4OWJA

Crystal structure of the vibrio vulnificus hemolysin/cytolysin beta-trefoil lectin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
MAHVTLQSLSNNDLCLDVYGENGDKTVAGGSVNGWSCHGSWNQVWGLDKEERYRSRVASDRCLTVNADKTLTVEQCGANLAQKWYWEGDKLISRYVDGNNTRYLLNIVGGRNVQVTPENEANQARWKPTLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Glycan Specificity of the Vibrio vulnificus Hemolysin Lectin Outlines Evolutionary History of Membrane Targeting by a Toxin Family.
pubmed doi rcsb
molecule keywords Cytolysin
molecule tags Toxin
source organism Vibrio vulnificus
total genus 35
structure length 131
sequence length 131
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4owjA00
3VUOA 2D44A 4LO0A 1WBAA 4IONA 3NBEA 4ZKTB 4QBVA 3HALA 4I4SA 3BAOA 1ISZA 1ABRB 4H9WA 4JP0A 1G82A 3CAHA 4J2YA 2ERMA 1P63A 1ITBA 3BTAA 4USPA 4LO3C 4X37A 1V6UA 1S0GA 3D7WB 3VEQA 2GO2A 1IRAX 3FJBA 3HSMA 1N4KA 1RZOB 1BARA 2BEAA 5BVPI 3AH4A 3FUQA 1PC8B 3IM7A 1OQLB 4G6JA 4KEKA 5B2HA 1V6VA 1JT5A 2I1BA 4IZEA 3R4SA 4QO3A 2KKIA 3UD9A 1II4A 2VSEA 1QQLA 4L4HA 4AN6A 41BIA 3BX1C 4H04A 2MIBA 3V0AB 2M49A 3CA5A 4I4UA 2D7RA 3V0BA 5EHAA 5DVHA 2ESUA 3I2XA 3NJ5A 3CRIA 3VT2A 2DRZA 3FJJA 4I4OA 3ZXGA 4J2KA 1AVXB 4I7IA 3ZC8A 3K1XA 1BFGA 2MLLB 4DCKC 2VU9A 1Z4SA 3AJ6A 3A21A 4EFQA 2DS0A 3OBRA 1RY7A 4JRAA 3BRGC 3PHZA 2KI4A 5BQUA 3AKGA 2RQ9A 3FJIA 3EF2A 3AKHA 1D0HA 1TP0A 4Z9WB 1SR4C 2AQZA 4G9MA 3BAUA 4OWJA 2L5XA 2R9KB 8I1BA 3CA4A 4P0LA 1YTOA 1W3FA 1S0EA 1WD4A 4GP3A 3AZWA 2NP0A 4Q9PA 2NM1A 3VT0A 4P6AA 4QKSA 4I4RA 4IY8A 1JQZA 3UJ4A 5BOWA 4F34A 2AFGA 2DREA 3E8LC 2D23A 3F1RA 4KEIA 4I2SA 2IHOA 4GP0A 3FGMA 2HW9A 4J2SA 4I1BA 5FNXA 3N7MA 3R4UA 2K4AB 3VWCA 2ZQNA 2GZBA 1QXMA 1XZZA 3WMUA 3QYDA 3HN1A 2HZ9A 2FFUA 4QBCA 1T4QA 3OJMA 2LIEA 3FFZA 2D22A 2FFVA 1K5UA 2XOAA 3A07A 1IILA 3CA0A 5E24E 2D20A 1S0FA 5BXTA 3V0BB 3CA6A 4OEEA 1IHKA 3FJHA 2F2FA 4ZOTA 3VSZA 1PUUB 3WINC 4Q9GA 1BLDA 3W9TA 4I37A 4JKXB 3WO4A 2ZQOA 5BXSA 2WRYA 1ISYA 3NBDA 3H6QA 4PC4A 4DENA 1CE7B 1W3AA 4JPZA 4EKXB 3FJDA 1FWUA 3O3QA 4QKRA 4ENDA 4LO2C 1FV2A 4I96A 2K8RA 3JRRA 1XYFA 4WBCA 1RG8A 3FJKA 1TIEA 1Z0HA 4JKQA 5F8SA 4LO0C 2DRYA 2QYIB 3ZC9A 2Y9XE 1ISVA 4A7KA 4I0YA 4J2XA 1EPWA 4I4PA 2NTDA 4OEFA 4XFUA 4OWKA 1MC9A 1HWPB 1R8OA 4USOA 1I1EA 1DQOA 1HCDA 3POKA 3AJ5A 1XHBA 4X38A 1KNMA 2KH2A 1EVTA 1ONKB 4TLPA 4CJMA 4KEJA 2VUAA 3O4BA 1Z2VA 3CA3A 2X2TA 1BFFA 1G9DA 3AH2A 1VCLA 3BA4A 2Q3NB 2QN4A 2RG9B 4LO1A 4ZA3B 4ZFYB 4HR6C 1DQGA 1T9FA 4Z8SB 3CQAA 4D8HA 3TC2A 5DUYA 1G9AA 1HCEA 2K43A 2ZR1B 3OJ2A 1BLAA 4YOLA 4A7YA 1IJTA 3I29B 4I4QA 1Q1UA 3WO2A 4GOVA 4X39A 1SZ6B 3RMXA 3A23A 1Q04A 1TWEA 3KMVA 1HWMB 3RTJB 1FMMS 4G1RA 5JMCA 3O49A 3N7LA 2BEBA 1AXMA 1QQKA 5I1BA 4QD2B 4JQ0A 4Q91A 3IIRA 1FV3A 3UJ0A 1FQ9A 4ZFWB 3N7JA 3S8KA 1JLYA 4G9NA 1DLLA 3HBWA 3V79C 4JAWA 2J3PA 1BFCA 4EFPA 3OBTA 5FZUA 3CRHA 5FZZA 2IWTB 5DZUA 5GAQA 4ZFUB 2D24A 1W3GA 5F8YA 3ZXDA 4LO8B 2HWMA 1AF9A 5BQUC 4GOYA 2HWAA 3I2AA 1WBCA 2X2SA 3RTIB 1HWOB 1ISWA 4OW4A 5HPZA 3AH1A 4XFTA 2AAIB 3SNVA 4I4YA 1NUNA 5G00A 1FGAA 3QR5A 1AVWB 2FGFA 4I8MA 4X3AA 1JLXA 1V6WA 4EFRA 1HIBA 1YYNA 4I3NA 4OWLA 4XKIA 1ILR1 1DIWA 1PZZA 5BP5A 3BAVA 3FJ8A 4EB2B 3PUBA 1HKNA 4A7ZA 4ZLBB 4D0TA 2Y9WC 4GAIA 1YF8B 3BADA 2RSTA 3BAHA 4J23B 1Q03A 2FDBM 1DZCA 2NZ9A 3O5WB 3UDAA 3MPPG 4L4IA 3FJ9A 2E4MC 1GGPB 2UUSA 1M2TB 3PG0A 1CVSA 2BFHA 3CU1B 3IM5A 3FJEA 1YBIA 4HA2A 4IY9A 1A8DA 1BFBA 4QC4A 3BB2A 3LTQA 3UD7A 5D62A 2NYYA 4LO2A 1BASA 1EYLA 3P6JA 4QD2C 1PUMB 4LO3A 3NBCA 1S0LA 4IHZA 3AKFA 5DSSB 4FGFA 2VXRA 3ILAA 3HMYA 3VT1A 2D43A 2LIQA 2WBCA 1RMLA 1JT7A 3BA5A 4QALA 3OGGA 4I1EA 3PMEA 4I6IA 4LO7B 3JUTA 4P0JA 3O4CA 1EV2A 4IQPA 1JTCA 3NBNA 2P39A 3BAQA 3C9ZA 2Q9XA 4IYBA 3T8SA 4DEPA 3BAGA 5D61A 2KLLA 1TWMA 1TFMB 2D7IA 3FUOA 2ET2A 2VSAA 3B9UA 4ZBVB 5FNWA 1J0SA 3IAGC 3WO3A 3MALA 1JT3A 4I4XA 1FMZA 3O4AA 1AFCA 2P23A 1V6XA 3Q7YA 5BXRA 1S0DA 3A22A 1PWAA 3H6RA 5D63A 2YUGA 4LO1C 1JT4A 5EC5A 1HWNB 1S0CA 4OEGA 1FN0A 1BA7A 5F90A 3BA7A 6I1BA 5FZYA 4KC3A 3H6SE 3N7KA 3AKIA 3Q7XA 1R8NA 3O44A 31BIA 1ISXA 4AN7B 2Z48A 1M16A 4KBBA 2Z49A 1SR4A 1I1BA 3N0KA 1TOOA 3P53A 3F62B 2NVHA 1L2HA 4G6MA 1YXWA 3HOMA 4HJJA 2KI6B 1AVAC 3BRDA 5EG6C 1DFQA 5BXPA 3Q7WA 1IT0A 2Y9FA 4FVVA 4R6UB 1IOBA 3UD8A 3WMVA 4II0A 2AXMA 4I4VA 4F83A 1XG6A 3OJVA 2FO1A 1F31A 1DJSB 1K5VA 4EEEB 3FJFA 3BRFA 3FJCA 4LO7C 3CRGA 3AZVA 4ZGRB 1JY0A 4ISQA 4IZXA 3RSJA 3OGFA 3WA1A 1DZDA 7I1BA 1MD6A 1DFCA 4D0ZA 2Y9GA 1AVUA 4OUJA 1IRPA 4XFSA 5F8WA 3IM6A 3V0AA 1G9BA 4GAFA 3LLPA 5JLVA 2E4MA 1S0BA 4ISRA 2MC2A 3WINA 1G9CA 2VLCA 1WD3A 3FJAA 3H6RB 2F8XC 3P6IA 3ZX7A 5BP5C 3O4OA 3RMYA 9ILBA 1NZKA 3S8JA 3CA1A 4P0KA 2VXTI 1E0OA 1FWVA 21BIA 1UPSA 1TTUA 3O4DA 2F2FC 3VSFA 2D1ZA
chains in the Genus database with same CATH superfamily
3VUOA 2D44A 4LO0A 1WBAA 4IONA 3NBEA 4ZKTB 4QBVA 3HALA 4I4SA 3BAOA 1ISZA 1ABRB 4H9WA 4JP0A 1G82A 3CAHA 4J2YA 2ERMA 1P63A 1ITBA 3BTAA 4USPA 4LO3C 4UY4A 4X37A 1V6UA 1S0GA 3D7WB 3VEQA 2GO2A 1IRAX 3FJBA 3HSMA 1N4KA 1RZOB 1BARA 2BEAA 5BVPI 3AH4A 3FUQA 1PC8B 3IM7A 1OQLB 4G6JA 4KEKA 5B2HA 1V6VA 1JT5A 2I1BA 4IZEA 3R4SA 4QO3A 2KKIA 3UD9A 1II4A 2VSEA 1QQLA 4L4HA 4AN6A 41BIA 3BX1C 4H04A 2MIBA 3V0AB 2M49A 3CA5A 4I4UA 2D7RA 3V0BA 5EHAA 5DVHA 2ESUA 3I2XA 3NJ5A 3CRIA 3VT2A 2DRZA 3FJJA 4I4OA 3ZXGA 4J2KA 1AVXB 4I7IA 3ZC8A 3K1XA 1BFGA 2MLLB 4DCKC 2VU9A 1Z4SA 3AJ6A 3A21A 4EFQA 2DS0A 3OBRA 1RY7A 4JRAA 3BRGC 3PHZA 2KI4A 5BQUA 3AKGA 2RQ9A 3FJIA 3EF2A 3AKHA 1D0HA 1TP0A 4Z9WB 1SR4C 2AQZA 4G9MA 3BAUA 4OWJA 2L5XA 2R9KB 8I1BA 3CA4A 4P0LA 1YTOA 1W3FA 1S0EA 1WD4A 4GP3A 3AZWA 2NP0A 4Q9PA 2NM1A 3VT0A 4P6AA 4QKSA 4I4RA 4IY8A 1JQZA 3UJ4A 5BOWA 4F34A 2AFGA 2DREA 3E8LC 2D23A 3F1RA 4KEIA 4I2SA 2IHOA 4GP0A 3FGMA 2HW9A 4J2SA 4I1BA 5FNXA 3N7MA 3R4UA 2K4AB 3VWCA 2ZQNA 2GZBA 1QXMA 1XZZA 3WMUA 3QYDA 3HN1A 2HZ9A 2FFUA 4QBCA 1T4QA 3OJMA 2LIEA 3FFZA 2D22A 2FFVA 1K5UA 2XOAA 3A07A 1IILA 3CA0A 5E24E 2D20A 4MZFB 1S0FA 5BXTA 3V0BB 3CA6A 4OEEA 1IHKA 3FJHA 2F2FA 4ZOTA 3VSZA 1PUUB 3WINC 4Q9GA 1BLDA 3W9TA 4I37A 4JKXB 3WO4A 2ZQOA 4MZHA 2WRYA 5BXSA 1ISYA 3NBDA 3H6QA 4PC4A 4DENA 1CE7B 1W3AA 4JPZA 4EKXB 3FJDA 1FWUA 3O3QA 4QKRA 4ENDA 4LO2C 1FV2A 4I96A 2K8RA 3JRRA 1XYFA 4WBCA 1RG8A 3FJKA 1TIEA 1Z0HA 4JKQA 5F8SA 4LO0C 2DRYA 2QYIB 3ZC9A 2Y9XE 1ISVA 4A7KA 4I0YA 4J2XA 1EPWA 4I4PA 2NTDA 4OEFA 4XFUA 4OWKA 1MC9A 1HWPB 1R8OA 4USOA 1I1EA 1DQOA 1HCDA 3POKA 3AJ5A 1XHBA 4X38A 1KNMA 2KH2A 1EVTA 1ONKB 4TLPA 4CJMA 4KEJA 2VUAA 3O4BA 1Z2VA 3CA3A 2X2TA 1BFFA 1G9DA 3AH2A 1VCLA 3BA4A 2Q3NB 2QN4A 2RG9B 4LO1A 4ZA3B 4ZFYB 4HR6C 1DQGA 1T9FA 4Z8SB 3CQAA 4D8HA 3TC2A 5DUYA 1G9AA 1HCEA 2K43A 2ZR1B 3OJ2A 1BLAA 4YOLA 4A7YA 1IJTA 3I29B 4I4QA 1Q1UA 3WO2A 4GOVA 4X39A 1SZ6B 3RMXA 3A23A 1Q04A 1TWEA 3KMVA 1HWMB 3RTJB 1FMMS 4G1RA 5JMCA 3O49A 3N7LA 2BEBA 1AXMA 1QQKA 5I1BA 4QD2B 4JQ0A 4Q91A 3IIRA 1FV3A 3UJ0A 1FQ9A 4ZFWB 4MZGB 3N7JA 3S8KA 1JLYA 4G9NA 1DLLA 3HBWA 3V79C 4JAWA 2J3PA 1BFCA 4EFPA 3OBTA 5FZUA 3CRHA 5FZZA 2IWTB 5DZUA 5GAQA 4ZFUB 2D24A 1W3GA 5F8YA 3ZXDA 4LO8B 2HWMA 1AF9A 5BQUC 4GOYA 2HWAA 3I2AA 1WBCA 2X2SA 3RTIB 1HWOB 1ISWA 4OW4A 5HPZA 3AH1A 4XFTA 2AAIB 3SNVA 4I4YA 1NUNA 5G00A 1FGAA 3QR5A 1AVWB 2FGFA 4I8MA 4X3AA 1JLXA 1V6WA 4EFRA 1HIBA 1YYNA 4I3NA 4OWLA 4XKIA 1ILR1 1DIWA 1PZZA 5BP5A 3BAVA 3FJ8A 4EB2B 3PUBA 1HKNA 4A7ZA 4ZLBB 4D0TA 2Y9WC 4GAIA 1YF8B 3BADA 2RSTA 3BAHA 4J23B 1Q03A 2FDBM 1DZCA 2NZ9A 3O5WB 3UDAA 3MPPG 4L4IA 3FJ9A 2E4MC 1GGPB 2UUSA 1M2TB 3PG0A 1CVSA 2BFHA 3CU1B 3IM5A 3FJEA 1YBIA 4HA2A 4IY9A 1A8DA 1BFBA 4QC4A 3BB2A 3LTQA 3UD7A 5D62A 2NYYA 4LO2A 1BASA 1EYLA 3P6JA 4QD2C 1PUMB 4LO3A 3NBCA 1S0LA 4IHZA 3AKFA 2NS2A 5DSSB 4FGFA 2VXRA 3ILAA 3HMYA 3VT1A 2D43A 2LIQA 2WBCA 1RMLA 1JT7A 3BA5A 4QALA 3OGGA 4I1EA 3PMEA 4I6IA 4LO7B 3JUTA 4P0JA 3O4CA 1EV2A 4IQPA 1JTCA 3NBNA 2P39A 3BAQA 3C9ZA 2Q9XA 4IYBA 3T8SA 4DEPA 3BAGA 5D61A 2KLLA 1TWMA 1TFMB 2D7IA 3FUOA 2ET2A 2VSAA 3B9UA 4ZBVB 5FNWA 1J0SA 3IAGC 3WO3A 3MALA 1JT3A 4I4XA 1FMZA 3O4AA 1AFCA 2P23A 1V6XA 3Q7YA 5BXRA 1S0DA 3A22A 1PWAA 3H6RA 5D63A 2YUGA 4LO1C 1JT4A 5EC5A 1HWNB 1S0CA 4OEGA 1FN0A 1BA7A 5F90A 3BA7A 6I1BA 5FZYA 4KC3A 3H6SE 3N7KA 3AKIA 3Q7XA 1R8NA 3O44A 31BIA 1ISXA 4AN7B 2Z48A 1M16A 4KBBA 2Z49A 1SR4A 1I1BA 3N0KA 1TOOA 3P53A 3F62B 2NVHA 1L2HA 4G6MA 1YXWA 3HOMA 4HJJA 2KI6B 1AVAC 3BRDA 5EG6C 1DFQA 5BXPA 3Q7WA 1IT0A 2Y9FA 4FVVA 4R6UB 1IOBA 3UD8A 3WMVA 4II0A 2AXMA 4I4VA 4F83A 1XG6A 3OJVA 2FO1A 1F31A 1DJSB 1K5VA 4EEEB 3FJFA 3BRFA 3FJCA 4LO7C 3CRGA 3AZVA 4ZGRB 1JY0A 4ISQA 4IZXA 3RSJA 3OGFA 3WA1A 1DZDA 7I1BA 1MD6A 1DFCA 4D0ZA 4H75A 2Y9GA 1AVUA 4OUJA 1IRPA 4XFSA 5F8WA 3IM6A 3V0AA 1G9BA 4GAFA 3LLPA 5JLVA 2E4MA 1S0BA 4ISRA 2MC2A 3WINA 1G9CA 2VLCA 1WD3A 3FJAA 3H6RB 2F8XC 3P6IA 3ZX7A 5BP5C 3O4OA 3RMYA 9ILBA 1NZKA 3S8JA 3CA1A 4P0KA 2VXTI 1E0OA 1FWVA 21BIA 1UPSA 1TTUA 3O4DA 2F2FC 3VSFA 2D1ZA
chains in the Genus database with same CATH topology
3VUOA 2D44A 4LO0A 1WBAA 4IONA 3NBEA 4ZKTB 4QBVA 3HALA 4I4SA 3BAOA 1ISZA 1ABRB 4H9WA 4JP0A 1G82A 3CAHA 4J2YA 2ERMA 1P63A 1ITBA 3BTAA 4USPA 4LO3C 4UY4A 4X37A 1V6UA 1S0GA 3D7WB 3VEQA 2GO2A 1IRAX 3FJBA 3HSMA 1N4KA 1RZOB 1BARA 2BEAA 5BVPI 3AH4A 3FUQA 1PC8B 3IM7A 1OQLB 4G6JA 4KEKA 5B2HA 1V6VA 1JT5A 2I1BA 4IZEA 3R4SA 4QO3A 2KKIA 3UD9A 1II4A 2VSEA 1QQLA 4L4HA 4AN6A 41BIA 3BX1C 4H04A 2MIBA 3V0AB 2M49A 3CA5A 4I4UA 2D7RA 3V0BA 5EHAA 5DVHA 2ESUA 3I2XA 3NJ5A 3CRIA 3VT2A 2DRZA 3FJJA 4I4OA 3ZXGA 4J2KA 1AVXB 4I7IA 3ZC8A 3K1XA 1BFGA 2MLLB 4DCKC 2VU9A 1Z4SA 3AJ6A 3A21A 4EFQA 2DS0A 3OBRA 1RY7A 4JRAA 3BRGC 3PHZA 2KI4A 5BQUA 3AKGA 2RQ9A 3FJIA 3EF2A 3AKHA 1D0HA 1TP0A 4Z9WB 1SR4C 2AQZA 4G9MA 3BAUA 4OWJA 2L5XA 2R9KB 8I1BA 3CA4A 4P0LA 1YTOA 1W3FA 1S0EA 1WD4A 4GP3A 3AZWA 2NP0A 4Q9PA 2NM1A 3VT0A 4P6AA 4QKSA 4I4RA 4IY8A 1JQZA 3UJ4A 5BOWA 4F34A 2AFGA 2DREA 3E8LC 2D23A 3F1RA 4KEIA 4I2SA 2IHOA 4GP0A 3FGMA 2HW9A 4J2SA 4I1BA 5FNXA 3N7MA 3R4UA 2K4AB 3VWCA 2ZQNA 2GZBA 1QXMA 1XZZA 3WMUA 3QYDA 3HN1A 2HZ9A 2FFUA 4QBCA 1T4QA 3OJMA 2LIEA 3FFZA 2D22A 2FFVA 1K5UA 2XOAA 3A07A 1IILA 3CA0A 5E24E 2D20A 4MZFB 1S0FA 5BXTA 3V0BB 3CA6A 4OEEA 1IHKA 3FJHA 2F2FA 4ZOTA 3VSZA 1PUUB 3WINC 4Q9GA 1BLDA 3W9TA 4I37A 4JKXB 3WO4A 2ZQOA 4MZHA 2WRYA 5BXSA 1ISYA 3NBDA 3H6QA 4PC4A 4DENA 1CE7B 1W3AA 4JPZA 4EKXB 3FJDA 1FWUA 3O3QA 4QKRA 4ENDA 4LO2C 1FV2A 4I96A 2K8RA 3JRRA 1XYFA 4WBCA 1RG8A 3FJKA 1TIEA 1Z0HA 4JKQA 5F8SA 4LO0C 2DRYA 2QYIB 3ZC9A 2Y9XE 1ISVA 4A7KA 4I0YA 4J2XA 1EPWA 4I4PA 2NTDA 4OEFA 4XFUA 4OWKA 1MC9A 1HWPB 1R8OA 4USOA 1I1EA 1DQOA 1HCDA 3POKA 3AJ5A 1XHBA 4X38A 1KNMA 2KH2A 1EVTA 1ONKB 4TLPA 4CJMA 4KEJA 2VUAA 3O4BA 1Z2VA 3CA3A 2X2TA 1BFFA 1G9DA 3AH2A 1VCLA 3BA4A 2Q3NB 2QN4A 2RG9B 4LO1A 4ZA3B 4ZFYB 4HR6C 1DQGA 1T9FA 4Z8SB 3CQAA 4D8HA 3TC2A 5DUYA 1G9AA 1HCEA 2K43A 2ZR1B 3OJ2A 1BLAA 4YOLA 4A7YA 1IJTA 3I29B 4I4QA 1Q1UA 3WO2A 4GOVA 4X39A 1SZ6B 3RMXA 3A23A 1Q04A 1TWEA 3KMVA 1HWMB 3RTJB 1FMMS 4G1RA 5JMCA 3O49A 3N7LA 2BEBA 1AXMA 1QQKA 5I1BA 4QD2B 4JQ0A 4Q91A 3IIRA 1FV3A 3UJ0A 1FQ9A 4ZFWB 4MZGB 3N7JA 3S8KA 1JLYA 4G9NA 1DLLA 3HBWA 3V79C 4JAWA 2J3PA 1BFCA 4EFPA 3OBTA 5FZUA 3CRHA 5FZZA 2IWTB 5DZUA 5GAQA 4ZFUB 2D24A 1W3GA 5F8YA 3ZXDA 4LO8B 2HWMA 1AF9A 5BQUC 4GOYA 2HWAA 3I2AA 1WBCA 2X2SA 3RTIB 1HWOB 1ISWA 4OW4A 5HPZA 3AH1A 4XFTA 2AAIB 3SNVA 4I4YA 1NUNA 5G00A 1FGAA 3QR5A 1AVWB 2FGFA 4I8MA 4X3AA 1JLXA 1V6WA 4EFRA 1HIBA 1YYNA 4I3NA 4OWLA 4XKIA 1ILR1 1DIWA 1PZZA 5BP5A 3BAVA 3FJ8A 4EB2B 3PUBA 1HKNA 4A7ZA 4ZLBB 4D0TA 2Y9WC 4GAIA 1YF8B 3BADA 2RSTA 3BAHA 4J23B 1Q03A 2FDBM 1DZCA 2NZ9A 3O5WB 3UDAA 3MPPG 4L4IA 3FJ9A 2E4MC 1GGPB 2UUSA 1M2TB 3PG0A 1CVSA 2BFHA 3CU1B 3IM5A 3FJEA 1YBIA 4HA2A 4IY9A 1A8DA 1BFBA 4QC4A 3BB2A 3LTQA 3UD7A 5D62A 2NYYA 4LO2A 1BASA 1EYLA 3P6JA 4QD2C 1PUMB 4LO3A 3NBCA 1S0LA 4IHZA 3AKFA 2NS2A 5DSSB 4FGFA 2VXRA 3ILAA 3HMYA 3VT1A 2D43A 2LIQA 2WBCA 1RMLA 1JT7A 3BA5A 4QALA 3OGGA 4I1EA 3PMEA 4I6IA 4LO7B 3JUTA 4P0JA 3O4CA 1EV2A 4IQPA 1JTCA 3NBNA 2P39A 3BAQA 3C9ZA 2Q9XA 4IYBA 3T8SA 4DEPA 3BAGA 5D61A 2KLLA 1TWMA 1TFMB 2D7IA 3FUOA 2ET2A 2VSAA 3B9UA 4ZBVB 5FNWA 1J0SA 3IAGC 3WO3A 3MALA 1JT3A 4I4XA 1FMZA 3O4AA 1AFCA 2P23A 1V6XA 3Q7YA 5BXRA 1S0DA 3A22A 1PWAA 3H6RA 5D63A 2YUGA 4LO1C 1JT4A 5EC5A 1HWNB 1S0CA 4OEGA 1FN0A 1BA7A 5F90A 3BA7A 6I1BA 5FZYA 4KC3A 3H6SE 3N7KA 3AKIA 3Q7XA 1R8NA 3O44A 31BIA 1ISXA 4AN7B 2Z48A 1M16A 4KBBA 2Z49A 1SR4A 1I1BA 3N0KA 1TOOA 3P53A 3F62B 2NVHA 1L2HA 4G6MA 1YXWA 3HOMA 4HJJA 2KI6B 1AVAC 3BRDA 5EG6C 1DFQA 5BXPA 3Q7WA 1IT0A 2Y9FA 4FVVA 4R6UB 1IOBA 3UD8A 3WMVA 4II0A 2AXMA 4I4VA 4F83A 1XG6A 3OJVA 2FO1A 1F31A 1DJSB 1K5VA 4EEEB 3FJFA 3BRFA 3FJCA 4LO7C 3CRGA 3AZVA 4ZGRB 1JY0A 4ISQA 4IZXA 3RSJA 3OGFA 3WA1A 1DZDA 7I1BA 1MD6A 1DFCA 4D0ZA 4H75A 2Y9GA 1AVUA 4OUJA 1IRPA 4XFSA 5F8WA 3IM6A 3V0AA 1G9BA 4GAFA 3LLPA 5JLVA 2E4MA 1S0BA 4ISRA 2MC2A 3WINA 1G9CA 2VLCA 1WD3A 3FJAA 3H6RB 2F8XC 3P6IA 3ZX7A 5BP5C 3O4OA 3RMYA 9ILBA 1NZKA 3S8JA 3CA1A 4P0KA 2VXTI 1E0OA 1FWVA 21BIA 1UPSA 1TTUA 3O4DA 2F2FC 3VSFA 2D1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUO A;  2D44 A;  4LO0 A;  1WBA A;  4ION A;  3NBE A;  4ZKT B;  4QBV A;  3HAL A;  4I4S A;  3BAO A;  1ISZ A;  1ABR B;  4H9W A;  4JP0 A;  1G82 A;  3CAH A;  4J2Y A;  2ERM A;  1P63 A;  1ITB A;  3BTA A;  4USP A;  4LO3 C;  4X37 A;  1V6U A;  1S0G A;  3D7W B;  3VEQ A;  2GO2 A;  1IRA X;  3FJB A;  3HSM A;  1N4K A;  1RZO B;  1BAR A;  2BEA A;  5BVP I;  3AH4 A;  3FUQ A;  1PC8 B;  3IM7 A;  1OQL B;  4G6J A;  4KEK A;  5B2H A;  1V6V A;  1JT5 A;  2I1B A;  4IZE A;  3R4S A;  4QO3 A;  2KKI A;  3UD9 A;  1II4 A;  2VSE A;  1QQL A;  4L4H A;  4AN6 A;  41BI A;  3BX1 C;  4H04 A;  2MIB A;  3V0A B;  2M49 A;  3CA5 A;  4I4U A;  2D7R A;  3V0B A;  5EHA A;  5DVH A;  2ESU A;  3I2X A;  3NJ5 A;  3CRI A;  3VT2 A;  2DRZ A;  3FJJ A;  4I4O A;  3ZXG A;  4J2K A;  1AVX B;  4I7I A;  3ZC8 A;  3K1X A;  1BFG A;  2MLL B;  4DCK C;  2VU9 A;  1Z4S A;  3AJ6 A;  3A21 A;  4EFQ A;  2DS0 A;  3OBR A;  1RY7 A;  4JRA A;  3BRG C;  3PHZ A;  2KI4 A;  5BQU A;  3AKG A;  2RQ9 A;  3FJI A;  3EF2 A;  3AKH A;  1D0H A;  1TP0 A;  4Z9W B;  1SR4 C;  2AQZ A;  4G9M A;  3BAU A;  4OWJ A;  2L5X A;  2R9K B;  8I1B A;  3CA4 A;  4P0L A;  1YTO A;  1W3F A;  1S0E A;  1WD4 A;  4GP3 A;  3AZW A;  2NP0 A;  4Q9P A;  2NM1 A;  3VT0 A;  4P6A A;  4QKS A;  4I4R A;  4IY8 A;  1JQZ A;  3UJ4 A;  5BOW A;  4F34 A;  2AFG A;  2DRE A;  3E8L C;  2D23 A;  3F1R A;  4KEI A;  4I2S A;  2IHO A;  4GP0 A;  3FGM A;  2HW9 A;  4J2S A;  4I1B A;  5FNX A;  3N7M A;  3R4U A;  2K4A B;  3VWC A;  2ZQN A;  2GZB A;  1QXM A;  1XZZ A;  3WMU A;  3QYD A;  3HN1 A;  2HZ9 A;  2FFU A;  4QBC A;  1T4Q A;  3OJM A;  2LIE A;  3FFZ A;  2D22 A;  2FFV A;  1K5U A;  2XOA A;  3A07 A;  1IIL A;  3CA0 A;  5E24 E;  2D20 A;  1S0F A;  5BXT A;  3V0B B;  3CA6 A;  4OEE A;  1IHK A;  3FJH A;  2F2F A;  4ZOT A;  3VSZ A;  1PUU B;  3WIN C;  4Q9G A;  1BLD A;  3W9T A;  4I37 A;  4JKX B;  3WO4 A;  2ZQO A;  5BXS A;  2WRY A;  1ISY A;  3NBD A;  3H6Q A;  4PC4 A;  4DEN A;  1CE7 B;  1W3A A;  4JPZ A;  4EKX B;  3FJD A;  1FWU A;  3O3Q A;  4QKR A;  4END A;  4LO2 C;  1FV2 A;  4I96 A;  2K8R A;  3JRR A;  1XYF A;  4WBC A;  1RG8 A;  3FJK A;  1TIE A;  1Z0H A;  4JKQ A;  5F8S A;  4LO0 C;  2DRY A;  2QYI B;  3ZC9 A;  2Y9X E;  1ISV A;  4A7K A;  4I0Y A;  4J2X A;  1EPW A;  4I4P A;  2NTD A;  4OEF A;  4XFU A;  4OWK A;  1MC9 A;  1HWP B;  1R8O A;  4USO A;  1I1E A;  1DQO A;  1HCD A;  3POK A;  3AJ5 A;  1XHB A;  4X38 A;  1KNM A;  2KH2 A;  1EVT A;  1ONK B;  4TLP A;  4CJM A;  4KEJ A;  2VUA A;  3O4B A;  1Z2V A;  3CA3 A;  2X2T A;  1BFF A;  1G9D A;  3AH2 A;  1VCL A;  3BA4 A;  2Q3N B;  2QN4 A;  2RG9 B;  4LO1 A;  4ZA3 B;  4ZFY B;  4HR6 C;  1DQG A;  1T9F A;  4Z8S B;  3CQA A;  4D8H A;  3TC2 A;  5DUY A;  1G9A A;  1HCE A;  2K43 A;  2ZR1 B;  3OJ2 A;  1BLA A;  4YOL A;  4A7Y A;  1IJT A;  3I29 B;  4I4Q A;  1Q1U A;  3WO2 A;  4GOV A;  4X39 A;  1SZ6 B;  3RMX A;  3A23 A;  1Q04 A;  1TWE A;  3KMV A;  1HWM B;  3RTJ B;  1FMM S;  4G1R A;  5JMC A;  3O49 A;  3N7L A;  2BEB A;  1AXM A;  1QQK A;  5I1B A;  4QD2 B;  4JQ0 A;  4Q91 A;  3IIR A;  1FV3 A;  3UJ0 A;  1FQ9 A;  4ZFW B;  3N7J A;  3S8K A;  1JLY A;  4G9N A;  1DLL A;  3HBW A;  3V79 C;  4JAW A;  2J3P A;  1BFC A;  4EFP A;  3OBT A;  5FZU A;  3CRH A;  5FZZ A;  2IWT B;  5DZU A;  5GAQ A;  4ZFU B;  2D24 A;  1W3G A;  5F8Y A;  3ZXD A;  4LO8 B;  2HWM A;  1AF9 A;  5BQU C;  4GOY A;  2HWA A;  3I2A A;  1WBC A;  2X2S A;  3RTI B;  1HWO B;  1ISW A;  4OW4 A;  5HPZ A;  3AH1 A;  4XFT A;  2AAI B;  3SNV A;  4I4Y A;  1NUN A;  5G00 A;  1FGA A;  3QR5 A;  1AVW B;  2FGF A;  4I8M A;  4X3A A;  1JLX A;  1V6W A;  4EFR A;  1HIB A;  1YYN A;  4I3N A;  4OWL A;  4XKI A;  1ILR 1;  1DIW A;  1PZZ A;  5BP5 A;  3BAV A;  3FJ8 A;  4EB2 B;  3PUB A;  1HKN A;  4A7Z A;  4ZLB B;  4D0T A;  2Y9W C;  4GAI A;  1YF8 B;  3BAD A;  2RST A;  3BAH A;  4J23 B;  1Q03 A;  2FDB M;  1DZC A;  2NZ9 A;  3O5W B;  3UDA A;  3MPP G;  4L4I A;  3FJ9 A;  2E4M C;  1GGP B;  2UUS A;  1M2T B;  3PG0 A;  1CVS A;  2BFH A;  3CU1 B;  3IM5 A;  3FJE A;  1YBI A;  4HA2 A;  4IY9 A;  1A8D A;  1BFB A;  4QC4 A;  3BB2 A;  3LTQ A;  3UD7 A;  5D62 A;  2NYY A;  4LO2 A;  1BAS A;  1EYL A;  3P6J A;  4QD2 C;  1PUM B;  4LO3 A;  3NBC A;  1S0L A;  4IHZ A;  3AKF A;  5DSS B;  4FGF A;  2VXR A;  3ILA A;  3HMY A;  3VT1 A;  2D43 A;  2LIQ A;  2WBC A;  1RML A;  1JT7 A;  3BA5 A;  4QAL A;  3OGG A;  4I1E A;  3PME A;  4I6I A;  4LO7 B;  3JUT A;  4P0J A;  3O4C A;  1EV2 A;  4IQP A;  1JTC A;  3NBN A;  2P39 A;  3BAQ A;  3C9Z A;  2Q9X A;  4IYB A;  3T8S A;  4DEP A;  3BAG A;  5D61 A;  2KLL A;  1TWM A;  1TFM B;  2D7I A;  3FUO A;  2ET2 A;  2VSA A;  3B9U A;  4ZBV B;  5FNW A;  1J0S A;  3IAG C;  3WO3 A;  3MAL A;  1JT3 A;  4I4X A;  1FMZ A;  3O4A A;  1AFC A;  2P23 A;  1V6X A;  3Q7Y A;  5BXR A;  1S0D A;  3A22 A;  1PWA A;  3H6R A;  5D63 A;  2YUG A;  4LO1 C;  1JT4 A;  5EC5 A;  1HWN B;  1S0C A;  4OEG A;  1FN0 A;  1BA7 A;  5F90 A;  3BA7 A;  6I1B A;  5FZY A;  4KC3 A;  3H6S E;  3N7K A;  3AKI A;  3Q7X A;  1R8N A;  3O44 A;  31BI A;  1ISX A;  4AN7 B;  2Z48 A;  1M16 A;  4KBB A;  2Z49 A;  1SR4 A;  1I1B A;  3N0K A;  1TOO A;  3P53 A;  3F62 B;  2NVH A;  1L2H A;  4G6M A;  1YXW A;  3HOM A;  4HJJ A;  2KI6 B;  1AVA C;  3BRD A;  5EG6 C;  1DFQ A;  5BXP A;  3Q7W A;  1IT0 A;  2Y9F A;  4FVV A;  4R6U B;  1IOB A;  3UD8 A;  3WMV A;  4II0 A;  2AXM A;  4I4V A;  4F83 A;  1XG6 A;  3OJV A;  2FO1 A;  1F31 A;  1DJS B;  1K5V A;  4EEE B;  3FJF A;  3BRF A;  3FJC A;  4LO7 C;  3CRG A;  3AZV A;  4ZGR B;  1JY0 A;  4ISQ A;  4IZX A;  3RSJ A;  3OGF A;  3WA1 A;  1DZD A;  7I1B A;  1MD6 A;  1DFC A;  4D0Z A;  2Y9G A;  1AVU A;  4OUJ A;  1IRP A;  4XFS A;  5F8W A;  3IM6 A;  3V0A A;  1G9B A;  4GAF A;  3LLP A;  5JLV A;  2E4M A;  1S0B A;  4ISR A;  2MC2 A;  3WIN A;  1G9C A;  2VLC A;  1WD3 A;  3FJA A;  3H6R B;  2F8X C;  3P6I A;  3ZX7 A;  5BP5 C;  3O4O A;  3RMY A;  9ILB A;  1NZK A;  3S8J A;  3CA1 A;  4P0K A;  2VXT I;  1E0O A;  1FWV A;  21BI A;  1UPS A;  1TTU A;  3O4D A;  2F2F C;  3VSF A;  2D1Z A; 
#chains in the Genus database with same CATH topology
 3VUO A;  2D44 A;  4LO0 A;  1WBA A;  4ION A;  3NBE A;  4ZKT B;  4QBV A;  3HAL A;  4I4S A;  3BAO A;  1ISZ A;  1ABR B;  4H9W A;  4JP0 A;  1G82 A;  3CAH A;  4J2Y A;  2ERM A;  1P63 A;  1ITB A;  3BTA A;  4USP A;  4LO3 C;  4UY4 A;  4X37 A;  1V6U A;  1S0G A;  3D7W B;  3VEQ A;  2GO2 A;  1IRA X;  3FJB A;  3HSM A;  1N4K A;  1RZO B;  1BAR A;  2BEA A;  5BVP I;  3AH4 A;  3FUQ A;  1PC8 B;  3IM7 A;  1OQL B;  4G6J A;  4KEK A;  5B2H A;  1V6V A;  1JT5 A;  2I1B A;  4IZE A;  3R4S A;  4QO3 A;  2KKI A;  3UD9 A;  1II4 A;  2VSE A;  1QQL A;  4L4H A;  4AN6 A;  41BI A;  3BX1 C;  4H04 A;  2MIB A;  3V0A B;  2M49 A;  3CA5 A;  4I4U A;  2D7R A;  3V0B A;  5EHA A;  5DVH A;  2ESU A;  3I2X A;  3NJ5 A;  3CRI A;  3VT2 A;  2DRZ A;  3FJJ A;  4I4O A;  3ZXG A;  4J2K A;  1AVX B;  4I7I A;  3ZC8 A;  3K1X A;  1BFG A;  2MLL B;  4DCK C;  2VU9 A;  1Z4S A;  3AJ6 A;  3A21 A;  4EFQ A;  2DS0 A;  3OBR A;  1RY7 A;  4JRA A;  3BRG C;  3PHZ A;  2KI4 A;  5BQU A;  3AKG A;  2RQ9 A;  3FJI A;  3EF2 A;  3AKH A;  1D0H A;  1TP0 A;  4Z9W B;  1SR4 C;  2AQZ A;  4G9M A;  3BAU A;  4OWJ A;  2L5X A;  2R9K B;  8I1B A;  3CA4 A;  4P0L A;  1YTO A;  1W3F A;  1S0E A;  1WD4 A;  4GP3 A;  3AZW A;  2NP0 A;  4Q9P A;  2NM1 A;  3VT0 A;  4P6A A;  4QKS A;  4I4R A;  4IY8 A;  1JQZ A;  3UJ4 A;  5BOW A;  4F34 A;  2AFG A;  2DRE A;  3E8L C;  2D23 A;  3F1R A;  4KEI A;  4I2S A;  2IHO A;  4GP0 A;  3FGM A;  2HW9 A;  4J2S A;  4I1B A;  5FNX A;  3N7M A;  3R4U A;  2K4A B;  3VWC A;  2ZQN A;  2GZB A;  1QXM A;  1XZZ A;  3WMU A;  3QYD A;  3HN1 A;  2HZ9 A;  2FFU A;  4QBC A;  1T4Q A;  3OJM A;  2LIE A;  3FFZ A;  2D22 A;  2FFV A;  1K5U A;  2XOA A;  3A07 A;  1IIL A;  3CA0 A;  5E24 E;  2D20 A;  4MZF B;  1S0F A;  5BXT A;  3V0B B;  3CA6 A;  4OEE A;  1IHK A;  3FJH A;  2F2F A;  4ZOT A;  3VSZ A;  1PUU B;  3WIN C;  4Q9G A;  1BLD A;  3W9T A;  4I37 A;  4JKX B;  3WO4 A;  2ZQO A;  4MZH A;  2WRY A;  5BXS A;  1ISY A;  3NBD A;  3H6Q A;  4PC4 A;  4DEN A;  1CE7 B;  1W3A A;  4JPZ A;  4EKX B;  3FJD A;  1FWU A;  3O3Q A;  4QKR A;  4END A;  4LO2 C;  1FV2 A;  4I96 A;  2K8R A;  3JRR A;  1XYF A;  4WBC A;  1RG8 A;  3FJK A;  1TIE A;  1Z0H A;  4JKQ A;  5F8S A;  4LO0 C;  2DRY A;  2QYI B;  3ZC9 A;  2Y9X E;  1ISV A;  4A7K A;  4I0Y A;  4J2X A;  1EPW A;  4I4P A;  2NTD A;  4OEF A;  4XFU A;  4OWK A;  1MC9 A;  1HWP B;  1R8O A;  4USO A;  1I1E A;  1DQO A;  1HCD A;  3POK A;  3AJ5 A;  1XHB A;  4X38 A;  1KNM A;  2KH2 A;  1EVT A;  1ONK B;  4TLP A;  4CJM A;  4KEJ A;  2VUA A;  3O4B A;  1Z2V A;  3CA3 A;  2X2T A;  1BFF A;  1G9D A;  3AH2 A;  1VCL A;  3BA4 A;  2Q3N B;  2QN4 A;  2RG9 B;  4LO1 A;  4ZA3 B;  4ZFY B;  4HR6 C;  1DQG A;  1T9F A;  4Z8S B;  3CQA A;  4D8H A;  3TC2 A;  5DUY A;  1G9A A;  1HCE A;  2K43 A;  2ZR1 B;  3OJ2 A;  1BLA A;  4YOL A;  4A7Y A;  1IJT A;  3I29 B;  4I4Q A;  1Q1U A;  3WO2 A;  4GOV A;  4X39 A;  1SZ6 B;  3RMX A;  3A23 A;  1Q04 A;  1TWE A;  3KMV A;  1HWM B;  3RTJ B;  1FMM S;  4G1R A;  5JMC A;  3O49 A;  3N7L A;  2BEB A;  1AXM A;  1QQK A;  5I1B A;  4QD2 B;  4JQ0 A;  4Q91 A;  3IIR A;  1FV3 A;  3UJ0 A;  1FQ9 A;  4ZFW B;  4MZG B;  3N7J A;  3S8K A;  1JLY A;  4G9N A;  1DLL A;  3HBW A;  3V79 C;  4JAW A;  2J3P A;  1BFC A;  4EFP A;  3OBT A;  5FZU A;  3CRH A;  5FZZ A;  2IWT B;  5DZU A;  5GAQ A;  4ZFU B;  2D24 A;  1W3G A;  5F8Y A;  3ZXD A;  4LO8 B;  2HWM A;  1AF9 A;  5BQU C;  4GOY A;  2HWA A;  3I2A A;  1WBC A;  2X2S A;  3RTI B;  1HWO B;  1ISW A;  4OW4 A;  5HPZ A;  3AH1 A;  4XFT A;  2AAI B;  3SNV A;  4I4Y A;  1NUN A;  5G00 A;  1FGA A;  3QR5 A;  1AVW B;  2FGF A;  4I8M A;  4X3A A;  1JLX A;  1V6W A;  4EFR A;  1HIB A;  1YYN A;  4I3N A;  4OWL A;  4XKI A;  1ILR 1;  1DIW A;  1PZZ A;  5BP5 A;  3BAV A;  3FJ8 A;  4EB2 B;  3PUB A;  1HKN A;  4A7Z A;  4ZLB B;  4D0T A;  2Y9W C;  4GAI A;  1YF8 B;  3BAD A;  2RST A;  3BAH A;  4J23 B;  1Q03 A;  2FDB M;  1DZC A;  2NZ9 A;  3O5W B;  3UDA A;  3MPP G;  4L4I A;  3FJ9 A;  2E4M C;  1GGP B;  2UUS A;  1M2T B;  3PG0 A;  1CVS A;  2BFH A;  3CU1 B;  3IM5 A;  3FJE A;  1YBI A;  4HA2 A;  4IY9 A;  1A8D A;  1BFB A;  4QC4 A;  3BB2 A;  3LTQ A;  3UD7 A;  5D62 A;  2NYY A;  4LO2 A;  1BAS A;  1EYL A;  3P6J A;  4QD2 C;  1PUM B;  4LO3 A;  3NBC A;  1S0L A;  4IHZ A;  3AKF A;  2NS2 A;  5DSS B;  4FGF A;  2VXR A;  3ILA A;  3HMY A;  3VT1 A;  2D43 A;  2LIQ A;  2WBC A;  1RML A;  1JT7 A;  3BA5 A;  4QAL A;  3OGG A;  4I1E A;  3PME A;  4I6I A;  4LO7 B;  3JUT A;  4P0J A;  3O4C A;  1EV2 A;  4IQP A;  1JTC A;  3NBN A;  2P39 A;  3BAQ A;  3C9Z A;  2Q9X A;  4IYB A;  3T8S A;  4DEP A;  3BAG A;  5D61 A;  2KLL A;  1TWM A;  1TFM B;  2D7I A;  3FUO A;  2ET2 A;  2VSA A;  3B9U A;  4ZBV B;  5FNW A;  1J0S A;  3IAG C;  3WO3 A;  3MAL A;  1JT3 A;  4I4X A;  1FMZ A;  3O4A A;  1AFC A;  2P23 A;  1V6X A;  3Q7Y A;  5BXR A;  1S0D A;  3A22 A;  1PWA A;  3H6R A;  5D63 A;  2YUG A;  4LO1 C;  1JT4 A;  5EC5 A;  1HWN B;  1S0C A;  4OEG A;  1FN0 A;  1BA7 A;  5F90 A;  3BA7 A;  6I1B A;  5FZY A;  4KC3 A;  3H6S E;  3N7K A;  3AKI A;  3Q7X A;  1R8N A;  3O44 A;  31BI A;  1ISX A;  4AN7 B;  2Z48 A;  1M16 A;  4KBB A;  2Z49 A;  1SR4 A;  1I1B A;  3N0K A;  1TOO A;  3P53 A;  3F62 B;  2NVH A;  1L2H A;  4G6M A;  1YXW A;  3HOM A;  4HJJ A;  2KI6 B;  1AVA C;  3BRD A;  5EG6 C;  1DFQ A;  5BXP A;  3Q7W A;  1IT0 A;  2Y9F A;  4FVV A;  4R6U B;  1IOB A;  3UD8 A;  3WMV A;  4II0 A;  2AXM A;  4I4V A;  4F83 A;  1XG6 A;  3OJV A;  2FO1 A;  1F31 A;  1DJS B;  1K5V A;  4EEE B;  3FJF A;  3BRF A;  3FJC A;  4LO7 C;  3CRG A;  3AZV A;  4ZGR B;  1JY0 A;  4ISQ A;  4IZX A;  3RSJ A;  3OGF A;  3WA1 A;  1DZD A;  7I1B A;  1MD6 A;  1DFC A;  4D0Z A;  4H75 A;  2Y9G A;  1AVU A;  4OUJ A;  1IRP A;  4XFS A;  5F8W A;  3IM6 A;  3V0A A;  1G9B A;  4GAF A;  3LLP A;  5JLV A;  2E4M A;  1S0B A;  4ISR A;  2MC2 A;  3WIN A;  1G9C A;  2VLC A;  1WD3 A;  3FJA A;  3H6R B;  2F8X C;  3P6I A;  3ZX7 A;  5BP5 C;  3O4O A;  3RMY A;  9ILB A;  1NZK A;  3S8J A;  3CA1 A;  4P0K A;  2VXT I;  1E0O A;  1FWV A;  21BI A;  1UPS A;  1TTU A;  3O4D A;  2F2F C;  3VSF A;  2D1Z A; 
#chains in the Genus database with same CATH homology
 3VUO A;  2D44 A;  4LO0 A;  1WBA A;  4ION A;  3NBE A;  4ZKT B;  4QBV A;  3HAL A;  4I4S A;  3BAO A;  1ISZ A;  1ABR B;  4H9W A;  4JP0 A;  1G82 A;  3CAH A;  4J2Y A;  2ERM A;  1P63 A;  1ITB A;  3BTA A;  4USP A;  4LO3 C;  4UY4 A;  4X37 A;  1V6U A;  1S0G A;  3D7W B;  3VEQ A;  2GO2 A;  1IRA X;  3FJB A;  3HSM A;  1N4K A;  1RZO B;  1BAR A;  2BEA A;  5BVP I;  3AH4 A;  3FUQ A;  1PC8 B;  3IM7 A;  1OQL B;  4G6J A;  4KEK A;  5B2H A;  1V6V A;  1JT5 A;  2I1B A;  4IZE A;  3R4S A;  4QO3 A;  2KKI A;  3UD9 A;  1II4 A;  2VSE A;  1QQL A;  4L4H A;  4AN6 A;  41BI A;  3BX1 C;  4H04 A;  2MIB A;  3V0A B;  2M49 A;  3CA5 A;  4I4U A;  2D7R A;  3V0B A;  5EHA A;  5DVH A;  2ESU A;  3I2X A;  3NJ5 A;  3CRI A;  3VT2 A;  2DRZ A;  3FJJ A;  4I4O A;  3ZXG A;  4J2K A;  1AVX B;  4I7I A;  3ZC8 A;  3K1X A;  1BFG A;  2MLL B;  4DCK C;  2VU9 A;  1Z4S A;  3AJ6 A;  3A21 A;  4EFQ A;  2DS0 A;  3OBR A;  1RY7 A;  4JRA A;  3BRG C;  3PHZ A;  2KI4 A;  5BQU A;  3AKG A;  2RQ9 A;  3FJI A;  3EF2 A;  3AKH A;  1D0H A;  1TP0 A;  4Z9W B;  1SR4 C;  2AQZ A;  4G9M A;  3BAU A;  4OWJ A;  2L5X A;  2R9K B;  8I1B A;  3CA4 A;  4P0L A;  1YTO A;  1W3F A;  1S0E A;  1WD4 A;  4GP3 A;  3AZW A;  2NP0 A;  4Q9P A;  2NM1 A;  3VT0 A;  4P6A A;  4QKS A;  4I4R A;  4IY8 A;  1JQZ A;  3UJ4 A;  5BOW A;  4F34 A;  2AFG A;  2DRE A;  3E8L C;  2D23 A;  3F1R A;  4KEI A;  4I2S A;  2IHO A;  4GP0 A;  3FGM A;  2HW9 A;  4J2S A;  4I1B A;  5FNX A;  3N7M A;  3R4U A;  2K4A B;  3VWC A;  2ZQN A;  2GZB A;  1QXM A;  1XZZ A;  3WMU A;  3QYD A;  3HN1 A;  2HZ9 A;  2FFU A;  4QBC A;  1T4Q A;  3OJM A;  2LIE A;  3FFZ A;  2D22 A;  2FFV A;  1K5U A;  2XOA A;  3A07 A;  1IIL A;  3CA0 A;  5E24 E;  2D20 A;  4MZF B;  1S0F A;  5BXT A;  3V0B B;  3CA6 A;  4OEE A;  1IHK A;  3FJH A;  2F2F A;  4ZOT A;  3VSZ A;  1PUU B;  3WIN C;  4Q9G A;  1BLD A;  3W9T A;  4I37 A;  4JKX B;  3WO4 A;  2ZQO A;  4MZH A;  2WRY A;  5BXS A;  1ISY A;  3NBD A;  3H6Q A;  4PC4 A;  4DEN A;  1CE7 B;  1W3A A;  4JPZ A;  4EKX B;  3FJD A;  1FWU A;  3O3Q A;  4QKR A;  4END A;  4LO2 C;  1FV2 A;  4I96 A;  2K8R A;  3JRR A;  1XYF A;  4WBC A;  1RG8 A;  3FJK A;  1TIE A;  1Z0H A;  4JKQ A;  5F8S A;  4LO0 C;  2DRY A;  2QYI B;  3ZC9 A;  2Y9X E;  1ISV A;  4A7K A;  4I0Y A;  4J2X A;  1EPW A;  4I4P A;  2NTD A;  4OEF A;  4XFU A;  4OWK A;  1MC9 A;  1HWP B;  1R8O A;  4USO A;  1I1E A;  1DQO A;  1HCD A;  3POK A;  3AJ5 A;  1XHB A;  4X38 A;  1KNM A;  2KH2 A;  1EVT A;  1ONK B;  4TLP A;  4CJM A;  4KEJ A;  2VUA A;  3O4B A;  1Z2V A;  3CA3 A;  2X2T A;  1BFF A;  1G9D A;  3AH2 A;  1VCL A;  3BA4 A;  2Q3N B;  2QN4 A;  2RG9 B;  4LO1 A;  4ZA3 B;  4ZFY B;  4HR6 C;  1DQG A;  1T9F A;  4Z8S B;  3CQA A;  4D8H A;  3TC2 A;  5DUY A;  1G9A A;  1HCE A;  2K43 A;  2ZR1 B;  3OJ2 A;  1BLA A;  4YOL A;  4A7Y A;  1IJT A;  3I29 B;  4I4Q A;  1Q1U A;  3WO2 A;  4GOV A;  4X39 A;  1SZ6 B;  3RMX A;  3A23 A;  1Q04 A;  1TWE A;  3KMV A;  1HWM B;  3RTJ B;  1FMM S;  4G1R A;  5JMC A;  3O49 A;  3N7L A;  2BEB A;  1AXM A;  1QQK A;  5I1B A;  4QD2 B;  4JQ0 A;  4Q91 A;  3IIR A;  1FV3 A;  3UJ0 A;  1FQ9 A;  4ZFW B;  4MZG B;  3N7J A;  3S8K A;  1JLY A;  4G9N A;  1DLL A;  3HBW A;  3V79 C;  4JAW A;  2J3P A;  1BFC A;  4EFP A;  3OBT A;  5FZU A;  3CRH A;  5FZZ A;  2IWT B;  5DZU A;  5GAQ A;  4ZFU B;  2D24 A;  1W3G A;  5F8Y A;  3ZXD A;  4LO8 B;  2HWM A;  1AF9 A;  5BQU C;  4GOY A;  2HWA A;  3I2A A;  1WBC A;  2X2S A;  3RTI B;  1HWO B;  1ISW A;  4OW4 A;  5HPZ A;  3AH1 A;  4XFT A;  2AAI B;  3SNV A;  4I4Y A;  1NUN A;  5G00 A;  1FGA A;  3QR5 A;  1AVW B;  2FGF A;  4I8M A;  4X3A A;  1JLX A;  1V6W A;  4EFR A;  1HIB A;  1YYN A;  4I3N A;  4OWL A;  4XKI A;  1ILR 1;  1DIW A;  1PZZ A;  5BP5 A;  3BAV A;  3FJ8 A;  4EB2 B;  3PUB A;  1HKN A;  4A7Z A;  4ZLB B;  4D0T A;  2Y9W C;  4GAI A;  1YF8 B;  3BAD A;  2RST A;  3BAH A;  4J23 B;  1Q03 A;  2FDB M;  1DZC A;  2NZ9 A;  3O5W B;  3UDA A;  3MPP G;  4L4I A;  3FJ9 A;  2E4M C;  1GGP B;  2UUS A;  1M2T B;  3PG0 A;  1CVS A;  2BFH A;  3CU1 B;  3IM5 A;  3FJE A;  1YBI A;  4HA2 A;  4IY9 A;  1A8D A;  1BFB A;  4QC4 A;  3BB2 A;  3LTQ A;  3UD7 A;  5D62 A;  2NYY A;  4LO2 A;  1BAS A;  1EYL A;  3P6J A;  4QD2 C;  1PUM B;  4LO3 A;  3NBC A;  1S0L A;  4IHZ A;  3AKF A;  2NS2 A;  5DSS B;  4FGF A;  2VXR A;  3ILA A;  3HMY A;  3VT1 A;  2D43 A;  2LIQ A;  2WBC A;  1RML A;  1JT7 A;  3BA5 A;  4QAL A;  3OGG A;  4I1E A;  3PME A;  4I6I A;  4LO7 B;  3JUT A;  4P0J A;  3O4C A;  1EV2 A;  4IQP A;  1JTC A;  3NBN A;  2P39 A;  3BAQ A;  3C9Z A;  2Q9X A;  4IYB A;  3T8S A;  4DEP A;  3BAG A;  5D61 A;  2KLL A;  1TWM A;  1TFM B;  2D7I A;  3FUO A;  2ET2 A;  2VSA A;  3B9U A;  4ZBV B;  5FNW A;  1J0S A;  3IAG C;  3WO3 A;  3MAL A;  1JT3 A;  4I4X A;  1FMZ A;  3O4A A;  1AFC A;  2P23 A;  1V6X A;  3Q7Y A;  5BXR A;  1S0D A;  3A22 A;  1PWA A;  3H6R A;  5D63 A;  2YUG A;  4LO1 C;  1JT4 A;  5EC5 A;  1HWN B;  1S0C A;  4OEG A;  1FN0 A;  1BA7 A;  5F90 A;  3BA7 A;  6I1B A;  5FZY A;  4KC3 A;  3H6S E;  3N7K A;  3AKI A;  3Q7X A;  1R8N A;  3O44 A;  31BI A;  1ISX A;  4AN7 B;  2Z48 A;  1M16 A;  4KBB A;  2Z49 A;  1SR4 A;  1I1B A;  3N0K A;  1TOO A;  3P53 A;  3F62 B;  2NVH A;  1L2H A;  4G6M A;  1YXW A;  3HOM A;  4HJJ A;  2KI6 B;  1AVA C;  3BRD A;  5EG6 C;  1DFQ A;  5BXP A;  3Q7W A;  1IT0 A;  2Y9F A;  4FVV A;  4R6U B;  1IOB A;  3UD8 A;  3WMV A;  4II0 A;  2AXM A;  4I4V A;  4F83 A;  1XG6 A;  3OJV A;  2FO1 A;  1F31 A;  1DJS B;  1K5V A;  4EEE B;  3FJF A;  3BRF A;  3FJC A;  4LO7 C;  3CRG A;  3AZV A;  4ZGR B;  1JY0 A;  4ISQ A;  4IZX A;  3RSJ A;  3OGF A;  3WA1 A;  1DZD A;  7I1B A;  1MD6 A;  1DFC A;  4D0Z A;  4H75 A;  2Y9G A;  1AVU A;  4OUJ A;  1IRP A;  4XFS A;  5F8W A;  3IM6 A;  3V0A A;  1G9B A;  4GAF A;  3LLP A;  5JLV A;  2E4M A;  1S0B A;  4ISR A;  2MC2 A;  3WIN A;  1G9C A;  2VLC A;  1WD3 A;  3FJA A;  3H6R B;  2F8X C;  3P6I A;  3ZX7 A;  5BP5 C;  3O4O A;  3RMY A;  9ILB A;  1NZK A;  3S8J A;  3CA1 A;  4P0K A;  2VXT I;  1E0O A;  1FWV A;  21BI A;  1UPS A;  1TTU A;  3O4D A;  2F2F C;  3VSF A;  2D1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...