;  4HA2 A;  3I2A A;  3O4D A;  2ET2 A;  3O4A A;  2Z49 A;  2ZQN A;  4FGF A;  4G6J A;  4IZX A;  1FGA A;  4KC3 A;  1R8O A;  1I1E A;  5I1B A;  3F62 B;  3HOM A;  1IHK A;  3AKH A;  4MZF B;  2VLC A;  4LO8 B;  5EC5 A;  1FN0 A;  4LO1 C;  4A7K A;  1IIL A;  1RY7 A;  2Y9G A;  3CQA A;  3FJH A;  4F83 A;  3A23 A;  3C9Z A;  5FNX A;  1K5V A;  3CA5 A;  3CA4 A;  4LO2 A;  1DQO A;  21BI A;  3UJ0 A;  4Q9P A;  4F34 A;  3QR5 A;  3FJ9 A;  1ILR 1;  3R4U A;  3WMV A;  3BX1 C;  1QQL A;  2HWM A;  2MC2 A;  2UUS A;  3IM7 A;  3FFZ A;  2Y9W C;  3OJ2 A;  4OWL A;  2MLL B;  2LIE A;  1TIE A;  3O3Q A;  3VT2 A;  1II4 A;  3ZXD A;  2X2T A;  1WD3 A;  2DRY A;  3FGM A;  3ZC9 A;  1K5U A;  1TP0 A;  1S0E A;  3VUO A;  1BLD A;  4JQ0 A;  3N7M A;  4G9M A;  1T4Q A;  4IQP A;  1IJT A;  2NS2 A;  2F2F A;  3BA7 A;  4OEE A;  5BQU A;  1JT5 A;  3VWC A;  1Z2V A;  4ZA3 B;  1YBI A;  2F8X C;  2AQZ A;  4P6A A;  4ZLB B;  1JLX A;  4GP3 A;  5FZU A;  4J2Y A;  1S0G A;  1SR4 C;  4J2X A;  4I2S A;  2E4M A;  3IAG C;  3BAV A;  3FJA A;  1JTC A;  2KLL A;  3NBD A;  2VSA A;  1FV2 A;  4H75 A;  4QAL A;  3BAQ A;  3O49 A;  1RZO B;  4LO3 C;  4KEJ A;  3FUQ A;  1I1B A;  3WIN C;  3PG0 A;  3F1R A;  4ISR A;  4P0K A;  3D7W B;  3H6Q A;  3VSF A;  3WO3 A;  3V0B B;  2YUG A;  4R6U B;  1G9C A;  5EHA A;  3MAL A;  3N0K A;  3CRG A;  3H6R B;  2AAI B;  2J3P A;  4MZH A;  3IM5 A;  5JLV A;  4GP0 A;  4OUJ A;  1T9F A;  3Q7W A;  2QYI B;  3I2X A;  3V0A B; 
#chains in the Genus database with same CATH homology
 4END A;  2NYY A;  3I29 B;  1HIB A;  3OGF A;  1VCL A;  2AFG A;  9ILB A;  2Y9X E;  1ISV A;  2K4A B;  3UD8 A;  1UPS A;  3TC2 A;  4CJM A;  3HN1 A;  3NBE A;  1EV2 A;  3UJ4 A;  2FFU A;  3WA1 A;  1QXM A;  2L5X A;  1DZC A;  3NBC A;  5BXS A;  2IHO A;  4PC4 A;  5DVH A;  4I8M A;  4LO1 A;  2AXM A;  3Q7X A;  8I1B A;  5DSS B;  3UD7 A;  1PUU B;  3A22 A;  3BAU A;  4GAI A;  2ZR1 B;  4P0L A;  5F8Y A;  1DFC A;  1Q04 A;  3KMV A;  1PZZ A;  3BRD A;  1JY0 A;  5F8S A;  4A7Z A;  1OQL B;  4I4O A;  4ZFY B;  4ZFW B;  4H9W A;  4JPZ A;  4I4U A;  2D20 A;  1M2T B;  3K1X A;  3RMY A;  5BP5 C;  3CA1 A;  3AZW A;  1L2H A;  2KI4 A;  5G00 A;  4J2K A;  1EPW A;  2DS0 A;  1XHB A;  4AN7 B;  3N7L A;  1W3F A;  3CRH A;  3WO4 A;  1BAR A;  3ZXG A;  1S0C A;  1N4K A;  3CAH A;  1J0S A;  1YTO A;  1PWA A;  3NBN A;  4I37 A;  4KEK A;  3AKI A;  2VXR A;  5FZZ A;  1HKN A;  4I6I A;  1SR4 A;  4Q9G A;  4TLP A;  2D1Z A;  3T8S A;  4XKI A;  4QBV A;  4D8H A;  1JT3 A;  1YF8 B;  4L4H A;  3CA0 A;  1W3G A;  3QYD A;  4I1B A;  3WIN A;  5BOW A;  4L4I A;  1EVT A;  1TTU A;  4X39 A;  4EFP A;  4I4X A;  1S0F A;  1ISW A;  4LO7 B;  4JRA A;  1A8D A;  1E0O A;  1TOO A;  3FJ8 A;  1BA7 A;  1JT4 A;  2BEA A;  3RSJ A;  1IRP A;  1G9A A;  3FJD A;  3HMY A;  4I4Q A;  4D0T A;  1ONK B;  3AKF A;  1FQ9 A;  3OGG A;  4EFQ A;  2VUA A;  4JKQ A;  2NTD A;  3IM6 A;  3VSZ A;  1RG8 A;  3LTQ A;  1V6V A;  3N7J A;  4Z8S B;  1V6W A;  3BRF A;  2KH2 A;  3W9T A;  4MZG B;  4JKX B;  3CA6 A;  2VXT I;  4EFR A;  4J2S A;  5D62 A;  2NP0 A;  6I1B A;  4LO0 C;  4OW4 A;  1YXW A;  2NVH A;  2DRE A;  5FNW A;  3VT0 A;  1G82 A;  2WRY A;  2RST A;  1IRA X;  3FJK A;  1FMZ A;  1AVU A;  2P23 A;  3AH1 A;  4YOL A;  3NJ5 A;  41BI A;  3RTJ B;  3BRG C;  4Z9W B;  1ISZ A;  1BFF A;  2KI6 B;  2Q3N B;  4QKS A;  2ZQO A;  3AJ5 A;  1XG6 A;  1PUM B;  1QQK A;  1Z4S A;  1DLL A;  3FJI A;  3A07 A;  1BFB A;  1RML A;  1BFG A;  1TWM A;  3FUO A;  3BTA A;  3IIR A;  4XFU A;  2ESU A;  4XFT A;  4G9N A;  1BFC A;  1IT0 A;  3EF2 A;  4JAW A;  4OEF A;  1KNM A;  4DEP A;  4I0Y A;  4ZFU B;  1GGP B;  1Q03 A;  4HJJ A;  4OWJ A;  3A21 A;  4FVV A;  3CU1 B;  3BA4 A;  1S0D A;  1CVS A;  3E8L C;  1AXM A;  3S8K A;  4GAF A;  4ZOT A;  4D0Z A;  3AH4 A;  3ZC8 A;  1YYN A;  4UY4 A;  4ION A;  3P53 A;  5FZY A;  3PUB A;  4QD2 B;  3B9U A;  2FGF A;  3BAH A;  5DUY A;  2NM1 A;  1ISY A;  4DCK C;  1P63 A;  2FDB M;  1Z0H A;  1DJS B;  1R8N A;  4IY8 A;  2FO1 A;  2QN4 A;  4IY9 A;  1AF9 A;  1V6U A;  1AFC A;  1SZ6 B;  1MC9 A;  1ISX A;  31BI A;  3CA3 A;  4G1R A;  5D63 A;  4KBB A;  3JUT A;  3BAG A;  1DQG A;  4I3N A;  1S0B A;  1S0L A;  3H6S E;  2Z48 A;  3AH2 A;  5HPZ A;  4I4V A;  3SNV A;  4GOY A;  4KEI A;  2P39 A;  4II0 A;  3O4O A;  7I1B A;  3LLP A;  2RQ9 A;  2BEB A;  1G9B A;  1IOB A;  4EB2 B;  4LO3 A;  4ZGR B;  3BB2 A;  4OWK A;  2I1B A;  4QO3 A;  2Y9F A;  4X37 A;  3HSM A;  1TWE A;  5BVP I;  5B2H A;  2D22 A;  4WBC A;  3PHZ A;  1WD4 A;  2M49 A;  4LO0 A;  3ILA A;  3PME A;  4X3A A;  5BXP A;  5BXR A;  1AVX B;  3FJE A;  2BFH A;  1DIW A;  3O44 A;  4AN6 A;  4X38 A;  2R9K B;  3JRR A;  3OJV A;  5GAQ A;  4DEN A;  3HBW A;  1PC8 B;  3BA5 A;  1HCD A;  3MPP G;  1JT7 A;  4I4R A;  4LO2 C;  2HZ9 A;  2FFV A;  3FJC A;  1BAS A;  3Q7Y A;  3RMX A;  2X2S A;  3WMU A;  2IWT B;  4QD2 C;  2ERM A;  4OEG A;  4EKX B;  1NZK A;  4GOV A;  2D7I A;  4I4Y A;  2NZ9 A;  5BXT A;  3FJB A;  2D44 A;  4IYB A;  1AVW B;  3VT1 A;  1Q1U A;  1JQZ A;  2GO2 A;  1V6X A;  2D7R A;  1ITB A;  2VU9 A;  4A7Y A;  1FWV A;  1DZD A;  3FJF A;  4JP0 A;  2MIB A;  1FWU A;  1WBA A;  1HCE A;  2VSE A;  3P6I A;  1G9D A;  3CRI A;  3HAL A;  1BLA A;  2K43 A;  1MD6 A;  3V79 C;  2D23 A;  2K8R A;  4ISQ A;  4QC4 A;  3BAD A;  3UD9 A;  1XYF A;  4IZE A;  4I96 A;  1ABR B;  2F2F C;  5BQU C;  1JLY A;  3AZV A;  1NUN A;  1EYL A;  2HW9 A;  3ZX7 A;  5E24 E;  5EG6 C;  3AKG A;  2D43 A;  3P6J A;  5BP5 A;  2E4M C;  5D61 A;  3RTI B;  1TFM B;  1WBC A;  2HWA A;  4QBC A;  1M16 A;  4I4P A;  2WBC A;  3FJJ A;  1AVA C;  3V0B A;  1F31 A;  2D24 A;  4LO7 C;  1HWM B;  3O4C A;  5F8W A;  4ZKT B;  3H6R A;  3S8J A;  2Q9X A;  4IHZ A;  4EEE B;  1FV3 A;  2GZB A;  2RG9 B;  3WO2 A;  5F90 A;  4QKR A;  1CE7 B;  5JMC A;  4Q91 A;  1XZZ A;  3OBT A;  4XFS A;  1W3A A;  3N7K A;  1FMM S;  1DFQ A;  1HWN B;  4USO A;  3OBR A;  3VEQ A;  3V0A A;  3BAO A;  3O5W B;  2DRZ A;  1HWP B;  3UDA A;  4H04 A;  2XOA A;  1D0H A;  4USP A;  4P0J A;  4J23 B;  4HR6 C;  4I7I A;  4I4S A;  1HWO B;  3R4S A;  2LIQ A;  3POK A;  3OJM A;  3AJ6 A;  4I1E A;  5DZU A;  4ZBV B;  3O4B A;  4G6M A;  2KKI A;  4HA2 A;  3I2A A;  3O4D A;  2ET2 A;  3O4A A;  2Z49 A;  2ZQN A;  4FGF A;  4G6J A;  4IZX A;  1FGA A;  4KC3 A;  1R8O A;  1I1E A;  5I1B A;  3F62 B;  3HOM A;  1IHK A;  3AKH A;  4MZF B;  2VLC A;  4LO8 B;  5EC5 A;  1FN0 A;  4LO1 C;  4A7K A;  1IIL A;  1RY7 A;  2Y9G A;  3CQA A;  3FJH A;  4F83 A;  3A23 A;  3C9Z A;  5FNX A;  1K5V A;  3CA5 A;  3CA4 A;  4LO2 A;  1DQO A;  21BI A;  3UJ0 A;  4Q9P A;  4F34 A;  3QR5 A;  3FJ9 A;  1ILR 1;  3R4U A;  3WMV A;  3BX1 C;  1QQL A;  2HWM A;  2MC2 A;  2UUS A;  3IM7 A;  3FFZ A;  2Y9W C;  3OJ2 A;  4OWL A;  2MLL B;  2LIE A;  1TIE A;  3O3Q A;  3VT2 A;  1II4 A;  3ZXD A;  2X2T A;  1WD3 A;  2DRY A;  3FGM A;  3ZC9 A;  1K5U A;  1TP0 A;  1S0E A;  3VUO A;  1BLD A;  4JQ0 A;  3N7M A;  4G9M A;  1T4Q A;  4IQP A;  1IJT A;  2NS2 A;  2F2F A;  3BA7 A;  4OEE A;  5BQU A;  1JT5 A;  3VWC A;  1Z2V A;  4ZA3 B;  1YBI A;  2F8X C;  2AQZ A;  4P6A A;  4ZLB B;  1JLX A;  4GP3 A;  5FZU A;  4J2Y A;  1S0G A;  1SR4 C;  4J2X A;  4I2S A;  2E4M A;  3IAG C;  3BAV A;  3FJA A;  1JTC A;  2KLL A;  3NBD A;  2VSA A;  1FV2 A;  4H75 A;  4QAL A;  3BAQ A;  3O49 A;  1RZO B;  4LO3 C;  4KEJ A;  3FUQ A;  1I1B A;  3WIN C;  3PG0 A;  3F1R A;  4ISR A;  4P0K A;  3D7W B;  3H6Q A;  3VSF A;  3WO3 A;  3V0B B;  2YUG A;  4R6U B;  1G9C A;  5EHA A;  3MAL A;  3N0K A;  3CRG A;  3H6R B;  2AAI B;  2J3P A;  4MZH A;  3IM5 A;  5JLV A;  4GP0 A;  4OUJ A;  1T9F A;  3Q7W A;  2QYI B;  3I2X A;  3V0A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...