2DS0A

Crystal structure of the earthworm lectin c-terminal domain mutant in complex with 6'-sialyllactose
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
130
structure length
130
Chain Sequence
PKFFYIKSELNGKVLDIGGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDNVLGVIKSDKGASAHICAWKQHGGPNQKFIIESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 29-kDa galactose-binding lectin
publication title Tailoring a novel sialic acid-binding lectin from a ricin-B chain-like galactose-binding protein by natural evolution-mimicry
pubmed doi rcsb
source organism Lumbricus terrestris
molecule tags Sugar binding protein
total genus 34
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ds0A00
2MLLB 1XHBA 5FNWA 1WD3A 1JT3A 2NP0A 1DFCA 1CE7B 3IAGC 3RTJB 4XFTA 3I2XA 2K4AB 3E8LC 4EFRA 1RG8A 2KI6B 3VSZA 3SNVA 4IY8A 3AJ5A 4HA2A 4KEJA 1SZ6B 2AQZA 1AXMA 1RMLA 3QR5A 3BAVA 1QQKA 3CA3A 1XG6A 4XFSA 3IM7A 2VUAA 3OJ2A 2BEAA 4I4VA 4L4IA 3BX1C 3P6IA 3PHZA 4JP0A 3RMYA 3V0BB 5DUYA 4ENDA 4LO7C 4LO7B 5EG6C 5B2HA 6I1BA 1FMMS 2P23A 1G9CA 1IRAX 3BAUA 4G9MA 3AH4A 2Y9FA 1E0OA 4ZOTA 3IM5A 3POKA 1DJSB 1JQZA 5G00A 4R6UB 3HOMA 3P6JA 3AH2A 3CA5A 3RMXA 3BTAA 4LO1A 2Y9XE 4XKIA 3O4BA 3VUOA 2DREA 4G6JA 1WBAA 4I2SA 3HBWA 1BLAA 3BA5A 3H6RA 4I4UA 1EYLA 5DSSB 4IHZA 3D7WB 3NBNA 3FJ8A 1YBIA 2R9KB 5D62A 2D44A 1S0GA 4I4YA 3FJFA 1AFCA 1W3FA 1JY0A 4IY9A 3S8KA 4LO3A 3BADA 3AH1A 1JT5A 1V6WA 1Q1UA 4OWKA 4GOVA 4OWJA 1BFBA 3OGGA 3HMYA 1JLYA 5BQUC 2J3PA 1KNMA 1DZCA 2FGFA 1QXMA 1IHKA 2D20A 2MC2A 3BRGC 2ESUA 3K1XA 5BXRA 1AVWB 4USOA 3W9TA 3RTIB 4ZKTB 4LO1C 4LO0A 1YYNA 4F83A 3BA4A 1D0HA 2X2SA 3F1RA 3Q7XA 1RY7A 1K5VA 1W3AA 1DQGA 1HWPB 1QQLA 5BVPI 3MPPG 2VXRA 2DRZA 3BAHA 1JT4A 1V6UA 8I1BA 5FNXA 1EPWA 4D0ZA 41BIA 1WBCA 1R8NA 3R4SA 1ISYA 3HN1A 5F8YA 3TC2A 4LO3C 4QBVA 3ILAA 4G1RA 2FDBM 1GGPB 4I4PA 3WA1A 3ZX7A 4I7IA 2F2FA 4IZEA 4QKSA 2Z49A 3LLPA 2GO2A 3V0AB 1F31A 1YF8B 3ZXGA 1AVAC 4LO0C 3H6QA 4ISQA 5BOWA 4P0LA 1L2HA 1ISXA 3A23A 3N7LA 1DLLA 1XYFA 5FZUA 2HWMA 1DFQA 5F90A 2P39A 4QBCA 4I1BA 4OEGA 2D43A 1T4QA 4ZFYB 3OJMA 4I4OA 4X3AA 5I1BA 1G9AA 5GAQA 1FQ9A 2FO1A 4J23B 1BFGA 4CJMA 5E24E 2F2FC 3NBEA 5BXSA 5FZYA 1ABRB 4LO2C 1R8OA 1NUNA 3N7MA 3OBTA 4GP0A 3ZXDA 2GZBA 1S0FA 5JMCA 1VCLA 1JLXA 1PUMB 4USPA 2VSAA 1BFCA 1FN0A 3WO4A 1HWNB 1P63A 4EB2B 1MD6A 4X39A 4FGFA 4GP3A 7I1BA 4J2YA 3HALA 4I3NA 1IT0A 1EVTA 1FGAA 1IILA 2D7RA 1XZZA 2QN4A 3AKHA 5DZUA 1PZZA 4GAIA 1ITBA 5BP5A 4DENA 4A7KA 1DZDA 3WINA 1IJTA 3IM6A 2BEBA 2E4MA 4ZFUB 1HWMB 2NYYA 1HIBA 2IWTB 2D1ZA 4KEIA 1FWVA 2K43A 1J0SA 1BLDA 2NVHA 1AVXB 1TP0A 2KLLA 4AN7B 4G9NA 3BRDA 1AF9A 3IIRA 2D23A 1UPSA 4HR6C 3CA1A 5JLVA 3OGFA 4D0TA 4Z8SB 1DQOA 4IQPA 4G6MA 4YOLA 4ZA3B 1RZOB 4EFQA 1TFMB 4DEPA 1S0CA 1M16A 3I29B 9ILBA 2IHOA 1V6VA 5BP5C 1TWMA 2K8RA 3H6RB 2ERMA 4OEFA 3VT2A 3WINC 2Q3NB 2ZQOA 3BAQA 5EC5A 2NM1A 4ISRA 4I4XA 4QO3A 4I96A 2VSEA 2E4MC 1BA7A 5EHAA 1K5UA 4X38A 2HWAA 4JKQA 3MALA 4I37A 1TOOA 3UJ4A 2L5XA 3VT0A 5BXPA 1A8DA 1SR4A 1EV2A 3FUOA 2RQ9A 3AZWA 2D22A 3VEQA 1S0LA 5BXTA 3FJDA 3ZC9A 3ZC8A 3CAHA 3AZVA 2FFUA 3CA6A 4JPZA 3O49A 3CRGA 3N7KA 3UDAA 1G82A 31BIA 1S0EA 1ILR1 1S0BA 4JAWA 2LIQA 4A7ZA 3CQAA 1Q03A 2Y9GA 1BASA 1WD4A 4I6IA 4OW4A 3H6SE 3CU1B 2WBCA 3PG0A 4D8HA 4Q9GA 1T9FA 1TIEA 2Z48A 3OJVA 4J2KA 4EKXB 1CVSA 4I4QA 3CA4A 1G9BA 2VXTI 2WRYA 3EF2A 3WMVA 3O4OA 1Z2VA 2KH2A 5D61A 1HKNA 1W3GA 5F8WA 1OQLB 1HCEA 2MIBA 1II4A 4Z9WB 3UD9A 2RG9B 2XOAA 1I1EA 1AVUA 1PUUB 4JRAA 1PC8B 4F34A 1PWAA 3FJAA 2BFHA 4I0YA 3NBDA 2NTDA 4OUJA 3BAGA 5HPZA 3HSMA 2HZ9A 4EFPA 2VLCA 3O4CA 4Q9PA 1JTCA 2YUGA 3VT1A 3WMUA 2DRYA 3N0KA 3PMEA 3R4UA 4HJJA 4I8MA 4DCKC 1HCDA 3FGMA 4P6AA 2FFVA 3N7JA 4EEEB 2VU9A 4I1EA 4A7YA 3FJ9A 4OWLA 4GAFA 1IRPA 3BB2A 2KI4A 2D7IA 1DIWA 3B9UA 21BIA 3FJEA 3P53A 4QC4A 4QALA 2Q9XA 5BQUA 4H9WA 3UD8A 4X37A 2RSTA 3BRFA 2AAIB 3NBCA 4FVVA 2AXMA 3NJ5A 1NZKA 3FJHA 4JKXB 1BFFA 3UJ0A 1V6XA 1IOBA 4P0JA 2I1BA 4J2XA 1ISZA 2DS0A 1HWOB 3CA0A 3OBRA 3O3QA 1FV2A 3AKFA 3FJIA 2HW9A 3FJJA 4WBCA 1FV3A 5DVHA 2M49A 1YXWA 3A22A 5FZZA 1JT7A 4KC3A 3S8JA 3WO3A 3JUTA 3I2AA 3VSFA 2X2TA 3FUQA 3O4DA 3A07A 4XFUA 3V79C 4JQ0A 4LO8B 3AJ6A 4P0KA 2QYIB 4II0A 3WO2A 3LTQA 2D24A 3AKIA 1YTOA 2UUSA 3QYDA 2ET2A 1I1BA 1ONKB 2LIEA 4ZFWB 3O5WB 3V0AA 3KMVA 3CRHA 4KBBA 3FJBA 4QKRA 3O44A 3T8SA 3C9ZA 3FJKA 1ISVA 4J2SA 1FWUA 3CRIA 1Z0HA 4H04A 2KKIA 1MC9A 3Q7YA 3A21A 2NZ9A 4IONA 2Y9WC 4IZXA 4AN6A 1Q04A 3F62B 3BAOA 2F8XC 3FJCA 1Z4SA 5F8SA 1G9DA 1FMZA 4ZBVB 1N4KA 4Q91A 4TLPA 2AFGA 1ISWA 3PUBA 3Q7WA 4I4SA 4PC4A 2ZR1B 5D63A 3BA7A 4I4RA 1BARA 4ZLBB 4L4HA 4LO2A 3RSJA 4GOYA 3UD7A 3V0BA 1TTUA 4QD2C 4QD2B 1S0DA 3O4AA 1M2TB 1TWEA 2ZQNA 3FFZA 4ZGRB 4IYBA 1SR4C 4OEEA 3VWCA 3JRRA 3AKGA 4KEKA
chains in the Genus database with same CATH superfamily
2MLLB 1XHBA 5FNWA 1WD3A 1JT3A 2NP0A 1DFCA 1CE7B 3IAGC 3RTJB 4XFTA 3I2XA 2K4AB 3E8LC 4EFRA 1RG8A 2KI6B 3VSZA 3SNVA 4IY8A 3AJ5A 4HA2A 4KEJA 1SZ6B 2AQZA 1AXMA 1RMLA 3QR5A 3BAVA 1QQKA 3CA3A 1XG6A 4XFSA 3IM7A 2VUAA 3OJ2A 2BEAA 4I4VA 4L4IA 3BX1C 3P6IA 3PHZA 4JP0A 3RMYA 3V0BB 5DUYA 4ENDA 4LO7C 4LO7B 5EG6C 5B2HA 6I1BA 1FMMS 2P23A 1G9CA 1IRAX 3BAUA 4G9MA 3AH4A 4UY4A 2Y9FA 1E0OA 4ZOTA 3IM5A 3POKA 1DJSB 1JQZA 5G00A 4R6UB 3HOMA 3P6JA 3AH2A 3CA5A 3RMXA 3BTAA 4LO1A 2Y9XE 4MZFB 4XKIA 3O4BA 3VUOA 2DREA 4G6JA 1WBAA 4I2SA 3HBWA 1BLAA 3BA5A 3H6RA 4I4UA 1EYLA 5DSSB 4IHZA 3D7WB 3NBNA 3FJ8A 1YBIA 2R9KB 5D62A 2D44A 1S0GA 4I4YA 3FJFA 1AFCA 1W3FA 1JY0A 4IY9A 3S8KA 4LO3A 3BADA 3AH1A 1JT5A 1V6WA 1Q1UA 4OWKA 4GOVA 4OWJA 1BFBA 3OGGA 3HMYA 1JLYA 5BQUC 2J3PA 1KNMA 1DZCA 2FGFA 1QXMA 1IHKA 2D20A 2MC2A 3BRGC 2ESUA 3K1XA 5BXRA 1AVWB 4USOA 3W9TA 3RTIB 4ZKTB 4LO1C 4LO0A 1YYNA 4F83A 3BA4A 1D0HA 2X2SA 3F1RA 3Q7XA 1RY7A 1K5VA 1W3AA 1DQGA 1HWPB 1QQLA 5BVPI 3MPPG 2VXRA 2DRZA 3BAHA 1JT4A 1V6UA 8I1BA 5FNXA 1EPWA 4D0ZA 41BIA 1WBCA 1R8NA 3R4SA 1ISYA 3HN1A 5F8YA 3TC2A 4LO3C 4QBVA 3ILAA 4G1RA 2FDBM 1GGPB 4I4PA 3WA1A 3ZX7A 4I7IA 2F2FA 4IZEA 4QKSA 2Z49A 3LLPA 2GO2A 3V0AB 1F31A 1YF8B 3ZXGA 1AVAC 4LO0C 3H6QA 4ISQA 5BOWA 4P0LA 1L2HA 1ISXA 3A23A 3N7LA 1DLLA 1XYFA 5FZUA 2HWMA 1DFQA 5F90A 2P39A 4QBCA 4I1BA 4OEGA 2D43A 1T4QA 4ZFYB 3OJMA 4I4OA 4X3AA 5I1BA 1G9AA 5GAQA 1FQ9A 2FO1A 4J23B 1BFGA 4CJMA 5E24E 2F2FC 3NBEA 5BXSA 5FZYA 1ABRB 4LO2C 1R8OA 1NUNA 3N7MA 3OBTA 4GP0A 3ZXDA 2GZBA 1S0FA 5JMCA 1VCLA 1JLXA 1PUMB 4USPA 2VSAA 1BFCA 1FN0A 3WO4A 1HWNB 1P63A 4EB2B 1MD6A 4X39A 4FGFA 4GP3A 7I1BA 4J2YA 3HALA 4I3NA 1IT0A 1EVTA 1FGAA 1IILA 2D7RA 1XZZA 2QN4A 3AKHA 5DZUA 1PZZA 4GAIA 1ITBA 5BP5A 4DENA 4A7KA 1DZDA 3WINA 1IJTA 3IM6A 2BEBA 2E4MA 4ZFUB 1HWMB 2NYYA 1HIBA 2IWTB 2D1ZA 4KEIA 1FWVA 2K43A 1J0SA 1BLDA 2NVHA 1AVXB 1TP0A 2KLLA 4AN7B 4G9NA 3BRDA 1AF9A 3IIRA 2D23A 1UPSA 4HR6C 3CA1A 5JLVA 3OGFA 4D0TA 4Z8SB 1DQOA 4IQPA 4G6MA 4YOLA 4ZA3B 1RZOB 4EFQA 1TFMB 4DEPA 1S0CA 1M16A 3I29B 9ILBA 2IHOA 1V6VA 5BP5C 1TWMA 2K8RA 3H6RB 2ERMA 4OEFA 3VT2A 3WINC 2Q3NB 2ZQOA 3BAQA 5EC5A 2NM1A 4ISRA 4I4XA 4QO3A 4I96A 2VSEA 2E4MC 1BA7A 5EHAA 1K5UA 4X38A 2HWAA 4JKQA 3MALA 4I37A 1TOOA 3UJ4A 2L5XA 3VT0A 5BXPA 1A8DA 4MZHA 1SR4A 1EV2A 3FUOA 2RQ9A 3AZWA 2D22A 3VEQA 1S0LA 5BXTA 3FJDA 3ZC9A 3ZC8A 4H75A 3CAHA 3AZVA 2FFUA 3CA6A 4JPZA 3O49A 3CRGA 2NS2A 3N7KA 3UDAA 1G82A 31BIA 1S0EA 1ILR1 1S0BA 4JAWA 2LIQA 4A7ZA 3CQAA 1Q03A 2Y9GA 1BASA 1WD4A 4I6IA 4OW4A 3H6SE 3CU1B 2WBCA 3PG0A 4D8HA 4Q9GA 1T9FA 1TIEA 2Z48A 3OJVA 4J2KA 4EKXB 1CVSA 4I4QA 3CA4A 1G9BA 2VXTI 2WRYA 3EF2A 3WMVA 3O4OA 1Z2VA 2KH2A 5D61A 1HKNA 1W3GA 5F8WA 1OQLB 1HCEA 2MIBA 1II4A 4Z9WB 3UD9A 2RG9B 2XOAA 1I1EA 1AVUA 1PUUB 4JRAA 1PC8B 4F34A 1PWAA 3FJAA 2BFHA 4I0YA 3NBDA 2NTDA 4OUJA 3BAGA 5HPZA 3HSMA 2HZ9A 4EFPA 2VLCA 3O4CA 4Q9PA 1JTCA 2YUGA 3VT1A 3WMUA 2DRYA 3N0KA 3PMEA 3R4UA 4HJJA 4I8MA 4DCKC 1HCDA 3FGMA 4P6AA 2FFVA 3N7JA 4EEEB 2VU9A 4I1EA 4A7YA 3FJ9A 4OWLA 4GAFA 1IRPA 3BB2A 2KI4A 2D7IA 1DIWA 3B9UA 21BIA 3FJEA 3P53A 4QC4A 4QALA 2Q9XA 5BQUA 4H9WA 3UD8A 4X37A 2RSTA 3BRFA 2AAIB 3NBCA 4FVVA 2AXMA 3NJ5A 1NZKA 3FJHA 4JKXB 1BFFA 3UJ0A 1V6XA 1IOBA 4P0JA 2I1BA 4J2XA 1ISZA 2DS0A 1HWOB 3CA0A 3OBRA 3O3QA 1FV2A 3AKFA 3FJIA 2HW9A 3FJJA 4WBCA 1FV3A 5DVHA 2M49A 1YXWA 3A22A 5FZZA 1JT7A 4KC3A 3S8JA 3WO3A 3JUTA 3I2AA 3VSFA 2X2TA 3FUQA 3O4DA 3A07A 4XFUA 3V79C 4JQ0A 4LO8B 3AJ6A 4P0KA 2QYIB 4II0A 3WO2A 3LTQA 2D24A 3AKIA 1YTOA 2UUSA 3QYDA 2ET2A 1I1BA 4MZGB 1ONKB 2LIEA 4ZFWB 3O5WB 3V0AA 3KMVA 3CRHA 4KBBA 3FJBA 4QKRA 3O44A 3T8SA 3C9ZA 3FJKA 1ISVA 4J2SA 1FWUA 3CRIA 1Z0HA 4H04A 2KKIA 1MC9A 3Q7YA 3A21A 2NZ9A 4IONA 2Y9WC 4IZXA 4AN6A 1Q04A 3F62B 3BAOA 2F8XC 3FJCA 1Z4SA 5F8SA 1G9DA 1FMZA 4ZBVB 1N4KA 4Q91A 4TLPA 2AFGA 1ISWA 3PUBA 3Q7WA 4I4SA 4PC4A 2ZR1B 5D63A 3BA7A 4I4RA 1BARA 4ZLBB 4L4HA 4LO2A 3RSJA 4GOYA 3UD7A 3V0BA 1TTUA 4QD2C 4QD2B 1S0DA 3O4AA 1M2TB 1TWEA 2ZQNA 3FFZA 4ZGRB 4IYBA 1SR4C 4OEEA 3VWCA 3JRRA 3AKGA 4KEKA
chains in the Genus database with same CATH topology
2MLLB 1XHBA 5FNWA 1WD3A 1JT3A 2NP0A 1DFCA 1CE7B 3IAGC 3RTJB 4XFTA 3I2XA 2K4AB 3E8LC 4EFRA 1RG8A 2KI6B 3VSZA 3SNVA 4IY8A 3AJ5A 4HA2A 4KEJA 1SZ6B 2AQZA 1AXMA 1RMLA 3QR5A 3BAVA 1QQKA 3CA3A 1XG6A 4XFSA 3IM7A 2VUAA 3OJ2A 2BEAA 4I4VA 4L4IA 3BX1C 3P6IA 3PHZA 4JP0A 3RMYA 3V0BB 5DUYA 4ENDA 4LO7C 4LO7B 5EG6C 5B2HA 6I1BA 1FMMS 2P23A 1G9CA 1IRAX 3BAUA 4G9MA 3AH4A 4UY4A 2Y9FA 1E0OA 4ZOTA 3IM5A 3POKA 1DJSB 1JQZA 5G00A 4R6UB 3HOMA 3P6JA 3AH2A 3CA5A 3RMXA 3BTAA 4LO1A 2Y9XE 4MZFB 4XKIA 3O4BA 3VUOA 2DREA 4G6JA 1WBAA 4I2SA 3HBWA 1BLAA 3BA5A 3H6RA 4I4UA 1EYLA 5DSSB 4IHZA 3D7WB 3NBNA 3FJ8A 1YBIA 2R9KB 5D62A 2D44A 1S0GA 4I4YA 3FJFA 1AFCA 1W3FA 1JY0A 4IY9A 3S8KA 4LO3A 3BADA 3AH1A 1JT5A 1V6WA 1Q1UA 4OWKA 4GOVA 4OWJA 1BFBA 3OGGA 3HMYA 1JLYA 5BQUC 2J3PA 1KNMA 1DZCA 2FGFA 1QXMA 1IHKA 2D20A 2MC2A 3BRGC 2ESUA 3K1XA 5BXRA 1AVWB 4USOA 3W9TA 3RTIB 4ZKTB 4LO1C 4LO0A 1YYNA 4F83A 3BA4A 1D0HA 2X2SA 3F1RA 3Q7XA 1RY7A 1K5VA 1W3AA 1DQGA 1HWPB 1QQLA 5BVPI 3MPPG 2VXRA 2DRZA 3BAHA 1JT4A 1V6UA 8I1BA 5FNXA 1EPWA 4D0ZA 41BIA 1WBCA 1R8NA 3R4SA 1ISYA 3HN1A 5F8YA 3TC2A 4LO3C 4QBVA 3ILAA 4G1RA 2FDBM 1GGPB 4I4PA 3WA1A 3ZX7A 4I7IA 2F2FA 4IZEA 4QKSA 2Z49A 3LLPA 2GO2A 3V0AB 1F31A 1YF8B 3ZXGA 1AVAC 4LO0C 3H6QA 4ISQA 5BOWA 4P0LA 1L2HA 1ISXA 3A23A 3N7LA 1DLLA 1XYFA 5FZUA 2HWMA 1DFQA 5F90A 2P39A 4QBCA 4I1BA 4OEGA 2D43A 1T4QA 4ZFYB 3OJMA 4I4OA 4X3AA 5I1BA 1G9AA 5GAQA 1FQ9A 2FO1A 4J23B 1BFGA 4CJMA 5E24E 2F2FC 3NBEA 5BXSA 5FZYA 1ABRB 4LO2C 1R8OA 1NUNA 3N7MA 3OBTA 4GP0A 3ZXDA 2GZBA 1S0FA 5JMCA 1VCLA 1JLXA 1PUMB 4USPA 2VSAA 1BFCA 1FN0A 3WO4A 1HWNB 1P63A 4EB2B 1MD6A 4X39A 4FGFA 4GP3A 7I1BA 4J2YA 3HALA 4I3NA 1IT0A 1EVTA 1FGAA 1IILA 2D7RA 1XZZA 2QN4A 3AKHA 5DZUA 1PZZA 4GAIA 1ITBA 5BP5A 4DENA 4A7KA 1DZDA 3WINA 1IJTA 3IM6A 2BEBA 2E4MA 4ZFUB 1HWMB 2NYYA 1HIBA 2IWTB 2D1ZA 4KEIA 1FWVA 2K43A 1J0SA 1BLDA 2NVHA 1AVXB 1TP0A 2KLLA 4AN7B 4G9NA 3BRDA 1AF9A 3IIRA 2D23A 1UPSA 4HR6C 3CA1A 5JLVA 3OGFA 4D0TA 4Z8SB 1DQOA 4IQPA 4G6MA 4YOLA 4ZA3B 1RZOB 4EFQA 1TFMB 4DEPA 1S0CA 1M16A 3I29B 9ILBA 2IHOA 1V6VA 5BP5C 1TWMA 2K8RA 3H6RB 2ERMA 4OEFA 3VT2A 3WINC 2Q3NB 2ZQOA 3BAQA 5EC5A 2NM1A 4ISRA 4I4XA 4QO3A 4I96A 2VSEA 2E4MC 1BA7A 5EHAA 1K5UA 4X38A 2HWAA 4JKQA 3MALA 4I37A 1TOOA 3UJ4A 2L5XA 3VT0A 5BXPA 1A8DA 4MZHA 1SR4A 1EV2A 3FUOA 2RQ9A 3AZWA 2D22A 3VEQA 1S0LA 5BXTA 3FJDA 3ZC9A 3ZC8A 4H75A 3CAHA 3AZVA 2FFUA 3CA6A 4JPZA 3O49A 3CRGA 2NS2A 3N7KA 3UDAA 1G82A 31BIA 1S0EA 1ILR1 1S0BA 4JAWA 2LIQA 4A7ZA 3CQAA 1Q03A 2Y9GA 1BASA 1WD4A 4I6IA 4OW4A 3H6SE 3CU1B 2WBCA 3PG0A 4D8HA 4Q9GA 1T9FA 1TIEA 2Z48A 3OJVA 4J2KA 4EKXB 1CVSA 4I4QA 3CA4A 1G9BA 2VXTI 2WRYA 3EF2A 3WMVA 3O4OA 1Z2VA 2KH2A 5D61A 1HKNA 1W3GA 5F8WA 1OQLB 1HCEA 2MIBA 1II4A 4Z9WB 3UD9A 2RG9B 2XOAA 1I1EA 1AVUA 1PUUB 4JRAA 1PC8B 4F34A 1PWAA 3FJAA 2BFHA 4I0YA 3NBDA 2NTDA 4OUJA 3BAGA 5HPZA 3HSMA 2HZ9A 4EFPA 2VLCA 3O4CA 4Q9PA 1JTCA 2YUGA 3VT1A 3WMUA 2DRYA 3N0KA 3PMEA 3R4UA 4HJJA 4I8MA 4DCKC 1HCDA 3FGMA 4P6AA 2FFVA 3N7JA 4EEEB 2VU9A 4I1EA 4A7YA 3FJ9A 4OWLA 4GAFA 1IRPA 3BB2A 2KI4A 2D7IA 1DIWA 3B9UA 21BIA 3FJEA 3P53A 4QC4A 4QALA 2Q9XA 5BQUA 4H9WA 3UD8A 4X37A 2RSTA 3BRFA 2AAIB 3NBCA 4FVVA 2AXMA 3NJ5A 1NZKA 3FJHA 4JKXB 1BFFA 3UJ0A 1V6XA 1IOBA 4P0JA 2I1BA 4J2XA 1ISZA 2DS0A 1HWOB 3CA0A 3OBRA 3O3QA 1FV2A 3AKFA 3FJIA 2HW9A 3FJJA 4WBCA 1FV3A 5DVHA 2M49A 1YXWA 3A22A 5FZZA 1JT7A 4KC3A 3S8JA 3WO3A 3JUTA 3I2AA 3VSFA 2X2TA 3FUQA 3O4DA 3A07A 4XFUA 3V79C 4JQ0A 4LO8B 3AJ6A 4P0KA 2QYIB 4II0A 3WO2A 3LTQA 2D24A 3AKIA 1YTOA 2UUSA 3QYDA 2ET2A 1I1BA 4MZGB 1ONKB 2LIEA 4ZFWB 3O5WB 3V0AA 3KMVA 3CRHA 4KBBA 3FJBA 4QKRA 3O44A 3T8SA 3C9ZA 3FJKA 1ISVA 4J2SA 1FWUA 3CRIA 1Z0HA 4H04A 2KKIA 1MC9A 3Q7YA 3A21A 2NZ9A 4IONA 2Y9WC 4IZXA 4AN6A 1Q04A 3F62B 3BAOA 2F8XC 3FJCA 1Z4SA 5F8SA 1G9DA 1FMZA 4ZBVB 1N4KA 4Q91A 4TLPA 2AFGA 1ISWA 3PUBA 3Q7WA 4I4SA 4PC4A 2ZR1B 5D63A 3BA7A 4I4RA 1BARA 4ZLBB 4L4HA 4LO2A 3RSJA 4GOYA 3UD7A 3V0BA 1TTUA 4QD2C 4QD2B 1S0DA 3O4AA 1M2TB 1TWEA 2ZQNA 3FFZA 4ZGRB 4IYBA 1SR4C 4OEEA 3VWCA 3JRRA 3AKGA 4KEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLL B;  1XHB A;  5FNW A;  1WD3 A;  1JT3 A;  2NP0 A;  1DFC A;  1CE7 B;  3IAG C;  3RTJ B;  4XFT A;  3I2X A;  2K4A B;  3E8L C;  4EFR A;  1RG8 A;  2KI6 B;  3VSZ A;  3SNV A;  4IY8 A;  3AJ5 A;  4HA2 A;  4KEJ A;  1SZ6 B;  2AQZ A;  1AXM A;  1RML A;  3QR5 A;  3BAV A;  1QQK A;  3CA3 A;  1XG6 A;  4XFS A;  3IM7 A;  2VUA A;  3OJ2 A;  2BEA A;  4I4V A;  4L4I A;  3BX1 C;  3P6I A;  3PHZ A;  4JP0 A;  3RMY A;  3V0B B;  5DUY A;  4END A;  4LO7 C;  4LO7 B;  5EG6 C;  5B2H A;  6I1B A;  1FMM S;  2P23 A;  1G9C A;  1IRA X;  3BAU A;  4G9M A;  3AH4 A;  2Y9F A;  1E0O A;  4ZOT A;  3IM5 A;  3POK A;  1DJS B;  1JQZ A;  5G00 A;  4R6U B;  3HOM A;  3P6J A;  3AH2 A;  3CA5 A;  3RMX A;  3BTA A;  4LO1 A;  2Y9X E;  4XKI A;  3O4B A;  3VUO A;  2DRE A;  4G6J A;  1WBA A;  4I2S A;  3HBW A;  1BLA A;  3BA5 A;  3H6R A;  4I4U A;  1EYL A;  5DSS B;  4IHZ A;  3D7W B;  3NBN A;  3FJ8 A;  1YBI A;  2R9K B;  5D62 A;  2D44 A;  1S0G A;  4I4Y A;  3FJF A;  1AFC A;  1W3F A;  1JY0 A;  4IY9 A;  3S8K A;  4LO3 A;  3BAD A;  3AH1 A;  1JT5 A;  1V6W A;  1Q1U A;  4OWK A;  4GOV A;  4OWJ A;  1BFB A;  3OGG A;  3HMY A;  1JLY A;  5BQU C;  2J3P A;  1KNM A;  1DZC A;  2FGF A;  1QXM A;  1IHK A;  2D20 A;  2MC2 A;  3BRG C;  2ESU A;  3K1X A;  5BXR A;  1AVW B;  4USO A;  3W9T A;  3RTI B;  4ZKT B;  4LO1 C;  4LO0 A;  1YYN A;  4F83 A;  3BA4 A;  1D0H A;  2X2S A;  3F1R A;  3Q7X A;  1RY7 A;  1K5V A;  1W3A A;  1DQG A;  1HWP B;  1QQL A;  5BVP I;  3MPP G;  2VXR A;  2DRZ A;  3BAH A;  1JT4 A;  1V6U A;  8I1B A;  5FNX A;  1EPW A;  4D0Z A;  41BI A;  1WBC A;  1R8N A;  3R4S A;  1ISY A;  3HN1 A;  5F8Y A;  3TC2 A;  4LO3 C;  4QBV A;  3ILA A;  4G1R A;  2FDB M;  1GGP B;  4I4P A;  3WA1 A;  3ZX7 A;  4I7I A;  2F2F A;  4IZE A;  4QKS A;  2Z49 A;  3LLP A;  2GO2 A;  3V0A B;  1F31 A;  1YF8 B;  3ZXG A;  1AVA C;  4LO0 C;  3H6Q A;  4ISQ A;  5BOW A;  4P0L A;  1L2H A;  1ISX A;  3A23 A;  3N7L A;  1DLL A;  1XYF A;  5FZU A;  2HWM A;  1DFQ A;  5F90 A;  2P39 A;  4QBC A;  4I1B A;  4OEG A;  2D43 A;  1T4Q A;  4ZFY B;  3OJM A;  4I4O A;  4X3A A;  5I1B A;  1G9A A;  5GAQ A;  1FQ9 A;  2FO1 A;  4J23 B;  1BFG A;  4CJM A;  5E24 E;  2F2F C;  3NBE A;  5BXS A;  5FZY A;  1ABR B;  4LO2 C;  1R8O A;  1NUN A;  3N7M A;  3OBT A;  4GP0 A;  3ZXD A;  2GZB A;  1S0F A;  5JMC A;  1VCL A;  1JLX A;  1PUM B;  4USP A;  2VSA A;  1BFC A;  1FN0 A;  3WO4 A;  1HWN B;  1P63 A;  4EB2 B;  1MD6 A;  4X39 A;  4FGF A;  4GP3 A;  7I1B A;  4J2Y A;  3HAL A;  4I3N A;  1IT0 A;  1EVT A;  1FGA A;  1IIL A;  2D7R A;  1XZZ A;  2QN4 A;  3AKH A;  5DZU A;  1PZZ A;  4GAI A;  1ITB A;  5BP5 A;  4DEN A;  4A7K A;  1DZD A;  3WIN A;  1IJT A;  3IM6 A;  2BEB A;  2E4M A;  4ZFU B;  1HWM B;  2NYY A;  1HIB A;  2IWT B;  2D1Z A;  4KEI A;  1FWV A;  2K43 A;  1J0S A;  1BLD A;  2NVH A;  1AVX B;  1TP0 A;  2KLL A;  4AN7 B;  4G9N A;  3BRD A;  1AF9 A;  3IIR A;  2D23 A;  1UPS A;  4HR6 C;  3CA1 A;  5JLV A;  3OGF A;  4D0T A;  4Z8S B;  1DQO A;  4IQP A;  4G6M A;  4YOL A;  4ZA3 B;  1RZO B;  4EFQ A;  1TFM B;  4DEP A;  1S0C A;  1M16 A;  3I29 B;  9ILB A;  2IHO A;  1V6V A;  5BP5 C;  1TWM A;  2K8R A;  3H6R B;  2ERM A;  4OEF A;  3VT2 A;  3WIN C;  2Q3N B;  2ZQO A;  3BAQ A;  5EC5 A;  2NM1 A;  4ISR A;  4I4X A;  4QO3 A;  4I96 A;  2VSE A;  2E4M C;  1BA7 A;  5EHA A;  1K5U A;  4X38 A;  2HWA A;  4JKQ A;  3MAL A;  4I37 A;  1TOO A;  3UJ4 A;  2L5X A;  3VT0 A;  5BXP A;  1A8D A;  1SR4 A;  1EV2 A;  3FUO A;  2RQ9 A;  3AZW A;  2D22 A;  3VEQ A;  1S0L A;  5BXT A;  3FJD A;  3ZC9 A;  3ZC8 A;  3CAH A;  3AZV A;  2FFU A;  3CA6 A;  4JPZ A;  3O49 A;  3CRG A;  3N7K A;  3UDA A;  1G82 A;  31BI A;  1S0E A;  1ILR 1;  1S0B A;  4JAW A;  2LIQ A;  4A7Z A;  3CQA A;  1Q03 A;  2Y9G A;  1BAS A;  1WD4 A;  4I6I A;  4OW4 A;  3H6S E;  3CU1 B;  2WBC A;  3PG0 A;  4D8H A;  4Q9G A;  1T9F A;  1TIE A;  2Z48 A;  3OJV A;  4J2K A;  4EKX B;  1CVS A;  4I4Q A;  3CA4 A;  1G9B A;  2VXT I;  2WRY A;  3EF2 A;  3WMV A;  3O4O A;  1Z2V A;  2KH2 A;  5D61 A;  1HKN A;  1W3G A;  5F8W A;  1OQL B;  1HCE A;  2MIB A;  1II4 A;  4Z9W B;  3UD9 A;  2RG9 B;  2XOA A;  1I1E A;  1AVU A;  1PUU B;  4JRA A;  1PC8 B;  4F34 A;  1PWA A;  3FJA A;  2BFH A;  4I0Y A;  3NBD A;  2NTD A;  4OUJ A;  3BAG A;  5HPZ A;  3HSM A;  2HZ9 A;  4EFP A;  2VLC A;  3O4C A;  4Q9P A;  1JTC A;  2YUG A;  3VT1 A;  3WMU A;  2DRY A;  3N0K A;  3PME A;  3R4U A;  4HJJ A;  4I8M A;  4DCK C;  1HCD A;  3FGM A;  4P6A A;  2FFV A;  3N7J A;  4EEE B;  2VU9 A;  4I1E A;  4A7Y A;  3FJ9 A;  4OWL A;  4GAF A;  1IRP A;  3BB2 A;  2KI4 A;  2D7I A;  1DIW A;  3B9U A;  21BI A;  3FJE A;  3P53 A;  4QC4 A;  4QAL A;  2Q9X A;  5BQU A;  4H9W A;  3UD8 A;  4X37 A;  2RST A;  3BRF A;  2AAI B;  3NBC A;  4FVV A;  2AXM A;  3NJ5 A;  1NZK A;  3FJH A;  4JKX B;  1BFF A;  3UJ0 A;  1V6X A;  1IOB A;  4P0J A;  2I1B A;  4J2X A;  1ISZ A;  2DS0 A;  1HWO B;  3CA0 A;  3OBR A;  3O3Q A;  1FV2 A;  3AKF A;  3FJI A;  2HW9 A;  3FJJ A;  4WBC A;  1FV3 A;  5DVH A;  2M49 A;  1YXW A;  3A22 A;  5FZZ A;  1JT7 A;  4KC3 A;  3S8J A;  3WO3 A;  3JUT A;  3I2A A;  3VSF A;  2X2T A;  3FUQ A;  3O4D A;  3A07 A;  4XFU A;  3V79 C;  4JQ0 A;  4LO8 B;  3AJ6 A;  4P0K A;  2QYI B;  4II0 A;  3WO2 A;  3LTQ A;  2D24 A;  3AKI A;  1YTO A;  2UUS A;  3QYD A;  2ET2 A;  1I1B A;  1ONK B;  2LIE A;  4ZFW B;  3O5W B;  3V0A A;  3KMV A;  3CRH A;  4KBB A;  3FJB A;  4QKR A;  3O44 A;  3T8S A;  3C9Z A;  3FJK A;  1ISV A;  4J2S A;  1FWU A;  3CRI A;  1Z0H A;  4H04 A;  2KKI A;  1MC9 A;  3Q7Y A;  3A21 A;  2NZ9 A;  4ION A;  2Y9W C;  4IZX A;  4AN6 A;  1Q04 A;  3F62 B;  3BAO A;  2F8X C;  3FJC A;  1Z4S A;  5F8S A;  1G9D A;  1FMZ A;  4ZBV B;  1N4K A;  4Q91 A;  4TLP A;  2AFG A;  1ISW A;  3PUB A;  3Q7W A;  4I4S A;  4PC4 A;  2ZR1 B;  5D63 A;  3BA7 A;  4I4R A;  1BAR A;  4ZLB B;  4L4H A;  4LO2 A;  3RSJ A;  4GOY A;  3UD7 A;  3V0B A;  1TTU A;  4QD2 C;  4QD2 B;  1S0D A;  3O4A A;  1M2T B;  1TWE A;  2ZQN A;  3FFZ A;  4ZGR B;  4IYB A;  1SR4 C;  4OEE A;  3VWC A;  3JRR A;  3AKG A;  4KEK A; 
#chains in the Genus database with same CATH topology
 2MLL B;  1XHB A;  5FNW A;  1WD3 A;  1JT3 A;  2NP0 A;  1DFC A;  1CE7 B;  3IAG C;  3RTJ B;  4XFT A;  3I2X A;  2K4A B;  3E8L C;  4EFR A;  1RG8 A;  2KI6 B;  3VSZ A;  3SNV A;  4IY8 A;  3AJ5 A;  4HA2 A;  4KEJ A;  1SZ6 B;  2AQZ A;  1AXM A;  1RML A;  3QR5 A;  3BAV A;  1QQK A;  3CA3 A;  1XG6 A;  4XFS A;  3IM7 A;  2VUA A;  3OJ2 A;  2BEA A;  4I4V A;  4L4I A;  3BX1 C;  3P6I A;  3PHZ A;  4JP0 A;  3RMY A;  3V0B B;  5DUY A;  4END A;  4LO7 C;  4LO7 B;  5EG6 C;  5B2H A;  6I1B A;  1FMM S;  2P23 A;  1G9C A;  1IRA X;  3BAU A;  4G9M A;  3AH4 A;  4UY4 A;  2Y9F A;  1E0O A;  4ZOT A;  3IM5 A;  3POK A;  1DJS B;  1JQZ A;  5G00 A;  4R6U B;  3HOM A;  3P6J A;  3AH2 A;  3CA5 A;  3RMX A;  3BTA A;  4LO1 A;  2Y9X E;  4MZF B;  4XKI A;  3O4B A;  3VUO A;  2DRE A;  4G6J A;  1WBA A;  4I2S A;  3HBW A;  1BLA A;  3BA5 A;  3H6R A;  4I4U A;  1EYL A;  5DSS B;  4IHZ A;  3D7W B;  3NBN A;  3FJ8 A;  1YBI A;  2R9K B;  5D62 A;  2D44 A;  1S0G A;  4I4Y A;  3FJF A;  1AFC A;  1W3F A;  1JY0 A;  4IY9 A;  3S8K A;  4LO3 A;  3BAD A;  3AH1 A;  1JT5 A;  1V6W A;  1Q1U A;  4OWK A;  4GOV A;  4OWJ A;  1BFB A;  3OGG A;  3HMY A;  1JLY A;  5BQU C;  2J3P A;  1KNM A;  1DZC A;  2FGF A;  1QXM A;  1IHK A;  2D20 A;  2MC2 A;  3BRG C;  2ESU A;  3K1X A;  5BXR A;  1AVW B;  4USO A;  3W9T A;  3RTI B;  4ZKT B;  4LO1 C;  4LO0 A;  1YYN A;  4F83 A;  3BA4 A;  1D0H A;  2X2S A;  3F1R A;  3Q7X A;  1RY7 A;  1K5V A;  1W3A A;  1DQG A;  1HWP B;  1QQL A;  5BVP I;  3MPP G;  2VXR A;  2DRZ A;  3BAH A;  1JT4 A;  1V6U A;  8I1B A;  5FNX A;  1EPW A;  4D0Z A;  41BI A;  1WBC A;  1R8N A;  3R4S A;  1ISY A;  3HN1 A;  5F8Y A;  3TC2 A;  4LO3 C;  4QBV A;  3ILA A;  4G1R A;  2FDB M;  1GGP B;  4I4P A;  3WA1 A;  3ZX7 A;  4I7I A;  2F2F A;  4IZE A;  4QKS A;  2Z49 A;  3LLP A;  2GO2 A;  3V0A B;  1F31 A;  1YF8 B;  3ZXG A;  1AVA C;  4LO0 C;  3H6Q A;  4ISQ A;  5BOW A;  4P0L A;  1L2H A;  1ISX A;  3A23 A;  3N7L A;  1DLL A;  1XYF A;  5FZU A;  2HWM A;  1DFQ A;  5F90 A;  2P39 A;  4QBC A;  4I1B A;  4OEG A;  2D43 A;  1T4Q A;  4ZFY B;  3OJM A;  4I4O A;  4X3A A;  5I1B A;  1G9A A;  5GAQ A;  1FQ9 A;  2FO1 A;  4J23 B;  1BFG A;  4CJM A;  5E24 E;  2F2F C;  3NBE A;  5BXS A;  5FZY A;  1ABR B;  4LO2 C;  1R8O A;  1NUN A;  3N7M A;  3OBT A;  4GP0 A;  3ZXD A;  2GZB A;  1S0F A;  5JMC A;  1VCL A;  1JLX A;  1PUM B;  4USP A;  2VSA A;  1BFC A;  1FN0 A;  3WO4 A;  1HWN B;  1P63 A;  4EB2 B;  1MD6 A;  4X39 A;  4FGF A;  4GP3 A;  7I1B A;  4J2Y A;  3HAL A;  4I3N A;  1IT0 A;  1EVT A;  1FGA A;  1IIL A;  2D7R A;  1XZZ A;  2QN4 A;  3AKH A;  5DZU A;  1PZZ A;  4GAI A;  1ITB A;  5BP5 A;  4DEN A;  4A7K A;  1DZD A;  3WIN A;  1IJT A;  3IM6 A;  2BEB A;  2E4M A;  4ZFU B;  1HWM B;  2NYY A;  1HIB A;  2IWT B;  2D1Z A;  4KEI A;  1FWV A;  2K43 A;  1J0S A;  1BLD A;  2NVH A;  1AVX B;  1TP0 A;  2KLL A;  4AN7 B;  4G9N A;  3BRD A;  1AF9 A;  3IIR A;  2D23 A;  1UPS A;  4HR6 C;  3CA1 A;  5JLV A;  3OGF A;  4D0T A;  4Z8S B;  1DQO A;  4IQP A;  4G6M A;  4YOL A;  4ZA3 B;  1RZO B;  4EFQ A;  1TFM B;  4DEP A;  1S0C A;  1M16 A;  3I29 B;  9ILB A;  2IHO A;  1V6V A;  5BP5 C;  1TWM A;  2K8R A;  3H6R B;  2ERM A;  4OEF A;  3VT2 A;  3WIN C;  2Q3N B;  2ZQO A;  3BAQ A;  5EC5 A;  2NM1 A;  4ISR A;  4I4X A;  4QO3 A;  4I96 A;  2VSE A;  2E4M C;  1BA7 A;  5EHA A;  1K5U A;  4X38 A;  2HWA A;  4JKQ A;  3MAL A;  4I37 A;  1TOO A;  3UJ4 A;  2L5X A;  3VT0 A;  5BXP A;  1A8D A;  4MZH A;  1SR4 A;  1EV2 A;  3FUO A;  2RQ9 A;  3AZW A;  2D22 A;  3VEQ A;  1S0L A;  5BXT A;  3FJD A;  3ZC9 A;  3ZC8 A;  4H75 A;  3CAH A;  3AZV A;  2FFU A;  3CA6 A;  4JPZ A;  3O49 A;  3CRG A;  2NS2 A;  3N7K A;  3UDA A;  1G82 A;  31BI A;  1S0E A;  1ILR 1;  1S0B A;  4JAW A;  2LIQ A;  4A7Z A;  3CQA A;  1Q03 A;  2Y9G A;  1BAS A;  1WD4 A;  4I6I A;  4OW4 A;  3H6S E;  3CU1 B;  2WBC A;  3PG0 A;  4D8H A;  4Q9G A;  1T9F A;  1TIE A;  2Z48 A;  3OJV A;  4J2K A;  4EKX B;  1CVS A;  4I4Q A;  3CA4 A;  1G9B A;  2VXT I;  2WRY A;  3EF2 A;  3WMV A;  3O4O A;  1Z2V A;  2KH2 A;  5D61 A;  1HKN A;  1W3G A;  5F8W A;  1OQL B;  1HCE A;  2MIB A;  1II4 A;  4Z9W B;  3UD9 A;  2RG9 B;  2XOA A;  1I1E A;  1AVU A;  1PUU B;  4JRA A;  1PC8 B;  4F34 A;  1PWA A;  3FJA A;  2BFH A;  4I0Y A;  3NBD A;  2NTD A;  4OUJ A;  3BAG A;  5HPZ A;  3HSM A;  2HZ9 A;  4EFP A;  2VLC A;  3O4C A;  4Q9P A;  1JTC A;  2YUG A;  3VT1 A;  3WMU A;  2DRY A;  3N0K A;  3PME A;  3R4U A;  4HJJ A;  4I8M A;  4DCK C;  1HCD A;  3FGM A;  4P6A A;  2FFV A;  3N7J A;  4EEE B;  2VU9 A;  4I1E A;  4A7Y A;  3FJ9 A;  4OWL A;  4GAF A;  1IRP A;  3BB2 A;  2KI4 A;  2D7I A;  1DIW A;  3B9U A;  21BI A;  3FJE A;  3P53 A;  4QC4 A;  4QAL A;  2Q9X A;  5BQU A;  4H9W A;  3UD8 A;  4X37 A;  2RST A;  3BRF A;  2AAI B;  3NBC A;  4FVV A;  2AXM A;  3NJ5 A;  1NZK A;  3FJH A;  4JKX B;  1BFF A;  3UJ0 A;  1V6X A;  1IOB A;  4P0J A;  2I1B A;  4J2X A;  1ISZ A;  2DS0 A;  1HWO B;  3CA0 A;  3OBR A;  3O3Q A;  1FV2 A;  3AKF A;  3FJI A;  2HW9 A;  3FJJ A;  4WBC A;  1FV3 A;  5DVH A;  2M49 A;  1YXW A;  3A22 A;  5FZZ A;  1JT7 A;  4KC3 A;  3S8J A;  3WO3 A;  3JUT A;  3I2A A;  3VSF A;  2X2T A;  3FUQ A;  3O4D A;  3A07 A;  4XFU A;  3V79 C;  4JQ0 A;  4LO8 B;  3AJ6 A;  4P0K A;  2QYI B;  4II0 A;  3WO2 A;  3LTQ A;  2D24 A;  3AKI A;  1YTO A;  2UUS A;  3QYD A;  2ET2 A;  1I1B A;  4MZG B;  1ONK B;  2LIE A;  4ZFW B;  3O5W B;  3V0A A;  3KMV A;  3CRH A;  4KBB A;  3FJB A;  4QKR A;  3O44 A;  3T8S A;  3C9Z A;  3FJK A;  1ISV A;  4J2S A;  1FWU A;  3CRI A;  1Z0H A;  4H04 A;  2KKI A;  1MC9 A;  3Q7Y A;  3A21 A;  2NZ9 A;  4ION A;  2Y9W C;  4IZX A;  4AN6 A;  1Q04 A;  3F62 B;  3BAO A;  2F8X C;  3FJC A;  1Z4S A;  5F8S A;  1G9D A;  1FMZ A;  4ZBV B;  1N4K A;  4Q91 A;  4TLP A;  2AFG A;  1ISW A;  3PUB A;  3Q7W A;  4I4S A;  4PC4 A;  2ZR1 B;  5D63 A;  3BA7 A;  4I4R A;  1BAR A;  4ZLB B;  4L4H A;  4LO2 A;  3RSJ A;  4GOY A;  3UD7 A;  3V0B A;  1TTU A;  4QD2 C;  4QD2 B;  1S0D A;  3O4A A;  1M2T B;  1TWE A;  2ZQN A;  3FFZ A;  4ZGR B;  4IYB A;  1SR4 C;  4OEE A;  3VWC A;  3JRR A;  3AKG A;  4KEK A; 
#chains in the Genus database with same CATH homology
 2MLL B;  1XHB A;  5FNW A;  1WD3 A;  1JT3 A;  2NP0 A;  1DFC A;  1CE7 B;  3IAG C;  3RTJ B;  4XFT A;  3I2X A;  2K4A B;  3E8L C;  4EFR A;  1RG8 A;  2KI6 B;  3VSZ A;  3SNV A;  4IY8 A;  3AJ5 A;  4HA2 A;  4KEJ A;  1SZ6 B;  2AQZ A;  1AXM A;  1RML A;  3QR5 A;  3BAV A;  1QQK A;  3CA3 A;  1XG6 A;  4XFS A;  3IM7 A;  2VUA A;  3OJ2 A;  2BEA A;  4I4V A;  4L4I A;  3BX1 C;  3P6I A;  3PHZ A;  4JP0 A;  3RMY A;  3V0B B;  5DUY A;  4END A;  4LO7 C;  4LO7 B;  5EG6 C;  5B2H A;  6I1B A;  1FMM S;  2P23 A;  1G9C A;  1IRA X;  3BAU A;  4G9M A;  3AH4 A;  4UY4 A;  2Y9F A;  1E0O A;  4ZOT A;  3IM5 A;  3POK A;  1DJS B;  1JQZ A;  5G00 A;  4R6U B;  3HOM A;  3P6J A;  3AH2 A;  3CA5 A;  3RMX A;  3BTA A;  4LO1 A;  2Y9X E;  4MZF B;  4XKI A;  3O4B A;  3VUO A;  2DRE A;  4G6J A;  1WBA A;  4I2S A;  3HBW A;  1BLA A;  3BA5 A;  3H6R A;  4I4U A;  1EYL A;  5DSS B;  4IHZ A;  3D7W B;  3NBN A;  3FJ8 A;  1YBI A;  2R9K B;  5D62 A;  2D44 A;  1S0G A;  4I4Y A;  3FJF A;  1AFC A;  1W3F A;  1JY0 A;  4IY9 A;  3S8K A;  4LO3 A;  3BAD A;  3AH1 A;  1JT5 A;  1V6W A;  1Q1U A;  4OWK A;  4GOV A;  4OWJ A;  1BFB A;  3OGG A;  3HMY A;  1JLY A;  5BQU C;  2J3P A;  1KNM A;  1DZC A;  2FGF A;  1QXM A;  1IHK A;  2D20 A;  2MC2 A;  3BRG C;  2ESU A;  3K1X A;  5BXR A;  1AVW B;  4USO A;  3W9T A;  3RTI B;  4ZKT B;  4LO1 C;  4LO0 A;  1YYN A;  4F83 A;  3BA4 A;  1D0H A;  2X2S A;  3F1R A;  3Q7X A;  1RY7 A;  1K5V A;  1W3A A;  1DQG A;  1HWP B;  1QQL A;  5BVP I;  3MPP G;  2VXR A;  2DRZ A;  3BAH A;  1JT4 A;  1V6U A;  8I1B A;  5FNX A;  1EPW A;  4D0Z A;  41BI A;  1WBC A;  1R8N A;  3R4S A;  1ISY A;  3HN1 A;  5F8Y A;  3TC2 A;  4LO3 C;  4QBV A;  3ILA A;  4G1R A;  2FDB M;  1GGP B;  4I4P A;  3WA1 A;  3ZX7 A;  4I7I A;  2F2F A;  4IZE A;  4QKS A;  2Z49 A;  3LLP A;  2GO2 A;  3V0A B;  1F31 A;  1YF8 B;  3ZXG A;  1AVA C;  4LO0 C;  3H6Q A;  4ISQ A;  5BOW A;  4P0L A;  1L2H A;  1ISX A;  3A23 A;  3N7L A;  1DLL A;  1XYF A;  5FZU A;  2HWM A;  1DFQ A;  5F90 A;  2P39 A;  4QBC A;  4I1B A;  4OEG A;  2D43 A;  1T4Q A;  4ZFY B;  3OJM A;  4I4O A;  4X3A A;  5I1B A;  1G9A A;  5GAQ A;  1FQ9 A;  2FO1 A;  4J23 B;  1BFG A;  4CJM A;  5E24 E;  2F2F C;  3NBE A;  5BXS A;  5FZY A;  1ABR B;  4LO2 C;  1R8O A;  1NUN A;  3N7M A;  3OBT A;  4GP0 A;  3ZXD A;  2GZB A;  1S0F A;  5JMC A;  1VCL A;  1JLX A;  1PUM B;  4USP A;  2VSA A;  1BFC A;  1FN0 A;  3WO4 A;  1HWN B;  1P63 A;  4EB2 B;  1MD6 A;  4X39 A;  4FGF A;  4GP3 A;  7I1B A;  4J2Y A;  3HAL A;  4I3N A;  1IT0 A;  1EVT A;  1FGA A;  1IIL A;  2D7R A;  1XZZ A;  2QN4 A;  3AKH A;  5DZU A;  1PZZ A;  4GAI A;  1ITB A;  5BP5 A;  4DEN A;  4A7K A;  1DZD A;  3WIN A;  1IJT A;  3IM6 A;  2BEB A;  2E4M A;  4ZFU B;  1HWM B;  2NYY A;  1HIB A;  2IWT B;  2D1Z A;  4KEI A;  1FWV A;  2K43 A;  1J0S A;  1BLD A;  2NVH A;  1AVX B;  1TP0 A;  2KLL A;  4AN7 B;  4G9N A;  3BRD A;  1AF9 A;  3IIR A;  2D23 A;  1UPS A;  4HR6 C;  3CA1 A;  5JLV A;  3OGF A;  4D0T A;  4Z8S B;  1DQO A;  4IQP A;  4G6M A;  4YOL A;  4ZA3 B;  1RZO B;  4EFQ A;  1TFM B;  4DEP A;  1S0C A;  1M16 A;  3I29 B;  9ILB A;  2IHO A;  1V6V A;  5BP5 C;  1TWM A;  2K8R A;  3H6R B;  2ERM A;  4OEF A;  3VT2 A;  3WIN C;  2Q3N B;  2ZQO A;  3BAQ A;  5EC5 A;  2NM1 A;  4ISR A;  4I4X A;  4QO3 A;  4I96 A;  2VSE A;  2E4M C;  1BA7 A;  5EHA A;  1K5U A;  4X38 A;  2HWA A;  4JKQ A;  3MAL A;  4I37 A;  1TOO A;  3UJ4 A;  2L5X A;  3VT0 A;  5BXP A;  1A8D A;  4MZH A;  1SR4 A;  1EV2 A;  3FUO A;  2RQ9 A;  3AZW A;  2D22 A;  3VEQ A;  1S0L A;  5BXT A;  3FJD A;  3ZC9 A;  3ZC8 A;  4H75 A;  3CAH A;  3AZV A;  2FFU A;  3CA6 A;  4JPZ A;  3O49 A;  3CRG A;  2NS2 A;  3N7K A;  3UDA A;  1G82 A;  31BI A;  1S0E A;  1ILR 1;  1S0B A;  4JAW A;  2LIQ A;  4A7Z A;  3CQA A;  1Q03 A;  2Y9G A;  1BAS A;  1WD4 A;  4I6I A;  4OW4 A;  3H6S E;  3CU1 B;  2WBC A;  3PG0 A;  4D8H A;  4Q9G A;  1T9F A;  1TIE A;  2Z48 A;  3OJV A;  4J2K A;  4EKX B;  1CVS A;  4I4Q A;  3CA4 A;  1G9B A;  2VXT I;  2WRY A;  3EF2 A;  3WMV A;  3O4O A;  1Z2V A;  2KH2 A;  5D61 A;  1HKN A;  1W3G A;  5F8W A;  1OQL B;  1HCE A;  2MIB A;  1II4 A;  4Z9W B;  3UD9 A;  2RG9 B;  2XOA A;  1I1E A;  1AVU A;  1PUU B;  4JRA A;  1PC8 B;  4F34 A;  1PWA A;  3FJA A;  2BFH A;  4I0Y A;  3NBD A;  2NTD A;  4OUJ A;  3BAG A;  5HPZ A;  3HSM A;  2HZ9 A;  4EFP A;  2VLC A;  3O4C A;  4Q9P A;  1JTC A;  2YUG A;  3VT1 A;  3WMU A;  2DRY A;  3N0K A;  3PME A;  3R4U A;  4HJJ A;  4I8M A;  4DCK C;  1HCD A;  3FGM A;  4P6A A;  2FFV A;  3N7J A;  4EEE B;  2VU9 A;  4I1E A;  4A7Y A;  3FJ9 A;  4OWL A;  4GAF A;  1IRP A;  3BB2 A;  2KI4 A;  2D7I A;  1DIW A;  3B9U A;  21BI A;  3FJE A;  3P53 A;  4QC4 A;  4QAL A;  2Q9X A;  5BQU A;  4H9W A;  3UD8 A;  4X37 A;  2RST A;  3BRF A;  2AAI B;  3NBC A;  4FVV A;  2AXM A;  3NJ5 A;  1NZK A;  3FJH A;  4JKX B;  1BFF A;  3UJ0 A;  1V6X A;  1IOB A;  4P0J A;  2I1B A;  4J2X A;  1ISZ A;  2DS0 A;  1HWO B;  3CA0 A;  3OBR A;  3O3Q A;  1FV2 A;  3AKF A;  3FJI A;  2HW9 A;  3FJJ A;  4WBC A;  1FV3 A;  5DVH A;  2M49 A;  1YXW A;  3A22 A;  5FZZ A;  1JT7 A;  4KC3 A;  3S8J A;  3WO3 A;  3JUT A;  3I2A A;  3VSF A;  2X2T A;  3FUQ A;  3O4D A;  3A07 A;  4XFU A;  3V79 C;  4JQ0 A;  4LO8 B;  3AJ6 A;  4P0K A;  2QYI B;  4II0 A;  3WO2 A;  3LTQ A;  2D24 A;  3AKI A;  1YTO A;  2UUS A;  3QYD A;  2ET2 A;  1I1B A;  4MZG B;  1ONK B;  2LIE A;  4ZFW B;  3O5W B;  3V0A A;  3KMV A;  3CRH A;  4KBB A;  3FJB A;  4QKR A;  3O44 A;  3T8S A;  3C9Z A;  3FJK A;  1ISV A;  4J2S A;  1FWU A;  3CRI A;  1Z0H A;  4H04 A;  2KKI A;  1MC9 A;  3Q7Y A;  3A21 A;  2NZ9 A;  4ION A;  2Y9W C;  4IZX A;  4AN6 A;  1Q04 A;  3F62 B;  3BAO A;  2F8X C;  3FJC A;  1Z4S A;  5F8S A;  1G9D A;  1FMZ A;  4ZBV B;  1N4K A;  4Q91 A;  4TLP A;  2AFG A;  1ISW A;  3PUB A;  3Q7W A;  4I4S A;  4PC4 A;  2ZR1 B;  5D63 A;  3BA7 A;  4I4R A;  1BAR A;  4ZLB B;  4L4H A;  4LO2 A;  3RSJ A;  4GOY A;  3UD7 A;  3V0B A;  1TTU A;  4QD2 C;  4QD2 B;  1S0D A;  3O4A A;  1M2T B;  1TWE A;  2ZQN A;  3FFZ A;  4ZGR B;  4IYB A;  1SR4 C;  4OEE A;  3VWC A;  3JRR A;  3AKG A;  4KEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...