1JT3A

Human acidic fibroblast growth factor. 141 amino acid form with amino histidine tag and leu 73 replaced by val (l73v)
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
143
Chain Sequence
HHHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLVYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords acidic fibroblast growth factor
publication title Structure and stability effects of mutations designed to increase the primary sequence symmetry within the core region of a beta-trefoil.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 143
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1jt3A00
1A8DA 1IILA 2D7IA 2QN4A 2BEAA 4D0TA 1FQ9A 3Q7XA 3Q7YA 1FV2A 1GGPB 4J2KA 1W3GA 1DJSB 1IT0A 2M49A 3FJEA 3BX1C 3NJ5A 3BAUA 4I8MA 5DZUA 1N4KA 4I4RA 1VCLA 3UJ4A 4DCKC 1YTOA 1S0BA 4ZLBB 2VU9A 1Z4SA 1IOBA 1E0OA 3CRHA 3BA4A 3FJHA 4KBBA 4USOA 3AJ5A 4G9NA 3H6SE 3S8JA 3CAHA 1DIWA 4G6MA 3UD8A 3CU1B 5EG6C 1MC9A 2D7RA 2YUGA 4LO2A 2ESUA 3VWCA 1G82A 4EEEB 4OEEA 4GAFA 4XFTA 3UD7A 3WINC 3CA0A 2AAIB 1W3AA 2J3PA 4QBCA 2VXRA 1FN0A 21BIA 3T8SA 2Y9WC 1ISYA 2LIEA 3AKFA 2RSTA 1WD3A 1YYNA 3AZWA 1FGAA 4IONA 4I7IA 1EVTA 3AKIA 4AN7B 4H04A 2X2SA 1FMZA 2F2FA 2ZR1B 1Z0HA 3A23A 4KEKA 2K4AB 1RZOB 4L4IA 3V0BB 2E4MA 5BQUA 1AVXB 3NBEA 4P0LA 4XKIA 1TTUA 4ZOTA 1BFBA 4Q9GA 3OGGA 1W3FA 4QBVA 1HWPB 5FZYA 2VSEA 4QO3A 4FGFA 4X38A 1DFQA 4QKRA 3LTQA 2D44A 2Z49A 4I0YA 4LO8B 4CJMA 4USPA 3PUBA 4LO1C 5HPZA 5I1BA 3VSZA 5JMCA 4II0A 3H6RB 1JT4A 2FFUA 1T9FA 1SZ6B 3POKA 5FZZA 3AH1A 1P63A 4J2SA 3P6JA 1XZZA 2IHOA 3AH2A 3NBDA 5B2HA 2FGFA 1CE7B 1NUNA 1V6UA 4IYBA 3V79C 4LO3A 5F8WA 1S0FA 4IQPA 1Z2VA 2GZBA 2NTDA 4EB2B 5F8YA 3MPPG 4I4OA 3OBRA 2HZ9A 2P23A 4ZKTB 3AJ6A 4JAWA 3O5WB 1I1BA 4OEFA 5D62A 5D61A 1CVSA 3VT0A 1S0LA 4P6AA 2NVHA 4GP3A 1FWVA 3F62B 3WMVA 2FFVA 1DQOA 2FO1A 2NZ9A 3ZC8A 5JLVA 3V0AB 1FMMS 1FV3A 3N7KA 3CA6A 4XFSA 1ILR1 3CA3A 31BIA 1IHKA 1G9CA 3FFZA 3N7JA 2NM1A 3TC2A 4HA2A 2K43A 1M16A 2Q3NB 4D8HA 3RTJB 3KMVA 1ITBA 4EKXB 3VSFA 3NBCA 4QD2B 3IM5A 4LO7C 3RSJA 2KLLA 1HIBA 1PUUB 3JRRA 2MLLB 1HWMB 2DRZA 4ZGRB 3CRIA 2MIBA 5FNXA 1TIEA 4JKXB 1BA7A 1L2HA 2I1BA 3EF2A 4I4XA 4TLPA 1SR4C 1OQLB 3LLPA 2Y9XE 4QALA 3FJKA 1J0SA 2UUSA 2Y9GA 3UD9A 4IHZA 1XG6A 2D1ZA 2VSAA 4EFQA 3BAOA 5G00A 3PMEA 1R8OA 4P0JA 4OWJA 3VT2A 2Q9XA 4OWLA 3H6QA 1YBIA 4JQ0A 2D20A 1HWOB 1AFCA 1ISWA 1WBCA 3PG0A 1AVWB 2ZQNA 5BP5C 1G9AA 4ZBVB 3RTIB 4QD2C 4JKQA 4DENA 1Q03A 3NBNA 3ZX7A 4ENDA 2DRYA 3R4UA 3BAVA 41BIA 1ONKB 1JT3A 3IAGC 2NYYA 3C9ZA 3I29B 5BVPI 3WINA 2MC2A 3BA7A 3VEQA 1V6XA 7I1BA 3OBTA 5F90A 2HWAA 2LIQA 3B9UA 4ZFUB 3HN1A 1BLDA 3UJ0A 2ET2A 3BTAA 3ILAA 2HWMA 4IZXA 1Q04A 3PHZA 2HW9A 1Q1UA 4OEGA 4ZA3B 2KKIA 1TP0A 2GO2A 2WRYA 2X2TA 1AF9A 3CA5A 4I4YA 2VUAA 2KI4A 4I4SA 3FJCA 1S0CA 4H9WA 3CQAA 4I1BA 3AH4A 1FWUA 4XFUA 4HR6C 2DS0A 2Z48A 4LO0C 3CRGA 1RG8A 2ZQOA 1ISXA 4FVVA 2D24A 5BXRA 4A7YA 1PWAA 1JLXA 3FJIA 3SNVA 1IRPA 1JT7A 3WO2A 4PC4A 1XYFA 5D63A 4QC4A 4LO1A 2QYIB 3FJAA 4X3AA 3BA5A 1K5VA 4JP0A 1BFCA 1AVAC 1S0EA 1IJTA 3FJJA 1II4A 2WBCA 2VXTI 2Y9FA 4G6JA 4QKSA 3BAHA 3OJ2A 1BASA 3P6IA 3ZXGA 1S0GA 3WO4A 2L5XA 4I6IA 1ABRB 3HMYA 3VT1A 2P39A 2BEBA 3JUTA 3IM7A 4HJJA 1IRAX 3BB2A 4D0ZA 3P53A 3QR5A 1DQGA 2D22A 4ZFYB 3ZC9A 4OWKA 4I3NA 3V0BA 2XOAA 3O4AA 1M2TB 1YXWA 2D23A 1BARA 5BXPA 1QQKA 3BRGC 3CA1A 4IZEA 4IY9A 3A07A 1G9DA 2KI6B 3D7WB 4LO2C 5FZUA 3HOMA 3IM6A 1JTCA 1BLAA 3FJ9A 1T4QA 1UPSA 4GOVA 4I37A 4ZFWB 1HKNA 3WMUA 5GAQA 3FUOA 1PZZA 3AZVA 1AVUA 3R4SA 4GAIA 1HWNB 3FUQA 5BXSA 1TWEA 3OJMA 1BFFA 3H6RA 4KEIA 3ZXDA 4ISQA 1S0DA 1EPWA 3RMYA 3OJVA 4J23B 4OUJA 4JRAA 3FJDA 3MALA 5DSSB 1WD4A 4WBCA 3HBWA 3WA1A 1JY0A 6I1BA 2F2FC 1DZCA 2AXMA 1XHBA 3N7MA 4A7ZA 1DFCA 3O3QA 1NZKA 4L4HA 4G9MA 4AN6A 2E4MC 5BQUC 1DLLA 1PUMB 2RG9B 5BOWA 1G9BA 1I1EA 3BRDA 3I2XA 5E24E 1PC8B 4EFRA 4A7KA 1ISZA 3N0KA 1EYLA 1JQZA 3A21A 3VUOA 1SR4A 3IIRA 2ERMA 4I4VA 4I96A 4JPZA 3O4OA 5EC5A 1AXMA 5EHAA 4G1RA 4GP0A 1HCDA 3O4DA 2K8RA 4Q91A 5F8SA 3BRFA 3A22A 3HALA 4Q9PA 3F1RA 4I2SA 3E8LC 1D0HA 4X37A 1MD6A 3HSMA 3W9TA 3CA4A 3V0AA 1V6VA 2FDBM 3AKHA 4KEJA 2RQ9A 3O4BA 4GOYA 4EFPA 1WBAA 5DVHA 4F83A 1JT5A 2BFHA 1QXMA 1QQLA 4I4UA 4YOLA 5BP5A 8I1BA 4P0KA 4Z8SB 3RMXA 4LO3C 1JLYA 4IY8A 3BAQA 3FGMA 1TWMA 3I2AA 3BAGA 3O4CA 4KC3A 4X39A 4I4PA 2KH2A 4I1EA 1TOOA 1HCEA 9ILBA 1F31A 5BXTA 4OW4A 2AFGA 5DUYA 1DZDA 2D43A 4DEPA 4F34A 3Q7WA 4I4QA 4LO7B 1YF8B 2R9KB 4Z9WB 1R8NA 2DREA 2VLCA 4J2XA 3O44A 3UDAA 4J2YA 4R6UB 3FJ8A 3S8KA 1V6WA 1EV2A 3OGFA 1ISVA 4ISRA 2AQZA 3BADA 3FJBA 3AKGA 3QYDA 3O49A 1TFMB 5FNWA 1RMLA 1BFGA 1KNMA 2F8XC 4LO0A 2NP0A 1K5UA 3WO3A 1RY7A 3FJFA 3K1XA 2IWTB 3N7LA
chains in the Genus database with same CATH superfamily
1A8DA 1IILA 2D7IA 2QN4A 2BEAA 4D0TA 1FQ9A 3Q7XA 3Q7YA 1FV2A 1GGPB 4J2KA 1W3GA 1DJSB 1IT0A 2M49A 3FJEA 3BX1C 3NJ5A 3BAUA 4I8MA 5DZUA 1N4KA 4I4RA 1VCLA 3UJ4A 4DCKC 1YTOA 1S0BA 4ZLBB 2VU9A 1Z4SA 1IOBA 1E0OA 3CRHA 3BA4A 3FJHA 4KBBA 4USOA 3AJ5A 4G9NA 4UY4A 3H6SE 3S8JA 3CAHA 1DIWA 4G6MA 3UD8A 3CU1B 5EG6C 1MC9A 2D7RA 2YUGA 4LO2A 2ESUA 3VWCA 1G82A 4EEEB 4OEEA 4GAFA 4XFTA 3UD7A 3WINC 3CA0A 2AAIB 1W3AA 2J3PA 4QBCA 2VXRA 1FN0A 21BIA 3T8SA 2Y9WC 1ISYA 2LIEA 3AKFA 2RSTA 1WD3A 1YYNA 3AZWA 1FGAA 4IONA 4I7IA 1EVTA 3AKIA 4AN7B 4H04A 2X2SA 1FMZA 2F2FA 2ZR1B 1Z0HA 3A23A 4KEKA 2K4AB 1RZOB 4L4IA 3V0BB 2E4MA 5BQUA 1AVXB 3NBEA 4P0LA 4XKIA 1TTUA 4ZOTA 1BFBA 4Q9GA 3OGGA 1W3FA 4QBVA 1HWPB 5FZYA 2VSEA 4QO3A 4FGFA 4X38A 1DFQA 4QKRA 3LTQA 2D44A 2Z49A 4I0YA 4LO8B 4CJMA 4USPA 3PUBA 4LO1C 5HPZA 5I1BA 3VSZA 5JMCA 4II0A 3H6RB 1JT4A 2FFUA 1T9FA 1SZ6B 3POKA 5FZZA 3AH1A 1P63A 4J2SA 3P6JA 1XZZA 2IHOA 3AH2A 3NBDA 5B2HA 2FGFA 1CE7B 1NUNA 1V6UA 2NS2A 4MZGB 4IYBA 3V79C 4LO3A 5F8WA 1S0FA 4IQPA 1Z2VA 2GZBA 2NTDA 4EB2B 5F8YA 3MPPG 4I4OA 3OBRA 2HZ9A 2P23A 4ZKTB 3AJ6A 4JAWA 3O5WB 1I1BA 4OEFA 5D62A 5D61A 1CVSA 3VT0A 1S0LA 4P6AA 2NVHA 4GP3A 1FWVA 3F62B 3WMVA 2FFVA 1DQOA 2FO1A 2NZ9A 3ZC8A 5JLVA 3V0AB 1FMMS 1FV3A 3N7KA 3CA6A 4XFSA 1ILR1 3CA3A 31BIA 1IHKA 1G9CA 3FFZA 3N7JA 2NM1A 3TC2A 4HA2A 2K43A 1M16A 2Q3NB 4D8HA 3RTJB 3KMVA 1ITBA 4EKXB 3VSFA 3NBCA 4QD2B 3IM5A 4LO7C 3RSJA 2KLLA 1HIBA 1PUUB 3JRRA 2MLLB 1HWMB 2DRZA 4ZGRB 3CRIA 2MIBA 5FNXA 1TIEA 4JKXB 1BA7A 1L2HA 2I1BA 3EF2A 4I4XA 4TLPA 1SR4C 1OQLB 3LLPA 2Y9XE 4QALA 3FJKA 1J0SA 2UUSA 2Y9GA 3UD9A 4IHZA 1XG6A 2D1ZA 2VSAA 4EFQA 3BAOA 5G00A 3PMEA 1R8OA 4P0JA 4OWJA 3VT2A 2Q9XA 4OWLA 3H6QA 1YBIA 4JQ0A 2D20A 1HWOB 1AFCA 1ISWA 1WBCA 3PG0A 1AVWB 2ZQNA 5BP5C 1G9AA 4ZBVB 3RTIB 4H75A 4QD2C 4JKQA 4DENA 1Q03A 3NBNA 3ZX7A 4ENDA 2DRYA 3R4UA 3BAVA 41BIA 1ONKB 1JT3A 3IAGC 2NYYA 3C9ZA 3I29B 5BVPI 3WINA 2MC2A 3BA7A 3VEQA 1V6XA 7I1BA 3OBTA 5F90A 2HWAA 2LIQA 3B9UA 4ZFUB 3HN1A 1BLDA 3UJ0A 2ET2A 3BTAA 3ILAA 2HWMA 4IZXA 1Q04A 3PHZA 2HW9A 1Q1UA 4OEGA 4ZA3B 2KKIA 1TP0A 2GO2A 2WRYA 2X2TA 1AF9A 3CA5A 4I4YA 2VUAA 2KI4A 4I4SA 3FJCA 1S0CA 4H9WA 3CQAA 4I1BA 3AH4A 1FWUA 4XFUA 4HR6C 2DS0A 2Z48A 4LO0C 3CRGA 1RG8A 2ZQOA 1ISXA 4FVVA 2D24A 5BXRA 4A7YA 1PWAA 1JLXA 3FJIA 3SNVA 1IRPA 1JT7A 3WO2A 4PC4A 1XYFA 5D63A 4QC4A 4LO1A 2QYIB 3FJAA 4X3AA 3BA5A 1K5VA 4JP0A 1BFCA 1AVAC 1S0EA 1IJTA 3FJJA 1II4A 2WBCA 2VXTI 2Y9FA 4G6JA 4QKSA 3BAHA 3OJ2A 1BASA 3P6IA 3ZXGA 1S0GA 3WO4A 2L5XA 4I6IA 1ABRB 3HMYA 3VT1A 2P39A 2BEBA 3JUTA 3IM7A 4HJJA 1IRAX 3BB2A 4D0ZA 3P53A 3QR5A 1DQGA 2D22A 4ZFYB 3ZC9A 4OWKA 4I3NA 3V0BA 2XOAA 3O4AA 1M2TB 1YXWA 2D23A 1BARA 5BXPA 1QQKA 3BRGC 3CA1A 4IZEA 4IY9A 3A07A 1G9DA 2KI6B 3D7WB 4LO2C 5FZUA 3HOMA 3IM6A 1JTCA 1BLAA 3FJ9A 1T4QA 1UPSA 4GOVA 4I37A 4ZFWB 1HKNA 3WMUA 5GAQA 3FUOA 1PZZA 3AZVA 1AVUA 3R4SA 4GAIA 1HWNB 3FUQA 5BXSA 1TWEA 3OJMA 1BFFA 3H6RA 4KEIA 3ZXDA 4ISQA 1S0DA 1EPWA 3RMYA 3OJVA 4J23B 4OUJA 4JRAA 3FJDA 3MALA 5DSSB 1WD4A 4WBCA 3HBWA 3WA1A 1JY0A 6I1BA 4MZFB 2F2FC 1DZCA 2AXMA 1XHBA 3N7MA 4A7ZA 1DFCA 3O3QA 1NZKA 4L4HA 4G9MA 4AN6A 2E4MC 5BQUC 1DLLA 1PUMB 2RG9B 5BOWA 1G9BA 1I1EA 3BRDA 3I2XA 5E24E 1PC8B 4EFRA 4A7KA 1ISZA 3N0KA 1EYLA 1JQZA 3A21A 3VUOA 1SR4A 3IIRA 2ERMA 4I4VA 4I96A 4JPZA 3O4OA 5EC5A 1AXMA 5EHAA 4G1RA 4GP0A 1HCDA 3O4DA 2K8RA 4Q91A 5F8SA 3BRFA 3A22A 3HALA 4Q9PA 3F1RA 4I2SA 3E8LC 1D0HA 4X37A 1MD6A 3HSMA 3W9TA 3CA4A 3V0AA 1V6VA 2FDBM 3AKHA 4KEJA 2RQ9A 3O4BA 4GOYA 4EFPA 1WBAA 5DVHA 4F83A 1JT5A 2BFHA 1QXMA 1QQLA 4I4UA 4YOLA 5BP5A 8I1BA 4P0KA 4Z8SB 3RMXA 4LO3C 1JLYA 4IY8A 3BAQA 3FGMA 1TWMA 3I2AA 3BAGA 3O4CA 4KC3A 4X39A 4I4PA 2KH2A 4I1EA 1TOOA 1HCEA 9ILBA 1F31A 5BXTA 4OW4A 2AFGA 5DUYA 1DZDA 2D43A 4MZHA 4DEPA 4F34A 3Q7WA 4I4QA 4LO7B 1YF8B 2R9KB 4Z9WB 1R8NA 2DREA 2VLCA 4J2XA 3O44A 3UDAA 4J2YA 4R6UB 3FJ8A 3S8KA 1V6WA 1EV2A 3OGFA 1ISVA 4ISRA 2AQZA 3BADA 3FJBA 3AKGA 3QYDA 3O49A 1TFMB 5FNWA 1RMLA 1BFGA 1KNMA 2F8XC 4LO0A 2NP0A 1K5UA 3WO3A 1RY7A 3FJFA 3K1XA 2IWTB 3N7LA
chains in the Genus database with same CATH topology
1A8DA 1IILA 2D7IA 2QN4A 2BEAA 4D0TA 1FQ9A 3Q7XA 3Q7YA 1FV2A 1GGPB 4J2KA 1W3GA 1DJSB 1IT0A 2M49A 3FJEA 3BX1C 3NJ5A 3BAUA 4I8MA 5DZUA 1N4KA 4I4RA 1VCLA 3UJ4A 4DCKC 1YTOA 1S0BA 4ZLBB 2VU9A 1Z4SA 1IOBA 1E0OA 3CRHA 3BA4A 3FJHA 4KBBA 4USOA 3AJ5A 4G9NA 4UY4A 3H6SE 3S8JA 3CAHA 1DIWA 4G6MA 3UD8A 3CU1B 5EG6C 1MC9A 2D7RA 2YUGA 4LO2A 2ESUA 3VWCA 1G82A 4EEEB 4OEEA 4GAFA 4XFTA 3UD7A 3WINC 3CA0A 2AAIB 1W3AA 2J3PA 4QBCA 2VXRA 1FN0A 21BIA 3T8SA 2Y9WC 1ISYA 2LIEA 3AKFA 2RSTA 1WD3A 1YYNA 3AZWA 1FGAA 4IONA 4I7IA 1EVTA 3AKIA 4AN7B 4H04A 2X2SA 1FMZA 2F2FA 2ZR1B 1Z0HA 3A23A 4KEKA 2K4AB 1RZOB 4L4IA 3V0BB 2E4MA 5BQUA 1AVXB 3NBEA 4P0LA 4XKIA 1TTUA 4ZOTA 1BFBA 4Q9GA 3OGGA 1W3FA 4QBVA 1HWPB 5FZYA 2VSEA 4QO3A 4FGFA 4X38A 1DFQA 4QKRA 3LTQA 2D44A 2Z49A 4I0YA 4LO8B 4CJMA 4USPA 3PUBA 4LO1C 5HPZA 5I1BA 3VSZA 5JMCA 4II0A 3H6RB 1JT4A 2FFUA 1T9FA 1SZ6B 3POKA 5FZZA 3AH1A 1P63A 4J2SA 3P6JA 1XZZA 2IHOA 3AH2A 3NBDA 5B2HA 2FGFA 1CE7B 1NUNA 1V6UA 2NS2A 4MZGB 4IYBA 3V79C 4LO3A 5F8WA 1S0FA 4IQPA 1Z2VA 2GZBA 2NTDA 4EB2B 5F8YA 3MPPG 4I4OA 3OBRA 2HZ9A 2P23A 4ZKTB 3AJ6A 4JAWA 3O5WB 1I1BA 4OEFA 5D62A 5D61A 1CVSA 3VT0A 1S0LA 4P6AA 2NVHA 4GP3A 1FWVA 3F62B 3WMVA 2FFVA 1DQOA 2FO1A 2NZ9A 3ZC8A 5JLVA 3V0AB 1FMMS 1FV3A 3N7KA 3CA6A 4XFSA 1ILR1 3CA3A 31BIA 1IHKA 1G9CA 3FFZA 3N7JA 2NM1A 3TC2A 4HA2A 2K43A 1M16A 2Q3NB 4D8HA 3RTJB 3KMVA 1ITBA 4EKXB 3VSFA 3NBCA 4QD2B 3IM5A 4LO7C 3RSJA 2KLLA 1HIBA 1PUUB 3JRRA 2MLLB 1HWMB 2DRZA 4ZGRB 3CRIA 2MIBA 5FNXA 1TIEA 4JKXB 1BA7A 1L2HA 2I1BA 3EF2A 4I4XA 4TLPA 1SR4C 1OQLB 3LLPA 2Y9XE 4QALA 3FJKA 1J0SA 2UUSA 2Y9GA 3UD9A 4IHZA 1XG6A 2D1ZA 2VSAA 4EFQA 3BAOA 5G00A 3PMEA 1R8OA 4P0JA 4OWJA 3VT2A 2Q9XA 4OWLA 3H6QA 1YBIA 4JQ0A 2D20A 1HWOB 1AFCA 1ISWA 1WBCA 3PG0A 1AVWB 2ZQNA 5BP5C 1G9AA 4ZBVB 3RTIB 4H75A 4QD2C 4JKQA 4DENA 1Q03A 3NBNA 3ZX7A 4ENDA 2DRYA 3R4UA 3BAVA 41BIA 1ONKB 1JT3A 3IAGC 2NYYA 3C9ZA 3I29B 5BVPI 3WINA 2MC2A 3BA7A 3VEQA 1V6XA 7I1BA 3OBTA 5F90A 2HWAA 2LIQA 3B9UA 4ZFUB 3HN1A 1BLDA 3UJ0A 2ET2A 3BTAA 3ILAA 2HWMA 4IZXA 1Q04A 3PHZA 2HW9A 1Q1UA 4OEGA 4ZA3B 2KKIA 1TP0A 2GO2A 2WRYA 2X2TA 1AF9A 3CA5A 4I4YA 2VUAA 2KI4A 4I4SA 3FJCA 1S0CA 4H9WA 3CQAA 4I1BA 3AH4A 1FWUA 4XFUA 4HR6C 2DS0A 2Z48A 4LO0C 3CRGA 1RG8A 2ZQOA 1ISXA 4FVVA 2D24A 5BXRA 4A7YA 1PWAA 1JLXA 3FJIA 3SNVA 1IRPA 1JT7A 3WO2A 4PC4A 1XYFA 5D63A 4QC4A 4LO1A 2QYIB 3FJAA 4X3AA 3BA5A 1K5VA 4JP0A 1BFCA 1AVAC 1S0EA 1IJTA 3FJJA 1II4A 2WBCA 2VXTI 2Y9FA 4G6JA 4QKSA 3BAHA 3OJ2A 1BASA 3P6IA 3ZXGA 1S0GA 3WO4A 2L5XA 4I6IA 1ABRB 3HMYA 3VT1A 2P39A 2BEBA 3JUTA 3IM7A 4HJJA 1IRAX 3BB2A 4D0ZA 3P53A 3QR5A 1DQGA 2D22A 4ZFYB 3ZC9A 4OWKA 4I3NA 3V0BA 2XOAA 3O4AA 1M2TB 1YXWA 2D23A 1BARA 5BXPA 1QQKA 3BRGC 3CA1A 4IZEA 4IY9A 3A07A 1G9DA 2KI6B 3D7WB 4LO2C 5FZUA 3HOMA 3IM6A 1JTCA 1BLAA 3FJ9A 1T4QA 1UPSA 4GOVA 4I37A 4ZFWB 1HKNA 3WMUA 5GAQA 3FUOA 1PZZA 3AZVA 1AVUA 3R4SA 4GAIA 1HWNB 3FUQA 5BXSA 1TWEA 3OJMA 1BFFA 3H6RA 4KEIA 3ZXDA 4ISQA 1S0DA 1EPWA 3RMYA 3OJVA 4J23B 4OUJA 4JRAA 3FJDA 3MALA 5DSSB 1WD4A 4WBCA 3HBWA 3WA1A 1JY0A 6I1BA 4MZFB 2F2FC 1DZCA 2AXMA 1XHBA 3N7MA 4A7ZA 1DFCA 3O3QA 1NZKA 4L4HA 4G9MA 4AN6A 2E4MC 5BQUC 1DLLA 1PUMB 2RG9B 5BOWA 1G9BA 1I1EA 3BRDA 3I2XA 5E24E 1PC8B 4EFRA 4A7KA 1ISZA 3N0KA 1EYLA 1JQZA 3A21A 3VUOA 1SR4A 3IIRA 2ERMA 4I4VA 4I96A 4JPZA 3O4OA 5EC5A 1AXMA 5EHAA 4G1RA 4GP0A 1HCDA 3O4DA 2K8RA 4Q91A 5F8SA 3BRFA 3A22A 3HALA 4Q9PA 3F1RA 4I2SA 3E8LC 1D0HA 4X37A 1MD6A 3HSMA 3W9TA 3CA4A 3V0AA 1V6VA 2FDBM 3AKHA 4KEJA 2RQ9A 3O4BA 4GOYA 4EFPA 1WBAA 5DVHA 4F83A 1JT5A 2BFHA 1QXMA 1QQLA 4I4UA 4YOLA 5BP5A 8I1BA 4P0KA 4Z8SB 3RMXA 4LO3C 1JLYA 4IY8A 3BAQA 3FGMA 1TWMA 3I2AA 3BAGA 3O4CA 4KC3A 4X39A 4I4PA 2KH2A 4I1EA 1TOOA 1HCEA 9ILBA 1F31A 5BXTA 4OW4A 2AFGA 5DUYA 1DZDA 2D43A 4MZHA 4DEPA 4F34A 3Q7WA 4I4QA 4LO7B 1YF8B 2R9KB 4Z9WB 1R8NA 2DREA 2VLCA 4J2XA 3O44A 3UDAA 4J2YA 4R6UB 3FJ8A 3S8KA 1V6WA 1EV2A 3OGFA 1ISVA 4ISRA 2AQZA 3BADA 3FJBA 3AKGA 3QYDA 3O49A 1TFMB 5FNWA 1RMLA 1BFGA 1KNMA 2F8XC 4LO0A 2NP0A 1K5UA 3WO3A 1RY7A 3FJFA 3K1XA 2IWTB 3N7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8D A;  1IIL A;  2D7I A;  2QN4 A;  2BEA A;  4D0T A;  1FQ9 A;  3Q7X A;  3Q7Y A;  1FV2 A;  1GGP B;  4J2K A;  1W3G A;  1DJS B;  1IT0 A;  2M49 A;  3FJE A;  3BX1 C;  3NJ5 A;  3BAU A;  4I8M A;  5DZU A;  1N4K A;  4I4R A;  1VCL A;  3UJ4 A;  4DCK C;  1YTO A;  1S0B A;  4ZLB B;  2VU9 A;  1Z4S A;  1IOB A;  1E0O A;  3CRH A;  3BA4 A;  3FJH A;  4KBB A;  4USO A;  3AJ5 A;  4G9N A;  3H6S E;  3S8J A;  3CAH A;  1DIW A;  4G6M A;  3UD8 A;  3CU1 B;  5EG6 C;  1MC9 A;  2D7R A;  2YUG A;  4LO2 A;  2ESU A;  3VWC A;  1G82 A;  4EEE B;  4OEE A;  4GAF A;  4XFT A;  3UD7 A;  3WIN C;  3CA0 A;  2AAI B;  1W3A A;  2J3P A;  4QBC A;  2VXR A;  1FN0 A;  21BI A;  3T8S A;  2Y9W C;  1ISY A;  2LIE A;  3AKF A;  2RST A;  1WD3 A;  1YYN A;  3AZW A;  1FGA A;  4ION A;  4I7I A;  1EVT A;  3AKI A;  4AN7 B;  4H04 A;  2X2S A;  1FMZ A;  2F2F A;  2ZR1 B;  1Z0H A;  3A23 A;  4KEK A;  2K4A B;  1RZO B;  4L4I A;  3V0B B;  2E4M A;  5BQU A;  1AVX B;  3NBE A;  4P0L A;  4XKI A;  1TTU A;  4ZOT A;  1BFB A;  4Q9G A;  3OGG A;  1W3F A;  4QBV A;  1HWP B;  5FZY A;  2VSE A;  4QO3 A;  4FGF A;  4X38 A;  1DFQ A;  4QKR A;  3LTQ A;  2D44 A;  2Z49 A;  4I0Y A;  4LO8 B;  4CJM A;  4USP A;  3PUB A;  4LO1 C;  5HPZ A;  5I1B A;  3VSZ A;  5JMC A;  4II0 A;  3H6R B;  1JT4 A;  2FFU A;  1T9F A;  1SZ6 B;  3POK A;  5FZZ A;  3AH1 A;  1P63 A;  4J2S A;  3P6J A;  1XZZ A;  2IHO A;  3AH2 A;  3NBD A;  5B2H A;  2FGF A;  1CE7 B;  1NUN A;  1V6U A;  4IYB A;  3V79 C;  4LO3 A;  5F8W A;  1S0F A;  4IQP A;  1Z2V A;  2GZB A;  2NTD A;  4EB2 B;  5F8Y A;  3MPP G;  4I4O A;  3OBR A;  2HZ9 A;  2P23 A;  4ZKT B;  3AJ6 A;  4JAW A;  3O5W B;  1I1B A;  4OEF A;  5D62 A;  5D61 A;  1CVS A;  3VT0 A;  1S0L A;  4P6A A;  2NVH A;  4GP3 A;  1FWV A;  3F62 B;  3WMV A;  2FFV A;  1DQO A;  2FO1 A;  2NZ9 A;  3ZC8 A;  5JLV A;  3V0A B;  1FMM S;  1FV3 A;  3N7K A;  3CA6 A;  4XFS A;  1ILR 1;  3CA3 A;  31BI A;  1IHK A;  1G9C A;  3FFZ A;  3N7J A;  2NM1 A;  3TC2 A;  4HA2 A;  2K43 A;  1M16 A;  2Q3N B;  4D8H A;  3RTJ B;  3KMV A;  1ITB A;  4EKX B;  3VSF A;  3NBC A;  4QD2 B;  3IM5 A;  4LO7 C;  3RSJ A;  2KLL A;  1HIB A;  1PUU B;  3JRR A;  2MLL B;  1HWM B;  2DRZ A;  4ZGR B;  3CRI A;  2MIB A;  5FNX A;  1TIE A;  4JKX B;  1BA7 A;  1L2H A;  2I1B A;  3EF2 A;  4I4X A;  4TLP A;  1SR4 C;  1OQL B;  3LLP A;  2Y9X E;  4QAL A;  3FJK A;  1J0S A;  2UUS A;  2Y9G A;  3UD9 A;  4IHZ A;  1XG6 A;  2D1Z A;  2VSA A;  4EFQ A;  3BAO A;  5G00 A;  3PME A;  1R8O A;  4P0J A;  4OWJ A;  3VT2 A;  2Q9X A;  4OWL A;  3H6Q A;  1YBI A;  4JQ0 A;  2D20 A;  1HWO B;  1AFC A;  1ISW A;  1WBC A;  3PG0 A;  1AVW B;  2ZQN A;  5BP5 C;  1G9A A;  4ZBV B;  3RTI B;  4QD2 C;  4JKQ A;  4DEN A;  1Q03 A;  3NBN A;  3ZX7 A;  4END A;  2DRY A;  3R4U A;  3BAV A;  41BI A;  1ONK B;  1JT3 A;  3IAG C;  2NYY A;  3C9Z A;  3I29 B;  5BVP I;  3WIN A;  2MC2 A;  3BA7 A;  3VEQ A;  1V6X A;  7I1B A;  3OBT A;  5F90 A;  2HWA A;  2LIQ A;  3B9U A;  4ZFU B;  3HN1 A;  1BLD A;  3UJ0 A;  2ET2 A;  3BTA A;  3ILA A;  2HWM A;  4IZX A;  1Q04 A;  3PHZ A;  2HW9 A;  1Q1U A;  4OEG A;  4ZA3 B;  2KKI A;  1TP0 A;  2GO2 A;  2WRY A;  2X2T A;  1AF9 A;  3CA5 A;  4I4Y A;  2VUA A;  2KI4 A;  4I4S A;  3FJC A;  1S0C A;  4H9W A;  3CQA A;  4I1B A;  3AH4 A;  1FWU A;  4XFU A;  4HR6 C;  2DS0 A;  2Z48 A;  4LO0 C;  3CRG A;  1RG8 A;  2ZQO A;  1ISX A;  4FVV A;  2D24 A;  5BXR A;  4A7Y A;  1PWA A;  1JLX A;  3FJI A;  3SNV A;  1IRP A;  1JT7 A;  3WO2 A;  4PC4 A;  1XYF A;  5D63 A;  4QC4 A;  4LO1 A;  2QYI B;  3FJA A;  4X3A A;  3BA5 A;  1K5V A;  4JP0 A;  1BFC A;  1AVA C;  1S0E A;  1IJT A;  3FJJ A;  1II4 A;  2WBC A;  2VXT I;  2Y9F A;  4G6J A;  4QKS A;  3BAH A;  3OJ2 A;  1BAS A;  3P6I A;  3ZXG A;  1S0G A;  3WO4 A;  2L5X A;  4I6I A;  1ABR B;  3HMY A;  3VT1 A;  2P39 A;  2BEB A;  3JUT A;  3IM7 A;  4HJJ A;  1IRA X;  3BB2 A;  4D0Z A;  3P53 A;  3QR5 A;  1DQG A;  2D22 A;  4ZFY B;  3ZC9 A;  4OWK A;  4I3N A;  3V0B A;  2XOA A;  3O4A A;  1M2T B;  1YXW A;  2D23 A;  1BAR A;  5BXP A;  1QQK A;  3BRG C;  3CA1 A;  4IZE A;  4IY9 A;  3A07 A;  1G9D A;  2KI6 B;  3D7W B;  4LO2 C;  5FZU A;  3HOM A;  3IM6 A;  1JTC A;  1BLA A;  3FJ9 A;  1T4Q A;  1UPS A;  4GOV A;  4I37 A;  4ZFW B;  1HKN A;  3WMU A;  5GAQ A;  3FUO A;  1PZZ A;  3AZV A;  1AVU A;  3R4S A;  4GAI A;  1HWN B;  3FUQ A;  5BXS A;  1TWE A;  3OJM A;  1BFF A;  3H6R A;  4KEI A;  3ZXD A;  4ISQ A;  1S0D A;  1EPW A;  3RMY A;  3OJV A;  4J23 B;  4OUJ A;  4JRA A;  3FJD A;  3MAL A;  5DSS B;  1WD4 A;  4WBC A;  3HBW A;  3WA1 A;  1JY0 A;  6I1B A;  2F2F C;  1DZC A;  2AXM A;  1XHB A;  3N7M A;  4A7Z A;  1DFC A;  3O3Q A;  1NZK A;  4L4H A;  4G9M A;  4AN6 A;  2E4M C;  5BQU C;  1DLL A;  1PUM B;  2RG9 B;  5BOW A;  1G9B A;  1I1E A;  3BRD A;  3I2X A;  5E24 E;  1PC8 B;  4EFR A;  4A7K A;  1ISZ A;  3N0K A;  1EYL A;  1JQZ A;  3A21 A;  3VUO A;  1SR4 A;  3IIR A;  2ERM A;  4I4V A;  4I96 A;  4JPZ A;  3O4O A;  5EC5 A;  1AXM A;  5EHA A;  4G1R A;  4GP0 A;  1HCD A;  3O4D A;  2K8R A;  4Q91 A;  5F8S A;  3BRF A;  3A22 A;  3HAL A;  4Q9P A;  3F1R A;  4I2S A;  3E8L C;  1D0H A;  4X37 A;  1MD6 A;  3HSM A;  3W9T A;  3CA4 A;  3V0A A;  1V6V A;  2FDB M;  3AKH A;  4KEJ A;  2RQ9 A;  3O4B A;  4GOY A;  4EFP A;  1WBA A;  5DVH A;  4F83 A;  1JT5 A;  2BFH A;  1QXM A;  1QQL A;  4I4U A;  4YOL A;  5BP5 A;  8I1B A;  4P0K A;  4Z8S B;  3RMX A;  4LO3 C;  1JLY A;  4IY8 A;  3BAQ A;  3FGM A;  1TWM A;  3I2A A;  3BAG A;  3O4C A;  4KC3 A;  4X39 A;  4I4P A;  2KH2 A;  4I1E A;  1TOO A;  1HCE A;  9ILB A;  1F31 A;  5BXT A;  4OW4 A;  2AFG A;  5DUY A;  1DZD A;  2D43 A;  4DEP A;  4F34 A;  3Q7W A;  4I4Q A;  4LO7 B;  1YF8 B;  2R9K B;  4Z9W B;  1R8N A;  2DRE A;  2VLC A;  4J2X A;  3O44 A;  3UDA A;  4J2Y A;  4R6U B;  3FJ8 A;  3S8K A;  1V6W A;  1EV2 A;  3OGF A;  1ISV A;  4ISR A;  2AQZ A;  3BAD A;  3FJB A;  3AKG A;  3QYD A;  3O49 A;  1TFM B;  5FNW A;  1RML A;  1BFG A;  1KNM A;  2F8X C;  4LO0 A;  2NP0 A;  1K5U A;  3WO3 A;  1RY7 A;  3FJF A;  3K1X A;  2IWT B;  3N7L A; 
#chains in the Genus database with same CATH topology
 1A8D A;  1IIL A;  2D7I A;  2QN4 A;  2BEA A;  4D0T A;  1FQ9 A;  3Q7X A;  3Q7Y A;  1FV2 A;  1GGP B;  4J2K A;  1W3G A;  1DJS B;  1IT0 A;  2M49 A;  3FJE A;  3BX1 C;  3NJ5 A;  3BAU A;  4I8M A;  5DZU A;  1N4K A;  4I4R A;  1VCL A;  3UJ4 A;  4DCK C;  1YTO A;  1S0B A;  4ZLB B;  2VU9 A;  1Z4S A;  1IOB A;  1E0O A;  3CRH A;  3BA4 A;  3FJH A;  4KBB A;  4USO A;  3AJ5 A;  4G9N A;  4UY4 A;  3H6S E;  3S8J A;  3CAH A;  1DIW A;  4G6M A;  3UD8 A;  3CU1 B;  5EG6 C;  1MC9 A;  2D7R A;  2YUG A;  4LO2 A;  2ESU A;  3VWC A;  1G82 A;  4EEE B;  4OEE A;  4GAF A;  4XFT A;  3UD7 A;  3WIN C;  3CA0 A;  2AAI B;  1W3A A;  2J3P A;  4QBC A;  2VXR A;  1FN0 A;  21BI A;  3T8S A;  2Y9W C;  1ISY A;  2LIE A;  3AKF A;  2RST A;  1WD3 A;  1YYN A;  3AZW A;  1FGA A;  4ION A;  4I7I A;  1EVT A;  3AKI A;  4AN7 B;  4H04 A;  2X2S A;  1FMZ A;  2F2F A;  2ZR1 B;  1Z0H A;  3A23 A;  4KEK A;  2K4A B;  1RZO B;  4L4I A;  3V0B B;  2E4M A;  5BQU A;  1AVX B;  3NBE A;  4P0L A;  4XKI A;  1TTU A;  4ZOT A;  1BFB A;  4Q9G A;  3OGG A;  1W3F A;  4QBV A;  1HWP B;  5FZY A;  2VSE A;  4QO3 A;  4FGF A;  4X38 A;  1DFQ A;  4QKR A;  3LTQ A;  2D44 A;  2Z49 A;  4I0Y A;  4LO8 B;  4CJM A;  4USP A;  3PUB A;  4LO1 C;  5HPZ A;  5I1B A;  3VSZ A;  5JMC A;  4II0 A;  3H6R B;  1JT4 A;  2FFU A;  1T9F A;  1SZ6 B;  3POK A;  5FZZ A;  3AH1 A;  1P63 A;  4J2S A;  3P6J A;  1XZZ A;  2IHO A;  3AH2 A;  3NBD A;  5B2H A;  2FGF A;  1CE7 B;  1NUN A;  1V6U A;  2NS2 A;  4MZG B;  4IYB A;  3V79 C;  4LO3 A;  5F8W A;  1S0F A;  4IQP A;  1Z2V A;  2GZB A;  2NTD A;  4EB2 B;  5F8Y A;  3MPP G;  4I4O A;  3OBR A;  2HZ9 A;  2P23 A;  4ZKT B;  3AJ6 A;  4JAW A;  3O5W B;  1I1B A;  4OEF A;  5D62 A;  5D61 A;  1CVS A;  3VT0 A;  1S0L A;  4P6A A;  2NVH A;  4GP3 A;  1FWV A;  3F62 B;  3WMV A;  2FFV A;  1DQO A;  2FO1 A;  2NZ9 A;  3ZC8 A;  5JLV A;  3V0A B;  1FMM S;  1FV3 A;  3N7K A;  3CA6 A;  4XFS A;  1ILR 1;  3CA3 A;  31BI A;  1IHK A;  1G9C A;  3FFZ A;  3N7J A;  2NM1 A;  3TC2 A;  4HA2 A;  2K43 A;  1M16 A;  2Q3N B;  4D8H A;  3RTJ B;  3KMV A;  1ITB A;  4EKX B;  3VSF A;  3NBC A;  4QD2 B;  3IM5 A;  4LO7 C;  3RSJ A;  2KLL A;  1HIB A;  1PUU B;  3JRR A;  2MLL B;  1HWM B;  2DRZ A;  4ZGR B;  3CRI A;  2MIB A;  5FNX A;  1TIE A;  4JKX B;  1BA7 A;  1L2H A;  2I1B A;  3EF2 A;  4I4X A;  4TLP A;  1SR4 C;  1OQL B;  3LLP A;  2Y9X E;  4QAL A;  3FJK A;  1J0S A;  2UUS A;  2Y9G A;  3UD9 A;  4IHZ A;  1XG6 A;  2D1Z A;  2VSA A;  4EFQ A;  3BAO A;  5G00 A;  3PME A;  1R8O A;  4P0J A;  4OWJ A;  3VT2 A;  2Q9X A;  4OWL A;  3H6Q A;  1YBI A;  4JQ0 A;  2D20 A;  1HWO B;  1AFC A;  1ISW A;  1WBC A;  3PG0 A;  1AVW B;  2ZQN A;  5BP5 C;  1G9A A;  4ZBV B;  3RTI B;  4H75 A;  4QD2 C;  4JKQ A;  4DEN A;  1Q03 A;  3NBN A;  3ZX7 A;  4END A;  2DRY A;  3R4U A;  3BAV A;  41BI A;  1ONK B;  1JT3 A;  3IAG C;  2NYY A;  3C9Z A;  3I29 B;  5BVP I;  3WIN A;  2MC2 A;  3BA7 A;  3VEQ A;  1V6X A;  7I1B A;  3OBT A;  5F90 A;  2HWA A;  2LIQ A;  3B9U A;  4ZFU B;  3HN1 A;  1BLD A;  3UJ0 A;  2ET2 A;  3BTA A;  3ILA A;  2HWM A;  4IZX A;  1Q04 A;  3PHZ A;  2HW9 A;  1Q1U A;  4OEG A;  4ZA3 B;  2KKI A;  1TP0 A;  2GO2 A;  2WRY A;  2X2T A;  1AF9 A;  3CA5 A;  4I4Y A;  2VUA A;  2KI4 A;  4I4S A;  3FJC A;  1S0C A;  4H9W A;  3CQA A;  4I1B A;  3AH4 A;  1FWU A;  4XFU A;  4HR6 C;  2DS0 A;  2Z48 A;  4LO0 C;  3CRG A;  1RG8 A;  2ZQO A;  1ISX A;  4FVV A;  2D24 A;  5BXR A;  4A7Y A;  1PWA A;  1JLX A;  3FJI A;  3SNV A;  1IRP A;  1JT7 A;  3WO2 A;  4PC4 A;  1XYF A;  5D63 A;  4QC4 A;  4LO1 A;  2QYI B;  3FJA A;  4X3A A;  3BA5 A;  1K5V A;  4JP0 A;  1BFC A;  1AVA C;  1S0E A;  1IJT A;  3FJJ A;  1II4 A;  2WBC A;  2VXT I;  2Y9F A;  4G6J A;  4QKS A;  3BAH A;  3OJ2 A;  1BAS A;  3P6I A;  3ZXG A;  1S0G A;  3WO4 A;  2L5X A;  4I6I A;  1ABR B;  3HMY A;  3VT1 A;  2P39 A;  2BEB A;  3JUT A;  3IM7 A;  4HJJ A;  1IRA X;  3BB2 A;  4D0Z A;  3P53 A;  3QR5 A;  1DQG A;  2D22 A;  4ZFY B;  3ZC9 A;  4OWK A;  4I3N A;  3V0B A;  2XOA A;  3O4A A;  1M2T B;  1YXW A;  2D23 A;  1BAR A;  5BXP A;  1QQK A;  3BRG C;  3CA1 A;  4IZE A;  4IY9 A;  3A07 A;  1G9D A;  2KI6 B;  3D7W B;  4LO2 C;  5FZU A;  3HOM A;  3IM6 A;  1JTC A;  1BLA A;  3FJ9 A;  1T4Q A;  1UPS A;  4GOV A;  4I37 A;  4ZFW B;  1HKN A;  3WMU A;  5GAQ A;  3FUO A;  1PZZ A;  3AZV A;  1AVU A;  3R4S A;  4GAI A;  1HWN B;  3FUQ A;  5BXS A;  1TWE A;  3OJM A;  1BFF A;  3H6R A;  4KEI A;  3ZXD A;  4ISQ A;  1S0D A;  1EPW A;  3RMY A;  3OJV A;  4J23 B;  4OUJ A;  4JRA A;  3FJD A;  3MAL A;  5DSS B;  1WD4 A;  4WBC A;  3HBW A;  3WA1 A;  1JY0 A;  6I1B A;  4MZF B;  2F2F C;  1DZC A;  2AXM A;  1XHB A;  3N7M A;  4A7Z A;  1DFC A;  3O3Q A;  1NZK A;  4L4H A;  4G9M A;  4AN6 A;  2E4M C;  5BQU C;  1DLL A;  1PUM B;  2RG9 B;  5BOW A;  1G9B A;  1I1E A;  3BRD A;  3I2X A;  5E24 E;  1PC8 B;  4EFR A;  4A7K A;  1ISZ A;  3N0K A;  1EYL A;  1JQZ A;  3A21 A;  3VUO A;  1SR4 A;  3IIR A;  2ERM A;  4I4V A;  4I96 A;  4JPZ A;  3O4O A;  5EC5 A;  1AXM A;  5EHA A;  4G1R A;  4GP0 A;  1HCD A;  3O4D A;  2K8R A;  4Q91 A;  5F8S A;  3BRF A;  3A22 A;  3HAL A;  4Q9P A;  3F1R A;  4I2S A;  3E8L C;  1D0H A;  4X37 A;  1MD6 A;  3HSM A;  3W9T A;  3CA4 A;  3V0A A;  1V6V A;  2FDB M;  3AKH A;  4KEJ A;  2RQ9 A;  3O4B A;  4GOY A;  4EFP A;  1WBA A;  5DVH A;  4F83 A;  1JT5 A;  2BFH A;  1QXM A;  1QQL A;  4I4U A;  4YOL A;  5BP5 A;  8I1B A;  4P0K A;  4Z8S B;  3RMX A;  4LO3 C;  1JLY A;  4IY8 A;  3BAQ A;  3FGM A;  1TWM A;  3I2A A;  3BAG A;  3O4C A;  4KC3 A;  4X39 A;  4I4P A;  2KH2 A;  4I1E A;  1TOO A;  1HCE A;  9ILB A;  1F31 A;  5BXT A;  4OW4 A;  2AFG A;  5DUY A;  1DZD A;  2D43 A;  4MZH A;  4DEP A;  4F34 A;  3Q7W A;  4I4Q A;  4LO7 B;  1YF8 B;  2R9K B;  4Z9W B;  1R8N A;  2DRE A;  2VLC A;  4J2X A;  3O44 A;  3UDA A;  4J2Y A;  4R6U B;  3FJ8 A;  3S8K A;  1V6W A;  1EV2 A;  3OGF A;  1ISV A;  4ISR A;  2AQZ A;  3BAD A;  3FJB A;  3AKG A;  3QYD A;  3O49 A;  1TFM B;  5FNW A;  1RML A;  1BFG A;  1KNM A;  2F8X C;  4LO0 A;  2NP0 A;  1K5U A;  3WO3 A;  1RY7 A;  3FJF A;  3K1X A;  2IWT B;  3N7L A; 
#chains in the Genus database with same CATH homology
 1A8D A;  1IIL A;  2D7I A;  2QN4 A;  2BEA A;  4D0T A;  1FQ9 A;  3Q7X A;  3Q7Y A;  1FV2 A;  1GGP B;  4J2K A;  1W3G A;  1DJS B;  1IT0 A;  2M49 A;  3FJE A;  3BX1 C;  3NJ5 A;  3BAU A;  4I8M A;  5DZU A;  1N4K A;  4I4R A;  1VCL A;  3UJ4 A;  4DCK C;  1YTO A;  1S0B A;  4ZLB B;  2VU9 A;  1Z4S A;  1IOB A;  1E0O A;  3CRH A;  3BA4 A;  3FJH A;  4KBB A;  4USO A;  3AJ5 A;  4G9N A;  4UY4 A;  3H6S E;  3S8J A;  3CAH A;  1DIW A;  4G6M A;  3UD8 A;  3CU1 B;  5EG6 C;  1MC9 A;  2D7R A;  2YUG A;  4LO2 A;  2ESU A;  3VWC A;  1G82 A;  4EEE B;  4OEE A;  4GAF A;  4XFT A;  3UD7 A;  3WIN C;  3CA0 A;  2AAI B;  1W3A A;  2J3P A;  4QBC A;  2VXR A;  1FN0 A;  21BI A;  3T8S A;  2Y9W C;  1ISY A;  2LIE A;  3AKF A;  2RST A;  1WD3 A;  1YYN A;  3AZW A;  1FGA A;  4ION A;  4I7I A;  1EVT A;  3AKI A;  4AN7 B;  4H04 A;  2X2S A;  1FMZ A;  2F2F A;  2ZR1 B;  1Z0H A;  3A23 A;  4KEK A;  2K4A B;  1RZO B;  4L4I A;  3V0B B;  2E4M A;  5BQU A;  1AVX B;  3NBE A;  4P0L A;  4XKI A;  1TTU A;  4ZOT A;  1BFB A;  4Q9G A;  3OGG A;  1W3F A;  4QBV A;  1HWP B;  5FZY A;  2VSE A;  4QO3 A;  4FGF A;  4X38 A;  1DFQ A;  4QKR A;  3LTQ A;  2D44 A;  2Z49 A;  4I0Y A;  4LO8 B;  4CJM A;  4USP A;  3PUB A;  4LO1 C;  5HPZ A;  5I1B A;  3VSZ A;  5JMC A;  4II0 A;  3H6R B;  1JT4 A;  2FFU A;  1T9F A;  1SZ6 B;  3POK A;  5FZZ A;  3AH1 A;  1P63 A;  4J2S A;  3P6J A;  1XZZ A;  2IHO A;  3AH2 A;  3NBD A;  5B2H A;  2FGF A;  1CE7 B;  1NUN A;  1V6U A;  2NS2 A;  4MZG B;  4IYB A;  3V79 C;  4LO3 A;  5F8W A;  1S0F A;  4IQP A;  1Z2V A;  2GZB A;  2NTD A;  4EB2 B;  5F8Y A;  3MPP G;  4I4O A;  3OBR A;  2HZ9 A;  2P23 A;  4ZKT B;  3AJ6 A;  4JAW A;  3O5W B;  1I1B A;  4OEF A;  5D62 A;  5D61 A;  1CVS A;  3VT0 A;  1S0L A;  4P6A A;  2NVH A;  4GP3 A;  1FWV A;  3F62 B;  3WMV A;  2FFV A;  1DQO A;  2FO1 A;  2NZ9 A;  3ZC8 A;  5JLV A;  3V0A B;  1FMM S;  1FV3 A;  3N7K A;  3CA6 A;  4XFS A;  1ILR 1;  3CA3 A;  31BI A;  1IHK A;  1G9C A;  3FFZ A;  3N7J A;  2NM1 A;  3TC2 A;  4HA2 A;  2K43 A;  1M16 A;  2Q3N B;  4D8H A;  3RTJ B;  3KMV A;  1ITB A;  4EKX B;  3VSF A;  3NBC A;  4QD2 B;  3IM5 A;  4LO7 C;  3RSJ A;  2KLL A;  1HIB A;  1PUU B;  3JRR A;  2MLL B;  1HWM B;  2DRZ A;  4ZGR B;  3CRI A;  2MIB A;  5FNX A;  1TIE A;  4JKX B;  1BA7 A;  1L2H A;  2I1B A;  3EF2 A;  4I4X A;  4TLP A;  1SR4 C;  1OQL B;  3LLP A;  2Y9X E;  4QAL A;  3FJK A;  1J0S A;  2UUS A;  2Y9G A;  3UD9 A;  4IHZ A;  1XG6 A;  2D1Z A;  2VSA A;  4EFQ A;  3BAO A;  5G00 A;  3PME A;  1R8O A;  4P0J A;  4OWJ A;  3VT2 A;  2Q9X A;  4OWL A;  3H6Q A;  1YBI A;  4JQ0 A;  2D20 A;  1HWO B;  1AFC A;  1ISW A;  1WBC A;  3PG0 A;  1AVW B;  2ZQN A;  5BP5 C;  1G9A A;  4ZBV B;  3RTI B;  4H75 A;  4QD2 C;  4JKQ A;  4DEN A;  1Q03 A;  3NBN A;  3ZX7 A;  4END A;  2DRY A;  3R4U A;  3BAV A;  41BI A;  1ONK B;  1JT3 A;  3IAG C;  2NYY A;  3C9Z A;  3I29 B;  5BVP I;  3WIN A;  2MC2 A;  3BA7 A;  3VEQ A;  1V6X A;  7I1B A;  3OBT A;  5F90 A;  2HWA A;  2LIQ A;  3B9U A;  4ZFU B;  3HN1 A;  1BLD A;  3UJ0 A;  2ET2 A;  3BTA A;  3ILA A;  2HWM A;  4IZX A;  1Q04 A;  3PHZ A;  2HW9 A;  1Q1U A;  4OEG A;  4ZA3 B;  2KKI A;  1TP0 A;  2GO2 A;  2WRY A;  2X2T A;  1AF9 A;  3CA5 A;  4I4Y A;  2VUA A;  2KI4 A;  4I4S A;  3FJC A;  1S0C A;  4H9W A;  3CQA A;  4I1B A;  3AH4 A;  1FWU A;  4XFU A;  4HR6 C;  2DS0 A;  2Z48 A;  4LO0 C;  3CRG A;  1RG8 A;  2ZQO A;  1ISX A;  4FVV A;  2D24 A;  5BXR A;  4A7Y A;  1PWA A;  1JLX A;  3FJI A;  3SNV A;  1IRP A;  1JT7 A;  3WO2 A;  4PC4 A;  1XYF A;  5D63 A;  4QC4 A;  4LO1 A;  2QYI B;  3FJA A;  4X3A A;  3BA5 A;  1K5V A;  4JP0 A;  1BFC A;  1AVA C;  1S0E A;  1IJT A;  3FJJ A;  1II4 A;  2WBC A;  2VXT I;  2Y9F A;  4G6J A;  4QKS A;  3BAH A;  3OJ2 A;  1BAS A;  3P6I A;  3ZXG A;  1S0G A;  3WO4 A;  2L5X A;  4I6I A;  1ABR B;  3HMY A;  3VT1 A;  2P39 A;  2BEB A;  3JUT A;  3IM7 A;  4HJJ A;  1IRA X;  3BB2 A;  4D0Z A;  3P53 A;  3QR5 A;  1DQG A;  2D22 A;  4ZFY B;  3ZC9 A;  4OWK A;  4I3N A;  3V0B A;  2XOA A;  3O4A A;  1M2T B;  1YXW A;  2D23 A;  1BAR A;  5BXP A;  1QQK A;  3BRG C;  3CA1 A;  4IZE A;  4IY9 A;  3A07 A;  1G9D A;  2KI6 B;  3D7W B;  4LO2 C;  5FZU A;  3HOM A;  3IM6 A;  1JTC A;  1BLA A;  3FJ9 A;  1T4Q A;  1UPS A;  4GOV A;  4I37 A;  4ZFW B;  1HKN A;  3WMU A;  5GAQ A;  3FUO A;  1PZZ A;  3AZV A;  1AVU A;  3R4S A;  4GAI A;  1HWN B;  3FUQ A;  5BXS A;  1TWE A;  3OJM A;  1BFF A;  3H6R A;  4KEI A;  3ZXD A;  4ISQ A;  1S0D A;  1EPW A;  3RMY A;  3OJV A;  4J23 B;  4OUJ A;  4JRA A;  3FJD A;  3MAL A;  5DSS B;  1WD4 A;  4WBC A;  3HBW A;  3WA1 A;  1JY0 A;  6I1B A;  4MZF B;  2F2F C;  1DZC A;  2AXM A;  1XHB A;  3N7M A;  4A7Z A;  1DFC A;  3O3Q A;  1NZK A;  4L4H A;  4G9M A;  4AN6 A;  2E4M C;  5BQU C;  1DLL A;  1PUM B;  2RG9 B;  5BOW A;  1G9B A;  1I1E A;  3BRD A;  3I2X A;  5E24 E;  1PC8 B;  4EFR A;  4A7K A;  1ISZ A;  3N0K A;  1EYL A;  1JQZ A;  3A21 A;  3VUO A;  1SR4 A;  3IIR A;  2ERM A;  4I4V A;  4I96 A;  4JPZ A;  3O4O A;  5EC5 A;  1AXM A;  5EHA A;  4G1R A;  4GP0 A;  1HCD A;  3O4D A;  2K8R A;  4Q91 A;  5F8S A;  3BRF A;  3A22 A;  3HAL A;  4Q9P A;  3F1R A;  4I2S A;  3E8L C;  1D0H A;  4X37 A;  1MD6 A;  3HSM A;  3W9T A;  3CA4 A;  3V0A A;  1V6V A;  2FDB M;  3AKH A;  4KEJ A;  2RQ9 A;  3O4B A;  4GOY A;  4EFP A;  1WBA A;  5DVH A;  4F83 A;  1JT5 A;  2BFH A;  1QXM A;  1QQL A;  4I4U A;  4YOL A;  5BP5 A;  8I1B A;  4P0K A;  4Z8S B;  3RMX A;  4LO3 C;  1JLY A;  4IY8 A;  3BAQ A;  3FGM A;  1TWM A;  3I2A A;  3BAG A;  3O4C A;  4KC3 A;  4X39 A;  4I4P A;  2KH2 A;  4I1E A;  1TOO A;  1HCE A;  9ILB A;  1F31 A;  5BXT A;  4OW4 A;  2AFG A;  5DUY A;  1DZD A;  2D43 A;  4MZH A;  4DEP A;  4F34 A;  3Q7W A;  4I4Q A;  4LO7 B;  1YF8 B;  2R9K B;  4Z9W B;  1R8N A;  2DRE A;  2VLC A;  4J2X A;  3O44 A;  3UDA A;  4J2Y A;  4R6U B;  3FJ8 A;  3S8K A;  1V6W A;  1EV2 A;  3OGF A;  1ISV A;  4ISR A;  2AQZ A;  3BAD A;  3FJB A;  3AKG A;  3QYD A;  3O49 A;  1TFM B;  5FNW A;  1RML A;  1BFG A;  1KNM A;  2F8X C;  4LO0 A;  2NP0 A;  1K5U A;  3WO3 A;  1RY7 A;  3FJF A;  3K1X A;  2IWT B;  3N7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...