1PWAA

Crystal structure of fibroblast growth factor 19
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
136
structure length
123
Chain Sequence
PIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSLPLSHFLPMLPMVPEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Fibroblast growth factor-19
publication title The crystal structure of fibroblast growth factor (FGF) 19 reveals novel features of the FGF family and offers a structural basis for its unusual receptor affinity.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 123
sequence length 136
ec nomenclature
pdb deposition date 2003-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1pwaA00
5HPZA 1BA7A 2LIEA 3CRGA 1T9FA 2D1ZA 1TFMB 3BAHA 1CE7B 3CAHA 3BAOA 1SR4C 3O3QA 3FUOA 4JP0A 1WD4A 3OGGA 5BVPI 1RY7A 1G9BA 2IHOA 7I1BA 2IWTB 2P39A 1G9CA 4TLPA 3B9UA 5F8WA 4J2XA 4LO3A 3RTIB 1HIBA 1M16A 3P53A 5BOWA 4I4QA 4QBCA 1D0HA 3N0KA 3VSFA 1BASA 3VEQA 3HBWA 3JUTA 3W9TA 5EHAA 1RZOB 3V0AA 4JRAA 4Z9WB 3N7LA 3FJIA 5JLVA 4II0A 2LIQA 4LO2A 2Y9GA 3S8JA 4A7KA 4LO7B 3NJ5A 4ZKTB 5BQUA 3AH1A 4JPZA 4P0KA 4IZEA 4IZXA 1Z0HA 4USPA 3CA1A 4I96A 3ZC9A 3CRIA 2NM1A 4OEGA 4J2YA 3PMEA 3O4DA 1AFCA 1TTUA 3Q7WA 2QYIB 1IILA 1YXWA 3O4AA 4G6MA 4I1EA 2ERMA 2MC2A 1JT3A 1YTOA 2ZQOA 2D24A 5D62A 4LO1C 3VWCA 1IOBA 4USOA 4I6IA 1KNMA 3H6RA 1IHKA 4X39A 3BAUA 1PUUB 1FMZA 3O4BA 1AVAC 4J23B 4I4PA 1XYFA 2RG9B 4LO0A 3UJ4A 2VLCA 3POKA 1G82A 4QD2B 1JT5A 1AVXB 3AKHA 4F83A 3OBTA 1DZCA 3F62B 1BFCA 3O49A 1DJSB 4OWKA 4XKIA 2F2FA 3P6JA 2Q9XA 1HWPB 3MPPG 3WA1A 2J3PA 3A22A 2VSEA 3NBNA 4D8HA 4EFRA 1TWEA 4QKSA 3FJEA 1DLLA 1JY0A 2AQZA 2AXMA 3NBCA 3QR5A 1G9DA 2D43A 4J2KA 3AH2A 1PC8B 1I1EA 5EG6C 3PUBA 1JQZA 3BAVA 3R4SA 1V6VA 3LLPA 3FJBA 1DQGA 3SNVA 1ISZA 4P0JA 2DRZA 5F90A 1ONKB 3N7JA 4LO7C 1MD6A 1S0GA 3O4CA 4I4VA 1Z4SA 3CA5A 4XFTA 1ABRB 3UDAA 4F34A 5F8YA 3OGFA 1E0OA 1FV3A 4ISRA 1JT7A 1CVSA 1DIWA 4FGFA 1BLDA 3HN1A 3V79C 4D0ZA 1GGPB 4KC3A 2Z49A 4H9WA 5BXPA 4GP0A 1BARA 1R8NA 3BA7A 2ZQNA 2D7IA 3IIRA 1XG6A 1EPWA 9ILBA 2GO2A 1WBAA 4G6JA 2HZ9A 5D61A 1S0FA 3WO3A 3MALA 4H04A 3A21A 3CA3A 1ISXA 1Q04A 3V0BA 4FVVA 2R9KB 3A07A 3FJHA 3O44A 2M49A 5FZZA 4QD2C 3WINC 3HSMA 1FGAA 1OQLB 4ZLBB 1ISYA 1FWVA 1AVUA 4G9MA 2K4AB 2QN4A 3D7WB 2Z48A 1YBIA 2ET2A 1DQOA 3BTAA 2MIBA 4HA2A 1TOOA 2KKIA 3BAQA 3VT0A 1RMLA 1SR4A 3FFZA 5FNWA 2DS0A 2WRYA 3FGMA 2E4MC 2RQ9A 3AKIA 4L4HA 1S0EA 2Y9FA 4JKQA 1QXMA 2BEBA 3VT1A 3E8LC 1UPSA 3F1RA 2VXTI 3OJMA 21BIA 1HWOB 2YUGA 2NZ9A 1FN0A 1HCDA 3K1XA 2VSAA 5I1BA 4X38A 1S0CA 4DCKC 1XZZA 3RTJB 2VXRA 1BLAA 3HMYA 4HR6C 3BA4A 4A7ZA 3CRHA 4QC4A 5DZUA 3S8KA 4XFSA 5BP5C 3WMUA 3FJ9A 4JAWA 2RSTA 4I7IA 1WBCA 2GZBA 4I4OA 5FZYA 1IRAX 1FMMS 1IT0A 3BRGC 2K8RA 3V0AB 3Q7XA 1J0SA 3N7KA 3O5WB 2HW9A 2AAIB 5F8SA 4Q91A 4EFPA 3FJ8A 2HWMA 4ZFUB 1F31A 4KBBA 3I2AA 1TIEA 2P23A 3OBRA 3NBEA 4DEPA 3AKFA 1YYNA 5B2HA 4YOLA 4AN6A 1G9AA 1SZ6B 1NZKA 3BAGA 4JKXB 4LO1A 4Q9GA 1ILR1 1MC9A 1S0BA 4ISQA 4Z8SB 5DUYA 3H6RB 2D22A 3UJ0A 1W3FA 1Z2VA 5BXTA 3FUQA 8I1BA 3BRDA 1IRPA 3CA4A 3ZC8A 4GOYA 5BXRA 4OEFA 4JQ0A 6I1BA 2FGFA 1ISWA 1PZZA 1R8OA 3N7MA 2BEAA 3BADA 4PC4A 5D63A 3HOMA 4DENA 1QQKA 4KEJA 1DFQA 1JT4A 1EYLA 4GP3A 1AF9A 3IM5A 4I4RA 3Q7YA 4QALA 2NYYA 4EFQA 4LO3C 4GAIA 3OJVA 3UD8A 4I1BA 1PUMB 4I0YA 1V6UA 2FO1A 3FJKA 2KH2A 5DVHA 1PWAA 1Q03A 1FV2A 2FFUA 4G1RA 4Q9PA 4EB2B 4IY9A 3H6SE 4QO3A 4I4UA 1N4KA 2D20A 5GAQA 2X2SA 2NP0A 4ZGRB 1TWMA 31BIA 3FJAA 5JMCA 1QQLA 2FFVA 3P6IA 1ITBA 3QYDA 2DREA 3AJ6A 5E24E 4LO2C 3OJ2A 5BQUC 4G9NA 1W3AA 1L2HA 4D0TA 1IJTA 3FJCA 4EEEB 1BFBA 2KI6B 41BIA 4LO8B 1AXMA 3BRFA 3IM7A 2I1BA 3BA5A 2F8XC 3TC2A 1II4A 3FJJA 5DSSB 3LTQA 3CU1B 4IYBA 1M2TB 3FJDA 2AFGA 2Y9XE 4KEKA 3PG0A 3I2XA 3VSZA 2ESUA 3C9ZA 3I29B 5EC5A 1S0LA 1V6WA 4R6UB 3RMYA 4EKXB 3JRRA 4P6AA 1RG8A 5FNXA 3V0BB 3IM6A 3KMVA 4LO0C 2ZR1B 4I2SA 1JLYA 3WINA 3BB2A 2D44A 4I4XA 1XHBA 1HKNA 4HJJA 1I1BA 3AH4A 1T4QA 2X2TA 1TP0A 2F2FC 1W3GA 3ZXDA 4IONA 4P0LA 3IAGC 4GAFA 2DRYA 4IQPA 4OWJA 3BX1C 5BXSA 2KLLA 4L4IA 4ZFWB 4OEEA 3VT2A 2E4MA 3AZWA 1K5UA 3WO4A 3WO2A 2XOAA 2D7RA 2NTDA 3H6QA 4GOVA 2UUSA 2FDBM 4IHZA 4ZFYB 1BFFA 1AVWB 3PHZA 1FWUA 3UD9A 4KEIA 3AJ5A 3ZX7A 1A8DA 3T8SA 1K5VA 1HCEA 4ZBVB 3EF2A 2NVHA 3CA6A 1JTCA 1EVTA 3AZVA 3RMXA 4QKRA 4ENDA 3WMVA 4ZOTA 3RSJA 3NBDA 1P63A 5BP5A 3HALA 5FZUA 4I4SA 5G00A 1WD3A 4WBCA 2D23A 4J2SA 1JLXA 3A23A 4X3AA 4ZA3B 2Q3NB 1EV2A 1ISVA 1HWMB 1S0DA 4AN7B 3CA0A 3O4OA 2K43A 4OUJA 2VU9A 1V6XA 2VUAA 1VCLA 3R4UA 4I3NA 4XFUA 4A7YA 3AKGA 1HWNB 2HWAA 1Q1UA 2BFHA 4X37A 2Y9WC 4CJMA 1YF8B 1BFGA 4IY8A 2KI4A 1FQ9A 1DZDA 4I8MA 4OWLA 4OW4A 3VUOA 1NUNA 2L5XA 3CQAA 2MLLB 4I37A 4QBVA 1DFCA 2WBCA 4I4YA 3ILAA 3UD7A 3FJFA 3ZXGA
chains in the Genus database with same CATH superfamily
5HPZA 1BA7A 2LIEA 3CRGA 1T9FA 2D1ZA 1TFMB 3BAHA 1CE7B 3CAHA 3BAOA 1SR4C 3O3QA 3FUOA 4JP0A 1WD4A 3OGGA 5BVPI 1RY7A 1G9BA 2IHOA 7I1BA 2IWTB 2P39A 1G9CA 4TLPA 3B9UA 5F8WA 4J2XA 4LO3A 3RTIB 1HIBA 1M16A 3P53A 4MZGB 5BOWA 4I4QA 4QBCA 1D0HA 3N0KA 3VSFA 1BASA 3VEQA 3HBWA 3JUTA 3W9TA 5EHAA 1RZOB 3V0AA 4JRAA 4Z9WB 3N7LA 3FJIA 5JLVA 4II0A 2LIQA 4LO2A 2Y9GA 3S8JA 4A7KA 4LO7B 3NJ5A 4ZKTB 5BQUA 3AH1A 4JPZA 4P0KA 4IZEA 4IZXA 1Z0HA 4USPA 3CA1A 4I96A 3ZC9A 3CRIA 2NM1A 4OEGA 4J2YA 3PMEA 3O4DA 1AFCA 1TTUA 3Q7WA 2QYIB 1IILA 1YXWA 3O4AA 4G6MA 4I1EA 2ERMA 2MC2A 1JT3A 1YTOA 2ZQOA 2D24A 5D62A 4LO1C 3VWCA 1IOBA 4USOA 4I6IA 1KNMA 3H6RA 1IHKA 4X39A 3BAUA 1PUUB 1FMZA 3O4BA 1AVAC 4J23B 4I4PA 1XYFA 2RG9B 4LO0A 3UJ4A 2VLCA 3POKA 1G82A 4QD2B 1JT5A 1AVXB 3AKHA 4F83A 3OBTA 1DZCA 3F62B 1BFCA 3O49A 1DJSB 4OWKA 4XKIA 2F2FA 3P6JA 2Q9XA 1HWPB 3MPPG 3WA1A 2J3PA 3A22A 2VSEA 3NBNA 4D8HA 4EFRA 1TWEA 4QKSA 3FJEA 1DLLA 1JY0A 2AQZA 2AXMA 3NBCA 3QR5A 1G9DA 2D43A 4J2KA 3AH2A 1PC8B 1I1EA 5EG6C 3PUBA 1JQZA 3BAVA 3R4SA 1V6VA 3LLPA 3FJBA 1DQGA 3SNVA 1ISZA 4P0JA 2DRZA 5F90A 1ONKB 3N7JA 4LO7C 1MD6A 1S0GA 3O4CA 4I4VA 1Z4SA 3CA5A 4XFTA 1ABRB 3UDAA 4F34A 5F8YA 3OGFA 1E0OA 1FV3A 4ISRA 1JT7A 1CVSA 1DIWA 4FGFA 1BLDA 3HN1A 3V79C 4D0ZA 1GGPB 4KC3A 2Z49A 4H9WA 5BXPA 4GP0A 1BARA 1R8NA 3BA7A 2ZQNA 2D7IA 3IIRA 1XG6A 1EPWA 9ILBA 2GO2A 1WBAA 4G6JA 2HZ9A 5D61A 1S0FA 3WO3A 3MALA 4H04A 3A21A 3CA3A 1ISXA 1Q04A 3V0BA 4FVVA 2R9KB 3A07A 3FJHA 3O44A 2M49A 5FZZA 4QD2C 3WINC 3HSMA 1FGAA 1OQLB 4ZLBB 1ISYA 1FWVA 1AVUA 4G9MA 2K4AB 2QN4A 3D7WB 2Z48A 1YBIA 2ET2A 1DQOA 3BTAA 2MIBA 4HA2A 1TOOA 2KKIA 3BAQA 4H75A 3VT0A 1RMLA 4MZFB 1SR4A 3FFZA 5FNWA 2DS0A 2WRYA 3FGMA 2E4MC 2RQ9A 3AKIA 4L4HA 1S0EA 2Y9FA 4JKQA 1QXMA 2BEBA 3VT1A 3E8LC 1UPSA 3F1RA 2VXTI 3OJMA 21BIA 1HWOB 2YUGA 2NZ9A 1FN0A 1HCDA 3K1XA 2VSAA 5I1BA 4X38A 1S0CA 4DCKC 1XZZA 3RTJB 2VXRA 1BLAA 3HMYA 4HR6C 3BA4A 4A7ZA 3CRHA 4QC4A 5DZUA 3S8KA 4XFSA 5BP5C 3WMUA 3FJ9A 4JAWA 2RSTA 4I7IA 1WBCA 2GZBA 4I4OA 5FZYA 1IRAX 1FMMS 1IT0A 3BRGC 2K8RA 3V0AB 3Q7XA 1J0SA 3N7KA 3O5WB 2HW9A 2AAIB 5F8SA 4Q91A 4EFPA 3FJ8A 2HWMA 4ZFUB 1F31A 4KBBA 3I2AA 1TIEA 2P23A 3OBRA 3NBEA 4MZHA 4DEPA 2NS2A 3AKFA 1YYNA 5B2HA 4YOLA 4AN6A 1G9AA 1SZ6B 1NZKA 3BAGA 4JKXB 4LO1A 4Q9GA 1ILR1 1MC9A 1S0BA 4ISQA 4Z8SB 5DUYA 3H6RB 2D22A 3UJ0A 1W3FA 1Z2VA 5BXTA 3FUQA 8I1BA 3BRDA 1IRPA 3CA4A 3ZC8A 4GOYA 5BXRA 4OEFA 4JQ0A 6I1BA 2FGFA 1ISWA 1PZZA 1R8OA 3N7MA 2BEAA 3BADA 4PC4A 5D63A 3HOMA 4DENA 1QQKA 4KEJA 1DFQA 1JT4A 1EYLA 4GP3A 1AF9A 3IM5A 4I4RA 3Q7YA 4QALA 2NYYA 4EFQA 4LO3C 4GAIA 3OJVA 3UD8A 4I1BA 1PUMB 4I0YA 1V6UA 2FO1A 3FJKA 2KH2A 5DVHA 1PWAA 1Q03A 1FV2A 2FFUA 4G1RA 4Q9PA 4EB2B 4IY9A 3H6SE 4QO3A 4I4UA 1N4KA 2D20A 4UY4A 5GAQA 2X2SA 2NP0A 4ZGRB 1TWMA 31BIA 3FJAA 5JMCA 1QQLA 2FFVA 3P6IA 1ITBA 3QYDA 2DREA 3AJ6A 5E24E 4LO2C 3OJ2A 5BQUC 4G9NA 1W3AA 1L2HA 4D0TA 1IJTA 3FJCA 4EEEB 1BFBA 2KI6B 41BIA 4LO8B 1AXMA 3BRFA 3IM7A 2I1BA 3BA5A 2F8XC 3TC2A 1II4A 3FJJA 5DSSB 3LTQA 3CU1B 4IYBA 1M2TB 3FJDA 2AFGA 2Y9XE 4KEKA 3PG0A 3I2XA 3VSZA 2ESUA 3C9ZA 3I29B 5EC5A 1S0LA 1V6WA 4R6UB 3RMYA 4EKXB 3JRRA 4P6AA 1RG8A 5FNXA 3V0BB 3IM6A 3KMVA 4LO0C 2ZR1B 4I2SA 1JLYA 3WINA 3BB2A 2D44A 4I4XA 1XHBA 1HKNA 4HJJA 1I1BA 3AH4A 1T4QA 2X2TA 1TP0A 2F2FC 1W3GA 3ZXDA 4IONA 4P0LA 3IAGC 4GAFA 2DRYA 4IQPA 4OWJA 3BX1C 5BXSA 2KLLA 4L4IA 4ZFWB 4OEEA 3VT2A 2E4MA 3AZWA 1K5UA 3WO4A 3WO2A 2XOAA 2D7RA 2NTDA 3H6QA 4GOVA 2UUSA 2FDBM 4IHZA 4ZFYB 1BFFA 1AVWB 3PHZA 1FWUA 3UD9A 4KEIA 3AJ5A 3ZX7A 1A8DA 3T8SA 1K5VA 1HCEA 4ZBVB 3EF2A 2NVHA 3CA6A 1JTCA 1EVTA 3AZVA 3RMXA 4QKRA 4ENDA 3WMVA 4ZOTA 3RSJA 3NBDA 1P63A 5BP5A 3HALA 5FZUA 4I4SA 5G00A 1WD3A 4WBCA 2D23A 4J2SA 1JLXA 3A23A 4X3AA 4ZA3B 2Q3NB 1EV2A 1ISVA 1HWMB 1S0DA 4AN7B 3CA0A 3O4OA 2K43A 4OUJA 2VU9A 1V6XA 2VUAA 1VCLA 3R4UA 4I3NA 4XFUA 4A7YA 3AKGA 1HWNB 2HWAA 1Q1UA 2BFHA 4X37A 2Y9WC 4CJMA 1YF8B 1BFGA 4IY8A 2KI4A 1FQ9A 1DZDA 4I8MA 4OWLA 4OW4A 3VUOA 1NUNA 2L5XA 3CQAA 2MLLB 4I37A 4QBVA 1DFCA 2WBCA 4I4YA 3ILAA 3UD7A 3FJFA 3ZXGA
chains in the Genus database with same CATH topology
5HPZA 1BA7A 2LIEA 3CRGA 1T9FA 2D1ZA 1TFMB 3BAHA 1CE7B 3CAHA 3BAOA 1SR4C 3O3QA 3FUOA 4JP0A 1WD4A 3OGGA 5BVPI 1RY7A 1G9BA 2IHOA 7I1BA 2IWTB 2P39A 1G9CA 4TLPA 3B9UA 5F8WA 4J2XA 4LO3A 3RTIB 1HIBA 1M16A 3P53A 4MZGB 5BOWA 4I4QA 4QBCA 1D0HA 3N0KA 3VSFA 1BASA 3VEQA 3HBWA 3JUTA 3W9TA 5EHAA 1RZOB 3V0AA 4JRAA 4Z9WB 3N7LA 3FJIA 5JLVA 4II0A 2LIQA 4LO2A 2Y9GA 3S8JA 4A7KA 4LO7B 3NJ5A 4ZKTB 5BQUA 3AH1A 4JPZA 4P0KA 4IZEA 4IZXA 1Z0HA 4USPA 3CA1A 4I96A 3ZC9A 3CRIA 2NM1A 4OEGA 4J2YA 3PMEA 3O4DA 1AFCA 1TTUA 3Q7WA 2QYIB 1IILA 1YXWA 3O4AA 4G6MA 4I1EA 2ERMA 2MC2A 1JT3A 1YTOA 2ZQOA 2D24A 5D62A 4LO1C 3VWCA 1IOBA 4USOA 4I6IA 1KNMA 3H6RA 1IHKA 4X39A 3BAUA 1PUUB 1FMZA 3O4BA 1AVAC 4J23B 4I4PA 1XYFA 2RG9B 4LO0A 3UJ4A 2VLCA 3POKA 1G82A 4QD2B 1JT5A 1AVXB 3AKHA 4F83A 3OBTA 1DZCA 3F62B 1BFCA 3O49A 1DJSB 4OWKA 4XKIA 2F2FA 3P6JA 2Q9XA 1HWPB 3MPPG 3WA1A 2J3PA 3A22A 2VSEA 3NBNA 4D8HA 4EFRA 1TWEA 4QKSA 3FJEA 1DLLA 1JY0A 2AQZA 2AXMA 3NBCA 3QR5A 1G9DA 2D43A 4J2KA 3AH2A 1PC8B 1I1EA 5EG6C 3PUBA 1JQZA 3BAVA 3R4SA 1V6VA 3LLPA 3FJBA 1DQGA 3SNVA 1ISZA 4P0JA 2DRZA 5F90A 1ONKB 3N7JA 4LO7C 1MD6A 1S0GA 3O4CA 4I4VA 1Z4SA 3CA5A 4XFTA 1ABRB 3UDAA 4F34A 5F8YA 3OGFA 1E0OA 1FV3A 4ISRA 1JT7A 1CVSA 1DIWA 4FGFA 1BLDA 3HN1A 3V79C 4D0ZA 1GGPB 4KC3A 2Z49A 4H9WA 5BXPA 4GP0A 1BARA 1R8NA 3BA7A 2ZQNA 2D7IA 3IIRA 1XG6A 1EPWA 9ILBA 2GO2A 1WBAA 4G6JA 2HZ9A 5D61A 1S0FA 3WO3A 3MALA 4H04A 3A21A 3CA3A 1ISXA 1Q04A 3V0BA 4FVVA 2R9KB 3A07A 3FJHA 3O44A 2M49A 5FZZA 4QD2C 3WINC 3HSMA 1FGAA 1OQLB 4ZLBB 1ISYA 1FWVA 1AVUA 4G9MA 2K4AB 2QN4A 3D7WB 2Z48A 1YBIA 2ET2A 1DQOA 3BTAA 2MIBA 4HA2A 1TOOA 2KKIA 3BAQA 4H75A 3VT0A 1RMLA 4MZFB 1SR4A 3FFZA 5FNWA 2DS0A 2WRYA 3FGMA 2E4MC 2RQ9A 3AKIA 4L4HA 1S0EA 2Y9FA 4JKQA 1QXMA 2BEBA 3VT1A 3E8LC 1UPSA 3F1RA 2VXTI 3OJMA 21BIA 1HWOB 2YUGA 2NZ9A 1FN0A 1HCDA 3K1XA 2VSAA 5I1BA 4X38A 1S0CA 4DCKC 1XZZA 3RTJB 2VXRA 1BLAA 3HMYA 4HR6C 3BA4A 4A7ZA 3CRHA 4QC4A 5DZUA 3S8KA 4XFSA 5BP5C 3WMUA 3FJ9A 4JAWA 2RSTA 4I7IA 1WBCA 2GZBA 4I4OA 5FZYA 1IRAX 1FMMS 1IT0A 3BRGC 2K8RA 3V0AB 3Q7XA 1J0SA 3N7KA 3O5WB 2HW9A 2AAIB 5F8SA 4Q91A 4EFPA 3FJ8A 2HWMA 4ZFUB 1F31A 4KBBA 3I2AA 1TIEA 2P23A 3OBRA 3NBEA 4MZHA 4DEPA 2NS2A 3AKFA 1YYNA 5B2HA 4YOLA 4AN6A 1G9AA 1SZ6B 1NZKA 3BAGA 4JKXB 4LO1A 4Q9GA 1ILR1 1MC9A 1S0BA 4ISQA 4Z8SB 5DUYA 3H6RB 2D22A 3UJ0A 1W3FA 1Z2VA 5BXTA 3FUQA 8I1BA 3BRDA 1IRPA 3CA4A 3ZC8A 4GOYA 5BXRA 4OEFA 4JQ0A 6I1BA 2FGFA 1ISWA 1PZZA 1R8OA 3N7MA 2BEAA 3BADA 4PC4A 5D63A 3HOMA 4DENA 1QQKA 4KEJA 1DFQA 1JT4A 1EYLA 4GP3A 1AF9A 3IM5A 4I4RA 3Q7YA 4QALA 2NYYA 4EFQA 4LO3C 4GAIA 3OJVA 3UD8A 4I1BA 1PUMB 4I0YA 1V6UA 2FO1A 3FJKA 2KH2A 5DVHA 1PWAA 1Q03A 1FV2A 2FFUA 4G1RA 4Q9PA 4EB2B 4IY9A 3H6SE 4QO3A 4I4UA 1N4KA 2D20A 4UY4A 5GAQA 2X2SA 2NP0A 4ZGRB 1TWMA 31BIA 3FJAA 5JMCA 1QQLA 2FFVA 3P6IA 1ITBA 3QYDA 2DREA 3AJ6A 5E24E 4LO2C 3OJ2A 5BQUC 4G9NA 1W3AA 1L2HA 4D0TA 1IJTA 3FJCA 4EEEB 1BFBA 2KI6B 41BIA 4LO8B 1AXMA 3BRFA 3IM7A 2I1BA 3BA5A 2F8XC 3TC2A 1II4A 3FJJA 5DSSB 3LTQA 3CU1B 4IYBA 1M2TB 3FJDA 2AFGA 2Y9XE 4KEKA 3PG0A 3I2XA 3VSZA 2ESUA 3C9ZA 3I29B 5EC5A 1S0LA 1V6WA 4R6UB 3RMYA 4EKXB 3JRRA 4P6AA 1RG8A 5FNXA 3V0BB 3IM6A 3KMVA 4LO0C 2ZR1B 4I2SA 1JLYA 3WINA 3BB2A 2D44A 4I4XA 1XHBA 1HKNA 4HJJA 1I1BA 3AH4A 1T4QA 2X2TA 1TP0A 2F2FC 1W3GA 3ZXDA 4IONA 4P0LA 3IAGC 4GAFA 2DRYA 4IQPA 4OWJA 3BX1C 5BXSA 2KLLA 4L4IA 4ZFWB 4OEEA 3VT2A 2E4MA 3AZWA 1K5UA 3WO4A 3WO2A 2XOAA 2D7RA 2NTDA 3H6QA 4GOVA 2UUSA 2FDBM 4IHZA 4ZFYB 1BFFA 1AVWB 3PHZA 1FWUA 3UD9A 4KEIA 3AJ5A 3ZX7A 1A8DA 3T8SA 1K5VA 1HCEA 4ZBVB 3EF2A 2NVHA 3CA6A 1JTCA 1EVTA 3AZVA 3RMXA 4QKRA 4ENDA 3WMVA 4ZOTA 3RSJA 3NBDA 1P63A 5BP5A 3HALA 5FZUA 4I4SA 5G00A 1WD3A 4WBCA 2D23A 4J2SA 1JLXA 3A23A 4X3AA 4ZA3B 2Q3NB 1EV2A 1ISVA 1HWMB 1S0DA 4AN7B 3CA0A 3O4OA 2K43A 4OUJA 2VU9A 1V6XA 2VUAA 1VCLA 3R4UA 4I3NA 4XFUA 4A7YA 3AKGA 1HWNB 2HWAA 1Q1UA 2BFHA 4X37A 2Y9WC 4CJMA 1YF8B 1BFGA 4IY8A 2KI4A 1FQ9A 1DZDA 4I8MA 4OWLA 4OW4A 3VUOA 1NUNA 2L5XA 3CQAA 2MLLB 4I37A 4QBVA 1DFCA 2WBCA 4I4YA 3ILAA 3UD7A 3FJFA 3ZXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPZ A;  1BA7 A;  2LIE A;  3CRG A;  1T9F A;  2D1Z A;  1TFM B;  3BAH A;  1CE7 B;  3CAH A;  3BAO A;  1SR4 C;  3O3Q A;  3FUO A;  4JP0 A;  1WD4 A;  3OGG A;  5BVP I;  1RY7 A;  1G9B A;  2IHO A;  7I1B A;  2IWT B;  2P39 A;  1G9C A;  4TLP A;  3B9U A;  5F8W A;  4J2X A;  4LO3 A;  3RTI B;  1HIB A;  1M16 A;  3P53 A;  5BOW A;  4I4Q A;  4QBC A;  1D0H A;  3N0K A;  3VSF A;  1BAS A;  3VEQ A;  3HBW A;  3JUT A;  3W9T A;  5EHA A;  1RZO B;  3V0A A;  4JRA A;  4Z9W B;  3N7L A;  3FJI A;  5JLV A;  4II0 A;  2LIQ A;  4LO2 A;  2Y9G A;  3S8J A;  4A7K A;  4LO7 B;  3NJ5 A;  4ZKT B;  5BQU A;  3AH1 A;  4JPZ A;  4P0K A;  4IZE A;  4IZX A;  1Z0H A;  4USP A;  3CA1 A;  4I96 A;  3ZC9 A;  3CRI A;  2NM1 A;  4OEG A;  4J2Y A;  3PME A;  3O4D A;  1AFC A;  1TTU A;  3Q7W A;  2QYI B;  1IIL A;  1YXW A;  3O4A A;  4G6M A;  4I1E A;  2ERM A;  2MC2 A;  1JT3 A;  1YTO A;  2ZQO A;  2D24 A;  5D62 A;  4LO1 C;  3VWC A;  1IOB A;  4USO A;  4I6I A;  1KNM A;  3H6R A;  1IHK A;  4X39 A;  3BAU A;  1PUU B;  1FMZ A;  3O4B A;  1AVA C;  4J23 B;  4I4P A;  1XYF A;  2RG9 B;  4LO0 A;  3UJ4 A;  2VLC A;  3POK A;  1G82 A;  4QD2 B;  1JT5 A;  1AVX B;  3AKH A;  4F83 A;  3OBT A;  1DZC A;  3F62 B;  1BFC A;  3O49 A;  1DJS B;  4OWK A;  4XKI A;  2F2F A;  3P6J A;  2Q9X A;  1HWP B;  3MPP G;  3WA1 A;  2J3P A;  3A22 A;  2VSE A;  3NBN A;  4D8H A;  4EFR A;  1TWE A;  4QKS A;  3FJE A;  1DLL A;  1JY0 A;  2AQZ A;  2AXM A;  3NBC A;  3QR5 A;  1G9D A;  2D43 A;  4J2K A;  3AH2 A;  1PC8 B;  1I1E A;  5EG6 C;  3PUB A;  1JQZ A;  3BAV A;  3R4S A;  1V6V A;  3LLP A;  3FJB A;  1DQG A;  3SNV A;  1ISZ A;  4P0J A;  2DRZ A;  5F90 A;  1ONK B;  3N7J A;  4LO7 C;  1MD6 A;  1S0G A;  3O4C A;  4I4V A;  1Z4S A;  3CA5 A;  4XFT A;  1ABR B;  3UDA A;  4F34 A;  5F8Y A;  3OGF A;  1E0O A;  1FV3 A;  4ISR A;  1JT7 A;  1CVS A;  1DIW A;  4FGF A;  1BLD A;  3HN1 A;  3V79 C;  4D0Z A;  1GGP B;  4KC3 A;  2Z49 A;  4H9W A;  5BXP A;  4GP0 A;  1BAR A;  1R8N A;  3BA7 A;  2ZQN A;  2D7I A;  3IIR A;  1XG6 A;  1EPW A;  9ILB A;  2GO2 A;  1WBA A;  4G6J A;  2HZ9 A;  5D61 A;  1S0F A;  3WO3 A;  3MAL A;  4H04 A;  3A21 A;  3CA3 A;  1ISX A;  1Q04 A;  3V0B A;  4FVV A;  2R9K B;  3A07 A;  3FJH A;  3O44 A;  2M49 A;  5FZZ A;  4QD2 C;  3WIN C;  3HSM A;  1FGA A;  1OQL B;  4ZLB B;  1ISY A;  1FWV A;  1AVU A;  4G9M A;  2K4A B;  2QN4 A;  3D7W B;  2Z48 A;  1YBI A;  2ET2 A;  1DQO A;  3BTA A;  2MIB A;  4HA2 A;  1TOO A;  2KKI A;  3BAQ A;  3VT0 A;  1RML A;  1SR4 A;  3FFZ A;  5FNW A;  2DS0 A;  2WRY A;  3FGM A;  2E4M C;  2RQ9 A;  3AKI A;  4L4H A;  1S0E A;  2Y9F A;  4JKQ A;  1QXM A;  2BEB A;  3VT1 A;  3E8L C;  1UPS A;  3F1R A;  2VXT I;  3OJM A;  21BI A;  1HWO B;  2YUG A;  2NZ9 A;  1FN0 A;  1HCD A;  3K1X A;  2VSA A;  5I1B A;  4X38 A;  1S0C A;  4DCK C;  1XZZ A;  3RTJ B;  2VXR A;  1BLA A;  3HMY A;  4HR6 C;  3BA4 A;  4A7Z A;  3CRH A;  4QC4 A;  5DZU A;  3S8K A;  4XFS A;  5BP5 C;  3WMU A;  3FJ9 A;  4JAW A;  2RST A;  4I7I A;  1WBC A;  2GZB A;  4I4O A;  5FZY A;  1IRA X;  1FMM S;  1IT0 A;  3BRG C;  2K8R A;  3V0A B;  3Q7X A;  1J0S A;  3N7K A;  3O5W B;  2HW9 A;  2AAI B;  5F8S A;  4Q91 A;  4EFP A;  3FJ8 A;  2HWM A;  4ZFU B;  1F31 A;  4KBB A;  3I2A A;  1TIE A;  2P23 A;  3OBR A;  3NBE A;  4DEP A;  3AKF A;  1YYN A;  5B2H A;  4YOL A;  4AN6 A;  1G9A A;  1SZ6 B;  1NZK A;  3BAG A;  4JKX B;  4LO1 A;  4Q9G A;  1ILR 1;  1MC9 A;  1S0B A;  4ISQ A;  4Z8S B;  5DUY A;  3H6R B;  2D22 A;  3UJ0 A;  1W3F A;  1Z2V A;  5BXT A;  3FUQ A;  8I1B A;  3BRD A;  1IRP A;  3CA4 A;  3ZC8 A;  4GOY A;  5BXR A;  4OEF A;  4JQ0 A;  6I1B A;  2FGF A;  1ISW A;  1PZZ A;  1R8O A;  3N7M A;  2BEA A;  3BAD A;  4PC4 A;  5D63 A;  3HOM A;  4DEN A;  1QQK A;  4KEJ A;  1DFQ A;  1JT4 A;  1EYL A;  4GP3 A;  1AF9 A;  3IM5 A;  4I4R A;  3Q7Y A;  4QAL A;  2NYY A;  4EFQ A;  4LO3 C;  4GAI A;  3OJV A;  3UD8 A;  4I1B A;  1PUM B;  4I0Y A;  1V6U A;  2FO1 A;  3FJK A;  2KH2 A;  5DVH A;  1PWA A;  1Q03 A;  1FV2 A;  2FFU A;  4G1R A;  4Q9P A;  4EB2 B;  4IY9 A;  3H6S E;  4QO3 A;  4I4U A;  1N4K A;  2D20 A;  5GAQ A;  2X2S A;  2NP0 A;  4ZGR B;  1TWM A;  31BI A;  3FJA A;  5JMC A;  1QQL A;  2FFV A;  3P6I A;  1ITB A;  3QYD A;  2DRE A;  3AJ6 A;  5E24 E;  4LO2 C;  3OJ2 A;  5BQU C;  4G9N A;  1W3A A;  1L2H A;  4D0T A;  1IJT A;  3FJC A;  4EEE B;  1BFB A;  2KI6 B;  41BI A;  4LO8 B;  1AXM A;  3BRF A;  3IM7 A;  2I1B A;  3BA5 A;  2F8X C;  3TC2 A;  1II4 A;  3FJJ A;  5DSS B;  3LTQ A;  3CU1 B;  4IYB A;  1M2T B;  3FJD A;  2AFG A;  2Y9X E;  4KEK A;  3PG0 A;  3I2X A;  3VSZ A;  2ESU A;  3C9Z A;  3I29 B;  5EC5 A;  1S0L A;  1V6W A;  4R6U B;  3RMY A;  4EKX B;  3JRR A;  4P6A A;  1RG8 A;  5FNX A;  3V0B B;  3IM6 A;  3KMV A;  4LO0 C;  2ZR1 B;  4I2S A;  1JLY A;  3WIN A;  3BB2 A;  2D44 A;  4I4X A;  1XHB A;  1HKN A;  4HJJ A;  1I1B A;  3AH4 A;  1T4Q A;  2X2T A;  1TP0 A;  2F2F C;  1W3G A;  3ZXD A;  4ION A;  4P0L A;  3IAG C;  4GAF A;  2DRY A;  4IQP A;  4OWJ A;  3BX1 C;  5BXS A;  2KLL A;  4L4I A;  4ZFW B;  4OEE A;  3VT2 A;  2E4M A;  3AZW A;  1K5U A;  3WO4 A;  3WO2 A;  2XOA A;  2D7R A;  2NTD A;  3H6Q A;  4GOV A;  2UUS A;  2FDB M;  4IHZ A;  4ZFY B;  1BFF A;  1AVW B;  3PHZ A;  1FWU A;  3UD9 A;  4KEI A;  3AJ5 A;  3ZX7 A;  1A8D A;  3T8S A;  1K5V A;  1HCE A;  4ZBV B;  3EF2 A;  2NVH A;  3CA6 A;  1JTC A;  1EVT A;  3AZV A;  3RMX A;  4QKR A;  4END A;  3WMV A;  4ZOT A;  3RSJ A;  3NBD A;  1P63 A;  5BP5 A;  3HAL A;  5FZU A;  4I4S A;  5G00 A;  1WD3 A;  4WBC A;  2D23 A;  4J2S A;  1JLX A;  3A23 A;  4X3A A;  4ZA3 B;  2Q3N B;  1EV2 A;  1ISV A;  1HWM B;  1S0D A;  4AN7 B;  3CA0 A;  3O4O A;  2K43 A;  4OUJ A;  2VU9 A;  1V6X A;  2VUA A;  1VCL A;  3R4U A;  4I3N A;  4XFU A;  4A7Y A;  3AKG A;  1HWN B;  2HWA A;  1Q1U A;  2BFH A;  4X37 A;  2Y9W C;  4CJM A;  1YF8 B;  1BFG A;  4IY8 A;  2KI4 A;  1FQ9 A;  1DZD A;  4I8M A;  4OWL A;  4OW4 A;  3VUO A;  1NUN A;  2L5X A;  3CQA A;  2MLL B;  4I37 A;  4QBV A;  1DFC A;  2WBC A;  4I4Y A;  3ILA A;  3UD7 A;  3FJF A;  3ZXG A; 
#chains in the Genus database with same CATH topology
 5HPZ A;  1BA7 A;  2LIE A;  3CRG A;  1T9F A;  2D1Z A;  1TFM B;  3BAH A;  1CE7 B;  3CAH A;  3BAO A;  1SR4 C;  3O3Q A;  3FUO A;  4JP0 A;  1WD4 A;  3OGG A;  5BVP I;  1RY7 A;  1G9B A;  2IHO A;  7I1B A;  2IWT B;  2P39 A;  1G9C A;  4TLP A;  3B9U A;  5F8W A;  4J2X A;  4LO3 A;  3RTI B;  1HIB A;  1M16 A;  3P53 A;  4MZG B;  5BOW A;  4I4Q A;  4QBC A;  1D0H A;  3N0K A;  3VSF A;  1BAS A;  3VEQ A;  3HBW A;  3JUT A;  3W9T A;  5EHA A;  1RZO B;  3V0A A;  4JRA A;  4Z9W B;  3N7L A;  3FJI A;  5JLV A;  4II0 A;  2LIQ A;  4LO2 A;  2Y9G A;  3S8J A;  4A7K A;  4LO7 B;  3NJ5 A;  4ZKT B;  5BQU A;  3AH1 A;  4JPZ A;  4P0K A;  4IZE A;  4IZX A;  1Z0H A;  4USP A;  3CA1 A;  4I96 A;  3ZC9 A;  3CRI A;  2NM1 A;  4OEG A;  4J2Y A;  3PME A;  3O4D A;  1AFC A;  1TTU A;  3Q7W A;  2QYI B;  1IIL A;  1YXW A;  3O4A A;  4G6M A;  4I1E A;  2ERM A;  2MC2 A;  1JT3 A;  1YTO A;  2ZQO A;  2D24 A;  5D62 A;  4LO1 C;  3VWC A;  1IOB A;  4USO A;  4I6I A;  1KNM A;  3H6R A;  1IHK A;  4X39 A;  3BAU A;  1PUU B;  1FMZ A;  3O4B A;  1AVA C;  4J23 B;  4I4P A;  1XYF A;  2RG9 B;  4LO0 A;  3UJ4 A;  2VLC A;  3POK A;  1G82 A;  4QD2 B;  1JT5 A;  1AVX B;  3AKH A;  4F83 A;  3OBT A;  1DZC A;  3F62 B;  1BFC A;  3O49 A;  1DJS B;  4OWK A;  4XKI A;  2F2F A;  3P6J A;  2Q9X A;  1HWP B;  3MPP G;  3WA1 A;  2J3P A;  3A22 A;  2VSE A;  3NBN A;  4D8H A;  4EFR A;  1TWE A;  4QKS A;  3FJE A;  1DLL A;  1JY0 A;  2AQZ A;  2AXM A;  3NBC A;  3QR5 A;  1G9D A;  2D43 A;  4J2K A;  3AH2 A;  1PC8 B;  1I1E A;  5EG6 C;  3PUB A;  1JQZ A;  3BAV A;  3R4S A;  1V6V A;  3LLP A;  3FJB A;  1DQG A;  3SNV A;  1ISZ A;  4P0J A;  2DRZ A;  5F90 A;  1ONK B;  3N7J A;  4LO7 C;  1MD6 A;  1S0G A;  3O4C A;  4I4V A;  1Z4S A;  3CA5 A;  4XFT A;  1ABR B;  3UDA A;  4F34 A;  5F8Y A;  3OGF A;  1E0O A;  1FV3 A;  4ISR A;  1JT7 A;  1CVS A;  1DIW A;  4FGF A;  1BLD A;  3HN1 A;  3V79 C;  4D0Z A;  1GGP B;  4KC3 A;  2Z49 A;  4H9W A;  5BXP A;  4GP0 A;  1BAR A;  1R8N A;  3BA7 A;  2ZQN A;  2D7I A;  3IIR A;  1XG6 A;  1EPW A;  9ILB A;  2GO2 A;  1WBA A;  4G6J A;  2HZ9 A;  5D61 A;  1S0F A;  3WO3 A;  3MAL A;  4H04 A;  3A21 A;  3CA3 A;  1ISX A;  1Q04 A;  3V0B A;  4FVV A;  2R9K B;  3A07 A;  3FJH A;  3O44 A;  2M49 A;  5FZZ A;  4QD2 C;  3WIN C;  3HSM A;  1FGA A;  1OQL B;  4ZLB B;  1ISY A;  1FWV A;  1AVU A;  4G9M A;  2K4A B;  2QN4 A;  3D7W B;  2Z48 A;  1YBI A;  2ET2 A;  1DQO A;  3BTA A;  2MIB A;  4HA2 A;  1TOO A;  2KKI A;  3BAQ A;  4H75 A;  3VT0 A;  1RML A;  4MZF B;  1SR4 A;  3FFZ A;  5FNW A;  2DS0 A;  2WRY A;  3FGM A;  2E4M C;  2RQ9 A;  3AKI A;  4L4H A;  1S0E A;  2Y9F A;  4JKQ A;  1QXM A;  2BEB A;  3VT1 A;  3E8L C;  1UPS A;  3F1R A;  2VXT I;  3OJM A;  21BI A;  1HWO B;  2YUG A;  2NZ9 A;  1FN0 A;  1HCD A;  3K1X A;  2VSA A;  5I1B A;  4X38 A;  1S0C A;  4DCK C;  1XZZ A;  3RTJ B;  2VXR A;  1BLA A;  3HMY A;  4HR6 C;  3BA4 A;  4A7Z A;  3CRH A;  4QC4 A;  5DZU A;  3S8K A;  4XFS A;  5BP5 C;  3WMU A;  3FJ9 A;  4JAW A;  2RST A;  4I7I A;  1WBC A;  2GZB A;  4I4O A;  5FZY A;  1IRA X;  1FMM S;  1IT0 A;  3BRG C;  2K8R A;  3V0A B;  3Q7X A;  1J0S A;  3N7K A;  3O5W B;  2HW9 A;  2AAI B;  5F8S A;  4Q91 A;  4EFP A;  3FJ8 A;  2HWM A;  4ZFU B;  1F31 A;  4KBB A;  3I2A A;  1TIE A;  2P23 A;  3OBR A;  3NBE A;  4MZH A;  4DEP A;  2NS2 A;  3AKF A;  1YYN A;  5B2H A;  4YOL A;  4AN6 A;  1G9A A;  1SZ6 B;  1NZK A;  3BAG A;  4JKX B;  4LO1 A;  4Q9G A;  1ILR 1;  1MC9 A;  1S0B A;  4ISQ A;  4Z8S B;  5DUY A;  3H6R B;  2D22 A;  3UJ0 A;  1W3F A;  1Z2V A;  5BXT A;  3FUQ A;  8I1B A;  3BRD A;  1IRP A;  3CA4 A;  3ZC8 A;  4GOY A;  5BXR A;  4OEF A;  4JQ0 A;  6I1B A;  2FGF A;  1ISW A;  1PZZ A;  1R8O A;  3N7M A;  2BEA A;  3BAD A;  4PC4 A;  5D63 A;  3HOM A;  4DEN A;  1QQK A;  4KEJ A;  1DFQ A;  1JT4 A;  1EYL A;  4GP3 A;  1AF9 A;  3IM5 A;  4I4R A;  3Q7Y A;  4QAL A;  2NYY A;  4EFQ A;  4LO3 C;  4GAI A;  3OJV A;  3UD8 A;  4I1B A;  1PUM B;  4I0Y A;  1V6U A;  2FO1 A;  3FJK A;  2KH2 A;  5DVH A;  1PWA A;  1Q03 A;  1FV2 A;  2FFU A;  4G1R A;  4Q9P A;  4EB2 B;  4IY9 A;  3H6S E;  4QO3 A;  4I4U A;  1N4K A;  2D20 A;  4UY4 A;  5GAQ A;  2X2S A;  2NP0 A;  4ZGR B;  1TWM A;  31BI A;  3FJA A;  5JMC A;  1QQL A;  2FFV A;  3P6I A;  1ITB A;  3QYD A;  2DRE A;  3AJ6 A;  5E24 E;  4LO2 C;  3OJ2 A;  5BQU C;  4G9N A;  1W3A A;  1L2H A;  4D0T A;  1IJT A;  3FJC A;  4EEE B;  1BFB A;  2KI6 B;  41BI A;  4LO8 B;  1AXM A;  3BRF A;  3IM7 A;  2I1B A;  3BA5 A;  2F8X C;  3TC2 A;  1II4 A;  3FJJ A;  5DSS B;  3LTQ A;  3CU1 B;  4IYB A;  1M2T B;  3FJD A;  2AFG A;  2Y9X E;  4KEK A;  3PG0 A;  3I2X A;  3VSZ A;  2ESU A;  3C9Z A;  3I29 B;  5EC5 A;  1S0L A;  1V6W A;  4R6U B;  3RMY A;  4EKX B;  3JRR A;  4P6A A;  1RG8 A;  5FNX A;  3V0B B;  3IM6 A;  3KMV A;  4LO0 C;  2ZR1 B;  4I2S A;  1JLY A;  3WIN A;  3BB2 A;  2D44 A;  4I4X A;  1XHB A;  1HKN A;  4HJJ A;  1I1B A;  3AH4 A;  1T4Q A;  2X2T A;  1TP0 A;  2F2F C;  1W3G A;  3ZXD A;  4ION A;  4P0L A;  3IAG C;  4GAF A;  2DRY A;  4IQP A;  4OWJ A;  3BX1 C;  5BXS A;  2KLL A;  4L4I A;  4ZFW B;  4OEE A;  3VT2 A;  2E4M A;  3AZW A;  1K5U A;  3WO4 A;  3WO2 A;  2XOA A;  2D7R A;  2NTD A;  3H6Q A;  4GOV A;  2UUS A;  2FDB M;  4IHZ A;  4ZFY B;  1BFF A;  1AVW B;  3PHZ A;  1FWU A;  3UD9 A;  4KEI A;  3AJ5 A;  3ZX7 A;  1A8D A;  3T8S A;  1K5V A;  1HCE A;  4ZBV B;  3EF2 A;  2NVH A;  3CA6 A;  1JTC A;  1EVT A;  3AZV A;  3RMX A;  4QKR A;  4END A;  3WMV A;  4ZOT A;  3RSJ A;  3NBD A;  1P63 A;  5BP5 A;  3HAL A;  5FZU A;  4I4S A;  5G00 A;  1WD3 A;  4WBC A;  2D23 A;  4J2S A;  1JLX A;  3A23 A;  4X3A A;  4ZA3 B;  2Q3N B;  1EV2 A;  1ISV A;  1HWM B;  1S0D A;  4AN7 B;  3CA0 A;  3O4O A;  2K43 A;  4OUJ A;  2VU9 A;  1V6X A;  2VUA A;  1VCL A;  3R4U A;  4I3N A;  4XFU A;  4A7Y A;  3AKG A;  1HWN B;  2HWA A;  1Q1U A;  2BFH A;  4X37 A;  2Y9W C;  4CJM A;  1YF8 B;  1BFG A;  4IY8 A;  2KI4 A;  1FQ9 A;  1DZD A;  4I8M A;  4OWL A;  4OW4 A;  3VUO A;  1NUN A;  2L5X A;  3CQA A;  2MLL B;  4I37 A;  4QBV A;  1DFC A;  2WBC A;  4I4Y A;  3ILA A;  3UD7 A;  3FJF A;  3ZXG A; 
#chains in the Genus database with same CATH homology
 5HPZ A;  1BA7 A;  2LIE A;  3CRG A;  1T9F A;  2D1Z A;  1TFM B;  3BAH A;  1CE7 B;  3CAH A;  3BAO A;  1SR4 C;  3O3Q A;  3FUO A;  4JP0 A;  1WD4 A;  3OGG A;  5BVP I;  1RY7 A;  1G9B A;  2IHO A;  7I1B A;  2IWT B;  2P39 A;  1G9C A;  4TLP A;  3B9U A;  5F8W A;  4J2X A;  4LO3 A;  3RTI B;  1HIB A;  1M16 A;  3P53 A;  4MZG B;  5BOW A;  4I4Q A;  4QBC A;  1D0H A;  3N0K A;  3VSF A;  1BAS A;  3VEQ A;  3HBW A;  3JUT A;  3W9T A;  5EHA A;  1RZO B;  3V0A A;  4JRA A;  4Z9W B;  3N7L A;  3FJI A;  5JLV A;  4II0 A;  2LIQ A;  4LO2 A;  2Y9G A;  3S8J A;  4A7K A;  4LO7 B;  3NJ5 A;  4ZKT B;  5BQU A;  3AH1 A;  4JPZ A;  4P0K A;  4IZE A;  4IZX A;  1Z0H A;  4USP A;  3CA1 A;  4I96 A;  3ZC9 A;  3CRI A;  2NM1 A;  4OEG A;  4J2Y A;  3PME A;  3O4D A;  1AFC A;  1TTU A;  3Q7W A;  2QYI B;  1IIL A;  1YXW A;  3O4A A;  4G6M A;  4I1E A;  2ERM A;  2MC2 A;  1JT3 A;  1YTO A;  2ZQO A;  2D24 A;  5D62 A;  4LO1 C;  3VWC A;  1IOB A;  4USO A;  4I6I A;  1KNM A;  3H6R A;  1IHK A;  4X39 A;  3BAU A;  1PUU B;  1FMZ A;  3O4B A;  1AVA C;  4J23 B;  4I4P A;  1XYF A;  2RG9 B;  4LO0 A;  3UJ4 A;  2VLC A;  3POK A;  1G82 A;  4QD2 B;  1JT5 A;  1AVX B;  3AKH A;  4F83 A;  3OBT A;  1DZC A;  3F62 B;  1BFC A;  3O49 A;  1DJS B;  4OWK A;  4XKI A;  2F2F A;  3P6J A;  2Q9X A;  1HWP B;  3MPP G;  3WA1 A;  2J3P A;  3A22 A;  2VSE A;  3NBN A;  4D8H A;  4EFR A;  1TWE A;  4QKS A;  3FJE A;  1DLL A;  1JY0 A;  2AQZ A;  2AXM A;  3NBC A;  3QR5 A;  1G9D A;  2D43 A;  4J2K A;  3AH2 A;  1PC8 B;  1I1E A;  5EG6 C;  3PUB A;  1JQZ A;  3BAV A;  3R4S A;  1V6V A;  3LLP A;  3FJB A;  1DQG A;  3SNV A;  1ISZ A;  4P0J A;  2DRZ A;  5F90 A;  1ONK B;  3N7J A;  4LO7 C;  1MD6 A;  1S0G A;  3O4C A;  4I4V A;  1Z4S A;  3CA5 A;  4XFT A;  1ABR B;  3UDA A;  4F34 A;  5F8Y A;  3OGF A;  1E0O A;  1FV3 A;  4ISR A;  1JT7 A;  1CVS A;  1DIW A;  4FGF A;  1BLD A;  3HN1 A;  3V79 C;  4D0Z A;  1GGP B;  4KC3 A;  2Z49 A;  4H9W A;  5BXP A;  4GP0 A;  1BAR A;  1R8N A;  3BA7 A;  2ZQN A;  2D7I A;  3IIR A;  1XG6 A;  1EPW A;  9ILB A;  2GO2 A;  1WBA A;  4G6J A;  2HZ9 A;  5D61 A;  1S0F A;  3WO3 A;  3MAL A;  4H04 A;  3A21 A;  3CA3 A;  1ISX A;  1Q04 A;  3V0B A;  4FVV A;  2R9K B;  3A07 A;  3FJH A;  3O44 A;  2M49 A;  5FZZ A;  4QD2 C;  3WIN C;  3HSM A;  1FGA A;  1OQL B;  4ZLB B;  1ISY A;  1FWV A;  1AVU A;  4G9M A;  2K4A B;  2QN4 A;  3D7W B;  2Z48 A;  1YBI A;  2ET2 A;  1DQO A;  3BTA A;  2MIB A;  4HA2 A;  1TOO A;  2KKI A;  3BAQ A;  4H75 A;  3VT0 A;  1RML A;  4MZF B;  1SR4 A;  3FFZ A;  5FNW A;  2DS0 A;  2WRY A;  3FGM A;  2E4M C;  2RQ9 A;  3AKI A;  4L4H A;  1S0E A;  2Y9F A;  4JKQ A;  1QXM A;  2BEB A;  3VT1 A;  3E8L C;  1UPS A;  3F1R A;  2VXT I;  3OJM A;  21BI A;  1HWO B;  2YUG A;  2NZ9 A;  1FN0 A;  1HCD A;  3K1X A;  2VSA A;  5I1B A;  4X38 A;  1S0C A;  4DCK C;  1XZZ A;  3RTJ B;  2VXR A;  1BLA A;  3HMY A;  4HR6 C;  3BA4 A;  4A7Z A;  3CRH A;  4QC4 A;  5DZU A;  3S8K A;  4XFS A;  5BP5 C;  3WMU A;  3FJ9 A;  4JAW A;  2RST A;  4I7I A;  1WBC A;  2GZB A;  4I4O A;  5FZY A;  1IRA X;  1FMM S;  1IT0 A;  3BRG C;  2K8R A;  3V0A B;  3Q7X A;  1J0S A;  3N7K A;  3O5W B;  2HW9 A;  2AAI B;  5F8S A;  4Q91 A;  4EFP A;  3FJ8 A;  2HWM A;  4ZFU B;  1F31 A;  4KBB A;  3I2A A;  1TIE A;  2P23 A;  3OBR A;  3NBE A;  4MZH A;  4DEP A;  2NS2 A;  3AKF A;  1YYN A;  5B2H A;  4YOL A;  4AN6 A;  1G9A A;  1SZ6 B;  1NZK A;  3BAG A;  4JKX B;  4LO1 A;  4Q9G A;  1ILR 1;  1MC9 A;  1S0B A;  4ISQ A;  4Z8S B;  5DUY A;  3H6R B;  2D22 A;  3UJ0 A;  1W3F A;  1Z2V A;  5BXT A;  3FUQ A;  8I1B A;  3BRD A;  1IRP A;  3CA4 A;  3ZC8 A;  4GOY A;  5BXR A;  4OEF A;  4JQ0 A;  6I1B A;  2FGF A;  1ISW A;  1PZZ A;  1R8O A;  3N7M A;  2BEA A;  3BAD A;  4PC4 A;  5D63 A;  3HOM A;  4DEN A;  1QQK A;  4KEJ A;  1DFQ A;  1JT4 A;  1EYL A;  4GP3 A;  1AF9 A;  3IM5 A;  4I4R A;  3Q7Y A;  4QAL A;  2NYY A;  4EFQ A;  4LO3 C;  4GAI A;  3OJV A;  3UD8 A;  4I1B A;  1PUM B;  4I0Y A;  1V6U A;  2FO1 A;  3FJK A;  2KH2 A;  5DVH A;  1PWA A;  1Q03 A;  1FV2 A;  2FFU A;  4G1R A;  4Q9P A;  4EB2 B;  4IY9 A;  3H6S E;  4QO3 A;  4I4U A;  1N4K A;  2D20 A;  4UY4 A;  5GAQ A;  2X2S A;  2NP0 A;  4ZGR B;  1TWM A;  31BI A;  3FJA A;  5JMC A;  1QQL A;  2FFV A;  3P6I A;  1ITB A;  3QYD A;  2DRE A;  3AJ6 A;  5E24 E;  4LO2 C;  3OJ2 A;  5BQU C;  4G9N A;  1W3A A;  1L2H A;  4D0T A;  1IJT A;  3FJC A;  4EEE B;  1BFB A;  2KI6 B;  41BI A;  4LO8 B;  1AXM A;  3BRF A;  3IM7 A;  2I1B A;  3BA5 A;  2F8X C;  3TC2 A;  1II4 A;  3FJJ A;  5DSS B;  3LTQ A;  3CU1 B;  4IYB A;  1M2T B;  3FJD A;  2AFG A;  2Y9X E;  4KEK A;  3PG0 A;  3I2X A;  3VSZ A;  2ESU A;  3C9Z A;  3I29 B;  5EC5 A;  1S0L A;  1V6W A;  4R6U B;  3RMY A;  4EKX B;  3JRR A;  4P6A A;  1RG8 A;  5FNX A;  3V0B B;  3IM6 A;  3KMV A;  4LO0 C;  2ZR1 B;  4I2S A;  1JLY A;  3WIN A;  3BB2 A;  2D44 A;  4I4X A;  1XHB A;  1HKN A;  4HJJ A;  1I1B A;  3AH4 A;  1T4Q A;  2X2T A;  1TP0 A;  2F2F C;  1W3G A;  3ZXD A;  4ION A;  4P0L A;  3IAG C;  4GAF A;  2DRY A;  4IQP A;  4OWJ A;  3BX1 C;  5BXS A;  2KLL A;  4L4I A;  4ZFW B;  4OEE A;  3VT2 A;  2E4M A;  3AZW A;  1K5U A;  3WO4 A;  3WO2 A;  2XOA A;  2D7R A;  2NTD A;  3H6Q A;  4GOV A;  2UUS A;  2FDB M;  4IHZ A;  4ZFY B;  1BFF A;  1AVW B;  3PHZ A;  1FWU A;  3UD9 A;  4KEI A;  3AJ5 A;  3ZX7 A;  1A8D A;  3T8S A;  1K5V A;  1HCE A;  4ZBV B;  3EF2 A;  2NVH A;  3CA6 A;  1JTC A;  1EVT A;  3AZV A;  3RMX A;  4QKR A;  4END A;  3WMV A;  4ZOT A;  3RSJ A;  3NBD A;  1P63 A;  5BP5 A;  3HAL A;  5FZU A;  4I4S A;  5G00 A;  1WD3 A;  4WBC A;  2D23 A;  4J2S A;  1JLX A;  3A23 A;  4X3A A;  4ZA3 B;  2Q3N B;  1EV2 A;  1ISV A;  1HWM B;  1S0D A;  4AN7 B;  3CA0 A;  3O4O A;  2K43 A;  4OUJ A;  2VU9 A;  1V6X A;  2VUA A;  1VCL A;  3R4U A;  4I3N A;  4XFU A;  4A7Y A;  3AKG A;  1HWN B;  2HWA A;  1Q1U A;  2BFH A;  4X37 A;  2Y9W C;  4CJM A;  1YF8 B;  1BFG A;  4IY8 A;  2KI4 A;  1FQ9 A;  1DZD A;  4I8M A;  4OWL A;  4OW4 A;  3VUO A;  1NUN A;  2L5X A;  3CQA A;  2MLL B;  4I37 A;  4QBV A;  1DFC A;  2WBC A;  4I4Y A;  3ILA A;  3UD7 A;  3FJF A;  3ZXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...