4I4VA

Bel beta-trefoil complex with n-acetylgalactosamine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
146
structure length
146
Chain Sequence
VNFPNIPAEGVQFRLRARDTGYVIYSRTENPPLVWQYNGPPYDDQLFTLIYGTGPRKNLYAIKSVPNGRVLFSRTSASPYVGNIAGDGTYNDNWFQFIQDDNDPNSFRIYNLASDTVLYSRTTADPKFGNFTGAKYDDQLWHFELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BEL {beta}-trefoil: A novel lectin with antineoplastic properties in king bolete (Boletus edulis) mushrooms.
pubmed doi rcsb
molecule keywords BEL beta-trefoil
molecule tags Sugar binding protein
total genus 39
structure length 146
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4i4vA00
2X2TA 5JLVA 4X37A 4KEKA 4LO7B 4USPA 1QQLA 1FV2A 1PC8B 4AN6A 3FJKA 2WBCA 3CAHA 4TLPA 1GGPB 4ISQA 2J3PA 3JRRA 3NBEA 4G6JA 31BIA 2MIBA 3AJ6A 3FJIA 2ZQOA 4QO3A 1E0OA 1HWOB 4IONA 1ITBA 1XHBA 1WD4A 3HSMA 3VT1A 1QXMA 4G1RA 2IHOA 3CQAA 1S0EA 3CRIA 4OUJA 3OBTA 1M16A 3BRGC 2IWTB 3BTAA 3WINA 3WMVA 3V0BA 3KMVA 2ZR1B 3CRHA 4I37A 3CA1A 3O3QA 1V6UA 1YF8B 3ZXDA 4I4OA 3FFZA 4ZOTA 2Y9GA 3I2AA 1K5UA 1W3GA 2VU9A 1DFQA 4LO2C 2FGFA 3R4SA 1PUUB 2I1BA 3BAGA 7I1BA 9ILBA 3O4OA 3VT0A 1SR4A 3CRGA 1Z0HA 3N7KA 2D22A 3UDAA 2AQZA 2UUSA 3O4CA 3ZC8A 4XFTA 4EB2B 4Q9PA 3PUBA 5BP5C 1DQOA 1MD6A 2VXTI 5DVHA 3SNVA 1P63A 2M49A 3V79C 1JTCA 3VEQA 4ZLBB 1G9AA 1S0CA 3OJVA 3E8LC 2HWMA 3AKGA 1IJTA 3BAOA 4LO8B 4IHZA 3WO4A 1BARA 3BA5A 1WBCA 2WRYA 3AZVA 3R4UA 1BA7A 2K4AB 1TIEA 3UD9A 3V0AB 3S8JA 3UJ4A 1QQKA 4IYBA 1SZ6B 3P53A 3BAHA 1FWUA 4ZA3B 1TFMB 1Z2VA 4JAWA 3N7MA 4D0ZA 1HWPB 2F2FA 3LTQA 4ZBVB 1BLDA 6I1BA 4IQPA 4I4XA 4OWLA 3CA5A 1R8OA 4LO3A 4HR6C 4LO0A 5F8YA 4KC3A 4CJMA 4X3AA 3MPPG 1AVXB 4I6IA 3FJDA 1SR4C 3IM5A 3S8KA 1RY7A 4Q91A 1IT0A 4J2SA 1ABRB 1RG8A 4JQ0A 3WA1A 1A8DA 1J0SA 4L4HA 4QC4A 1RMLA 3AKHA 2R9KB 3BRFA 41BIA 2E4MC 1T4QA 2K43A 2VSEA 4GAFA 1FMMS 4GOYA 1IOBA 1V6XA 1AVWB 3B9UA 1HWMB 4I4PA 2RSTA 4F83A 3POKA 3O4BA 1DLLA 1EVTA 3N7JA 1AF9A 3A23A 1FMZA 2GO2A 3FJJA 3NBDA 3AH1A 4HJJA 4USOA 1RZOB 4A7KA 2QYIB 1UPSA 4QBVA 2Y9FA 3CA0A 1CE7B 2F8XC 2MLLB 5BQUC 4EFRA 3H6SE 4IY9A 3NBCA 3IM6A 3C9ZA 4J2KA 2FFVA 2HW9A 3OGFA 5BVPI 4Z9WB 4I7IA 2Y9WC 5F8SA 4HA2A 4LO3C 2KI4A 4LO0C 2LIQA 1S0FA 1Q03A 1YXWA 2D44A 3ZC9A 1KNMA 1TP0A 4LO1C 1NUNA 3OBRA 4D0TA 1HWNB 3O44A 2KH2A 1ISYA 3A22A 1K5VA 3BA4A 3HN1A 5D62A 4ZFWB 3IIRA 2K8RA 1TTUA 2RQ9A 3BA7A 4JKQA 4GP0A 5DZUA 5DSSB 5DUYA 2HZ9A 2QN4A 4OW4A 1TOOA 2RG9B 3ILAA 3Q7YA 4DCKC 2Y9XE 3MALA 3QR5A 4ENDA 1JY0A 4QALA 3V0BB 4I4QA 5BXTA 1DIWA 4X38A 5BXSA 4EFPA 3I29B 2L5XA 1AVAC 1JLYA 3H6RA 1D0HA 2P23A 2Z48A 4P0KA 5F90A 1G82A 4QD2B 4OWKA 2DRZA 4Q9GA 3CU1B 3O5WB 3ZX7A 3HBWA 5EC5A 4GP3A 2BFHA 2D23A 3A21A 3FUOA 1BFFA 3FJEA 3N0KA 2DS0A 4I4SA 4XFUA 2NP0A 3WINC 2HWAA 4KEJA 1BLAA 4WBCA 1L2HA 1BASA 1DZCA 1AVUA 1TWMA 3I2XA 3O4AA 2KI6B 4JP0A 4Z8SB 1I1BA 5BXPA 1FWVA 1V6WA 4J2XA 3F1RA 4ZGRB 4IZXA 3FJ9A 4AN7B 4QD2C 5BXRA 3JUTA 4OEGA 4I1EA 4I96A 4ZFUB 3UD8A 1PWAA 1BFCA 4F34A 3P6JA 2MC2A 3D7WB 1DFCA 5FNWA 1MC9A 3HOMA 3W9TA 4EKXB 5GAQA 2VUAA 2XOAA 3AKIA 4I1BA 1FQ9A 1OQLB 3O49A 4P6AA 1IRAX 1TWEA 3AKFA 4GAIA 4IZEA 2NZ9A 4JRAA 4OEFA 4I4YA 3FJCA 2AFGA 1HCEA 4R6UB 1EV2A 1JT5A 2NTDA 3VWCA 1BFGA 4KEIA 4JKXB 3EF2A 5B2HA 4LO2A 1HIBA 3WMUA 3HMYA 2NVHA 4G9NA 4P0JA 1Q1UA 3K1XA 5D61A 3VUOA 1W3AA 2ESUA 2D24A 1FV3A 3VSFA 2ERMA 1F31A 5F8WA 3OJMA 1ISZA 1G9DA 2D1ZA 3P6IA 2FFUA 3AJ5A 3BRDA 5BP5A 2F2FC 4J2YA 4ISRA 2VXRA 3FJHA 2D7RA 2Q9XA 4ZKTB 2Z49A 1S0LA 3A07A 5HPZA 1DZDA 4YOLA 4FVVA 5D63A 4I0YA 4XFSA 1DQGA 1EPWA 5EG6C 3FJAA 4I8MA 3CA3A 5FNXA 2D7IA 1YBIA 4D8HA 3AH4A 1JT7A 1JLXA 1NZKA 3BX1C 3RTIB 3AH2A 4LO7C 2FO1A 4A7ZA 3RTJB 3F62B 2D20A 3WO3A 4H9WA 4QKRA 4IY8A 3IAGC 4I3NA 4J23B 1M2TB 3UJ0A 2DRYA 2ZQNA 4QKSA 3HALA 3BB2A 5FZUA 2YUGA 5I1BA 1ISVA 3BAQA 1WD3A 1ISWA 4I4VA 2D43A 5BOWA 3IM7A 3OGGA 5G00A 1HCDA 4I4UA 1DJSB 3WO2A 3ZXGA 1XG6A 1S0DA 2NM1A 3VSZA 3VT2A 1PZZA 4II0A 2DREA 3RSJA 3V0AA 1ISXA 2FDBM 1S0BA 1FN0A 4A7YA 2Q3NB 3CA6A 5FZZA 4DEPA 1CVSA 5E24E 1XYFA 1PUMB 1ILR1 2KKIA 3N7LA 3Q7XA 3PHZA 4PC4A 4GOVA 1I1EA 4I2SA 3TC2A 3Q7WA 4G6MA 2E4MA 2VLCA 4I4RA 2LIEA 3PG0A 1T9FA 3FGMA 3CA4A 2AXMA 1XZZA 1WBAA 3H6RB 1HKNA 3RMYA 8I1BA 3RMXA 4G9MA 2VSAA 4JPZA 1FGAA 3NJ5A 3H6QA 4FGFA 3FJBA 1BFBA 3LLPA 21BIA 1AFCA 1JT3A 1YYNA 3FJ8A 3NBNA 4QBCA 3BAVA 1II4A 2KLLA 3AZWA 3T8SA 1G9BA 4L4IA 4OEEA 5BQUA 2X2SA 2P39A 4EFQA 1IILA 2BEBA 2GZBA 2NYYA 4ZFYB 4EEEB 4OWJA 2BEAA 1Q04A 2ET2A 3PMEA 4P0LA 5FZYA 1S0GA 1AXMA 3QYDA 1W3FA 1G9CA 1JQZA 3BAUA 4H04A 1R8NA 4X39A 4KBBA 4XKIA 4LO1A 1EYLA 3O4DA 2AAIB 1VCLA 1JT4A 1YTOA 1Z4SA 1V6VA 3UD7A 3FJFA 1IRPA 3OJ2A 3BADA 1N4KA 5EHAA 1IHKA 4DENA 5JMCA 1ONKB 3FUQA
chains in the Genus database with same CATH superfamily
2X2TA 5JLVA 4X37A 4KEKA 4LO7B 4USPA 1QQLA 1FV2A 1PC8B 4AN6A 3FJKA 2WBCA 3CAHA 4TLPA 1GGPB 4ISQA 2J3PA 3JRRA 3NBEA 4MZFB 4G6JA 31BIA 2MIBA 3AJ6A 3FJIA 2ZQOA 4QO3A 1E0OA 1HWOB 4IONA 1ITBA 1XHBA 1WD4A 3HSMA 3VT1A 1QXMA 4G1RA 2IHOA 3CQAA 1S0EA 3CRIA 4OUJA 3OBTA 1M16A 3BRGC 2IWTB 3BTAA 3WINA 3WMVA 3V0BA 3KMVA 2ZR1B 3CRHA 4I37A 3CA1A 3O3QA 1V6UA 1YF8B 3ZXDA 4I4OA 3FFZA 4H75A 4ZOTA 2Y9GA 3I2AA 1K5UA 1W3GA 2VU9A 1DFQA 4LO2C 2FGFA 3R4SA 1PUUB 2I1BA 3BAGA 7I1BA 9ILBA 3O4OA 3VT0A 1SR4A 3CRGA 1Z0HA 3N7KA 2D22A 3UDAA 2AQZA 2UUSA 3O4CA 3ZC8A 4XFTA 4EB2B 4Q9PA 3PUBA 5BP5C 1DQOA 1MD6A 2VXTI 5DVHA 3SNVA 1P63A 2M49A 3V79C 1JTCA 3VEQA 4ZLBB 1G9AA 1S0CA 3OJVA 3E8LC 2HWMA 3AKGA 1IJTA 3BAOA 4LO8B 4IHZA 3WO4A 1BARA 3BA5A 1WBCA 2WRYA 3AZVA 3R4UA 1BA7A 2K4AB 4UY4A 1TIEA 3UD9A 3V0AB 3S8JA 3UJ4A 1QQKA 4IYBA 1SZ6B 3P53A 3BAHA 1FWUA 4ZA3B 1TFMB 1Z2VA 4JAWA 3N7MA 4D0ZA 1HWPB 2F2FA 3LTQA 4ZBVB 1BLDA 6I1BA 4IQPA 4I4XA 4OWLA 3CA5A 1R8OA 4LO3A 4HR6C 4LO0A 5F8YA 4KC3A 4CJMA 4X3AA 3MPPG 1AVXB 4I6IA 3FJDA 1SR4C 3IM5A 3S8KA 1RY7A 4Q91A 1IT0A 4J2SA 1ABRB 1RG8A 4JQ0A 3WA1A 1A8DA 1J0SA 4L4HA 4QC4A 1RMLA 3AKHA 2R9KB 3BRFA 41BIA 2E4MC 1T4QA 2K43A 2VSEA 4GAFA 1FMMS 4GOYA 1IOBA 1V6XA 1AVWB 3B9UA 1HWMB 4I4PA 2RSTA 4F83A 3POKA 3O4BA 1DLLA 1EVTA 3N7JA 1AF9A 3A23A 1FMZA 2GO2A 3FJJA 3NBDA 3AH1A 4HJJA 4USOA 1RZOB 4A7KA 2QYIB 1UPSA 4QBVA 4MZGB 2Y9FA 3CA0A 1CE7B 2F8XC 2MLLB 5BQUC 4EFRA 3H6SE 4IY9A 3NBCA 3IM6A 3C9ZA 4J2KA 2FFVA 2HW9A 3OGFA 5BVPI 4Z9WB 4I7IA 2Y9WC 5F8SA 4HA2A 4LO3C 2KI4A 4LO0C 2LIQA 1S0FA 1Q03A 1YXWA 2D44A 3ZC9A 1KNMA 1TP0A 4LO1C 1NUNA 3OBRA 4D0TA 1HWNB 3O44A 2KH2A 1ISYA 3A22A 1K5VA 3BA4A 3HN1A 5D62A 4ZFWB 3IIRA 2K8RA 1TTUA 2RQ9A 3BA7A 4JKQA 4GP0A 5DZUA 5DSSB 5DUYA 2HZ9A 2QN4A 4OW4A 1TOOA 2RG9B 3ILAA 3Q7YA 4DCKC 2Y9XE 3MALA 3QR5A 4ENDA 2NS2A 1JY0A 4QALA 3V0BB 4I4QA 5BXTA 1DIWA 4X38A 5BXSA 4EFPA 3I29B 2L5XA 1AVAC 1JLYA 3H6RA 1D0HA 2P23A 2Z48A 4P0KA 5F90A 1G82A 4QD2B 4OWKA 2DRZA 4Q9GA 3CU1B 3O5WB 3ZX7A 3HBWA 5EC5A 4GP3A 2BFHA 2D23A 3A21A 3FUOA 1BFFA 3FJEA 3N0KA 2DS0A 4I4SA 4XFUA 2NP0A 3WINC 2HWAA 4KEJA 1BLAA 4WBCA 1L2HA 1BASA 1DZCA 1AVUA 1TWMA 3I2XA 3O4AA 2KI6B 4JP0A 4Z8SB 1I1BA 5BXPA 1FWVA 1V6WA 4J2XA 3F1RA 4ZGRB 4IZXA 3FJ9A 4AN7B 4QD2C 5BXRA 3JUTA 4OEGA 4I1EA 4I96A 4ZFUB 3UD8A 1PWAA 1BFCA 4F34A 3P6JA 2MC2A 3D7WB 1DFCA 5FNWA 1MC9A 3HOMA 3W9TA 4EKXB 5GAQA 2VUAA 2XOAA 3AKIA 4I1BA 1FQ9A 1OQLB 3O49A 4P6AA 1IRAX 1TWEA 3AKFA 4GAIA 4IZEA 2NZ9A 4JRAA 4OEFA 4I4YA 3FJCA 2AFGA 1HCEA 4R6UB 1EV2A 1JT5A 2NTDA 3VWCA 1BFGA 4KEIA 4JKXB 3EF2A 5B2HA 4LO2A 1HIBA 3WMUA 3HMYA 2NVHA 4G9NA 4P0JA 1Q1UA 3K1XA 5D61A 3VUOA 1W3AA 2ESUA 2D24A 1FV3A 3VSFA 2ERMA 1F31A 5F8WA 3OJMA 1ISZA 1G9DA 2D1ZA 3P6IA 2FFUA 3AJ5A 3BRDA 5BP5A 2F2FC 4J2YA 4ISRA 2VXRA 3FJHA 2D7RA 2Q9XA 4ZKTB 2Z49A 1S0LA 3A07A 5HPZA 1DZDA 4YOLA 4FVVA 5D63A 4I0YA 4XFSA 1DQGA 1EPWA 5EG6C 3FJAA 4I8MA 3CA3A 5FNXA 2D7IA 1YBIA 4D8HA 3AH4A 1JT7A 1JLXA 1NZKA 3BX1C 3RTIB 3AH2A 4LO7C 2FO1A 4A7ZA 3RTJB 3F62B 2D20A 3WO3A 4H9WA 4QKRA 4IY8A 3IAGC 4I3NA 4J23B 1M2TB 3UJ0A 2DRYA 2ZQNA 4QKSA 3HALA 3BB2A 5FZUA 2YUGA 5I1BA 1ISVA 3BAQA 1WD3A 1ISWA 4I4VA 2D43A 5BOWA 3IM7A 3OGGA 5G00A 1HCDA 4I4UA 1DJSB 3WO2A 3ZXGA 1XG6A 1S0DA 2NM1A 3VSZA 3VT2A 1PZZA 4II0A 2DREA 3RSJA 3V0AA 1ISXA 2FDBM 1S0BA 4MZHA 1FN0A 4A7YA 2Q3NB 3CA6A 5FZZA 4DEPA 1CVSA 5E24E 1XYFA 1PUMB 1ILR1 2KKIA 3N7LA 3Q7XA 3PHZA 4PC4A 4GOVA 1I1EA 4I2SA 3TC2A 3Q7WA 4G6MA 2E4MA 2VLCA 4I4RA 2LIEA 3PG0A 1T9FA 3FGMA 3CA4A 2AXMA 1XZZA 1WBAA 3H6RB 1HKNA 3RMYA 8I1BA 3RMXA 4G9MA 2VSAA 4JPZA 1FGAA 3NJ5A 3H6QA 4FGFA 3FJBA 1BFBA 3LLPA 21BIA 1AFCA 1JT3A 1YYNA 3FJ8A 3NBNA 4QBCA 3BAVA 1II4A 2KLLA 3AZWA 3T8SA 1G9BA 4L4IA 4OEEA 5BQUA 2X2SA 2P39A 4EFQA 1IILA 2BEBA 2GZBA 2NYYA 4ZFYB 4EEEB 4OWJA 2BEAA 1Q04A 2ET2A 3PMEA 4P0LA 5FZYA 1S0GA 1AXMA 3QYDA 1W3FA 1G9CA 1JQZA 3BAUA 4H04A 1R8NA 4X39A 4KBBA 4XKIA 4LO1A 1EYLA 3O4DA 2AAIB 1VCLA 1JT4A 1YTOA 1Z4SA 1V6VA 3UD7A 3FJFA 1IRPA 3OJ2A 3BADA 1N4KA 5EHAA 1IHKA 4DENA 5JMCA 1ONKB 3FUQA
chains in the Genus database with same CATH topology
2X2TA 5JLVA 4X37A 4KEKA 4LO7B 4USPA 1QQLA 1FV2A 1PC8B 4AN6A 3FJKA 2WBCA 3CAHA 4TLPA 1GGPB 4ISQA 2J3PA 3JRRA 3NBEA 4MZFB 4G6JA 31BIA 2MIBA 3AJ6A 3FJIA 2ZQOA 4QO3A 1E0OA 1HWOB 4IONA 1ITBA 1XHBA 1WD4A 3HSMA 3VT1A 1QXMA 4G1RA 2IHOA 3CQAA 1S0EA 3CRIA 4OUJA 3OBTA 1M16A 3BRGC 2IWTB 3BTAA 3WINA 3WMVA 3V0BA 3KMVA 2ZR1B 3CRHA 4I37A 3CA1A 3O3QA 1V6UA 1YF8B 3ZXDA 4I4OA 3FFZA 4H75A 4ZOTA 2Y9GA 3I2AA 1K5UA 1W3GA 2VU9A 1DFQA 4LO2C 2FGFA 3R4SA 1PUUB 2I1BA 3BAGA 7I1BA 9ILBA 3O4OA 3VT0A 1SR4A 3CRGA 1Z0HA 3N7KA 2D22A 3UDAA 2AQZA 2UUSA 3O4CA 3ZC8A 4XFTA 4EB2B 4Q9PA 3PUBA 5BP5C 1DQOA 1MD6A 2VXTI 5DVHA 3SNVA 1P63A 2M49A 3V79C 1JTCA 3VEQA 4ZLBB 1G9AA 1S0CA 3OJVA 3E8LC 2HWMA 3AKGA 1IJTA 3BAOA 4LO8B 4IHZA 3WO4A 1BARA 3BA5A 1WBCA 2WRYA 3AZVA 3R4UA 1BA7A 2K4AB 4UY4A 1TIEA 3UD9A 3V0AB 3S8JA 3UJ4A 1QQKA 4IYBA 1SZ6B 3P53A 3BAHA 1FWUA 4ZA3B 1TFMB 1Z2VA 4JAWA 3N7MA 4D0ZA 1HWPB 2F2FA 3LTQA 4ZBVB 1BLDA 6I1BA 4IQPA 4I4XA 4OWLA 3CA5A 1R8OA 4LO3A 4HR6C 4LO0A 5F8YA 4KC3A 4CJMA 4X3AA 3MPPG 1AVXB 4I6IA 3FJDA 1SR4C 3IM5A 3S8KA 1RY7A 4Q91A 1IT0A 4J2SA 1ABRB 1RG8A 4JQ0A 3WA1A 1A8DA 1J0SA 4L4HA 4QC4A 1RMLA 3AKHA 2R9KB 3BRFA 41BIA 2E4MC 1T4QA 2K43A 2VSEA 4GAFA 1FMMS 4GOYA 1IOBA 1V6XA 1AVWB 3B9UA 1HWMB 4I4PA 2RSTA 4F83A 3POKA 3O4BA 1DLLA 1EVTA 3N7JA 1AF9A 3A23A 1FMZA 2GO2A 3FJJA 3NBDA 3AH1A 4HJJA 4USOA 1RZOB 4A7KA 2QYIB 1UPSA 4QBVA 4MZGB 2Y9FA 3CA0A 1CE7B 2F8XC 2MLLB 5BQUC 4EFRA 3H6SE 4IY9A 3NBCA 3IM6A 3C9ZA 4J2KA 2FFVA 2HW9A 3OGFA 5BVPI 4Z9WB 4I7IA 2Y9WC 5F8SA 4HA2A 4LO3C 2KI4A 4LO0C 2LIQA 1S0FA 1Q03A 1YXWA 2D44A 3ZC9A 1KNMA 1TP0A 4LO1C 1NUNA 3OBRA 4D0TA 1HWNB 3O44A 2KH2A 1ISYA 3A22A 1K5VA 3BA4A 3HN1A 5D62A 4ZFWB 3IIRA 2K8RA 1TTUA 2RQ9A 3BA7A 4JKQA 4GP0A 5DZUA 5DSSB 5DUYA 2HZ9A 2QN4A 4OW4A 1TOOA 2RG9B 3ILAA 3Q7YA 4DCKC 2Y9XE 3MALA 3QR5A 4ENDA 2NS2A 1JY0A 4QALA 3V0BB 4I4QA 5BXTA 1DIWA 4X38A 5BXSA 4EFPA 3I29B 2L5XA 1AVAC 1JLYA 3H6RA 1D0HA 2P23A 2Z48A 4P0KA 5F90A 1G82A 4QD2B 4OWKA 2DRZA 4Q9GA 3CU1B 3O5WB 3ZX7A 3HBWA 5EC5A 4GP3A 2BFHA 2D23A 3A21A 3FUOA 1BFFA 3FJEA 3N0KA 2DS0A 4I4SA 4XFUA 2NP0A 3WINC 2HWAA 4KEJA 1BLAA 4WBCA 1L2HA 1BASA 1DZCA 1AVUA 1TWMA 3I2XA 3O4AA 2KI6B 4JP0A 4Z8SB 1I1BA 5BXPA 1FWVA 1V6WA 4J2XA 3F1RA 4ZGRB 4IZXA 3FJ9A 4AN7B 4QD2C 5BXRA 3JUTA 4OEGA 4I1EA 4I96A 4ZFUB 3UD8A 1PWAA 1BFCA 4F34A 3P6JA 2MC2A 3D7WB 1DFCA 5FNWA 1MC9A 3HOMA 3W9TA 4EKXB 5GAQA 2VUAA 2XOAA 3AKIA 4I1BA 1FQ9A 1OQLB 3O49A 4P6AA 1IRAX 1TWEA 3AKFA 4GAIA 4IZEA 2NZ9A 4JRAA 4OEFA 4I4YA 3FJCA 2AFGA 1HCEA 4R6UB 1EV2A 1JT5A 2NTDA 3VWCA 1BFGA 4KEIA 4JKXB 3EF2A 5B2HA 4LO2A 1HIBA 3WMUA 3HMYA 2NVHA 4G9NA 4P0JA 1Q1UA 3K1XA 5D61A 3VUOA 1W3AA 2ESUA 2D24A 1FV3A 3VSFA 2ERMA 1F31A 5F8WA 3OJMA 1ISZA 1G9DA 2D1ZA 3P6IA 2FFUA 3AJ5A 3BRDA 5BP5A 2F2FC 4J2YA 4ISRA 2VXRA 3FJHA 2D7RA 2Q9XA 4ZKTB 2Z49A 1S0LA 3A07A 5HPZA 1DZDA 4YOLA 4FVVA 5D63A 4I0YA 4XFSA 1DQGA 1EPWA 5EG6C 3FJAA 4I8MA 3CA3A 5FNXA 2D7IA 1YBIA 4D8HA 3AH4A 1JT7A 1JLXA 1NZKA 3BX1C 3RTIB 3AH2A 4LO7C 2FO1A 4A7ZA 3RTJB 3F62B 2D20A 3WO3A 4H9WA 4QKRA 4IY8A 3IAGC 4I3NA 4J23B 1M2TB 3UJ0A 2DRYA 2ZQNA 4QKSA 3HALA 3BB2A 5FZUA 2YUGA 5I1BA 1ISVA 3BAQA 1WD3A 1ISWA 4I4VA 2D43A 5BOWA 3IM7A 3OGGA 5G00A 1HCDA 4I4UA 1DJSB 3WO2A 3ZXGA 1XG6A 1S0DA 2NM1A 3VSZA 3VT2A 1PZZA 4II0A 2DREA 3RSJA 3V0AA 1ISXA 2FDBM 1S0BA 4MZHA 1FN0A 4A7YA 2Q3NB 3CA6A 5FZZA 4DEPA 1CVSA 5E24E 1XYFA 1PUMB 1ILR1 2KKIA 3N7LA 3Q7XA 3PHZA 4PC4A 4GOVA 1I1EA 4I2SA 3TC2A 3Q7WA 4G6MA 2E4MA 2VLCA 4I4RA 2LIEA 3PG0A 1T9FA 3FGMA 3CA4A 2AXMA 1XZZA 1WBAA 3H6RB 1HKNA 3RMYA 8I1BA 3RMXA 4G9MA 2VSAA 4JPZA 1FGAA 3NJ5A 3H6QA 4FGFA 3FJBA 1BFBA 3LLPA 21BIA 1AFCA 1JT3A 1YYNA 3FJ8A 3NBNA 4QBCA 3BAVA 1II4A 2KLLA 3AZWA 3T8SA 1G9BA 4L4IA 4OEEA 5BQUA 2X2SA 2P39A 4EFQA 1IILA 2BEBA 2GZBA 2NYYA 4ZFYB 4EEEB 4OWJA 2BEAA 1Q04A 2ET2A 3PMEA 4P0LA 5FZYA 1S0GA 1AXMA 3QYDA 1W3FA 1G9CA 1JQZA 3BAUA 4H04A 1R8NA 4X39A 4KBBA 4XKIA 4LO1A 1EYLA 3O4DA 2AAIB 1VCLA 1JT4A 1YTOA 1Z4SA 1V6VA 3UD7A 3FJFA 1IRPA 3OJ2A 3BADA 1N4KA 5EHAA 1IHKA 4DENA 5JMCA 1ONKB 3FUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2T A;  5JLV A;  4X37 A;  4KEK A;  4LO7 B;  4USP A;  1QQL A;  1FV2 A;  1PC8 B;  4AN6 A;  3FJK A;  2WBC A;  3CAH A;  4TLP A;  1GGP B;  4ISQ A;  2J3P A;  3JRR A;  3NBE A;  4G6J A;  31BI A;  2MIB A;  3AJ6 A;  3FJI A;  2ZQO A;  4QO3 A;  1E0O A;  1HWO B;  4ION A;  1ITB A;  1XHB A;  1WD4 A;  3HSM A;  3VT1 A;  1QXM A;  4G1R A;  2IHO A;  3CQA A;  1S0E A;  3CRI A;  4OUJ A;  3OBT A;  1M16 A;  3BRG C;  2IWT B;  3BTA A;  3WIN A;  3WMV A;  3V0B A;  3KMV A;  2ZR1 B;  3CRH A;  4I37 A;  3CA1 A;  3O3Q A;  1V6U A;  1YF8 B;  3ZXD A;  4I4O A;  3FFZ A;  4ZOT A;  2Y9G A;  3I2A A;  1K5U A;  1W3G A;  2VU9 A;  1DFQ A;  4LO2 C;  2FGF A;  3R4S A;  1PUU B;  2I1B A;  3BAG A;  7I1B A;  9ILB A;  3O4O A;  3VT0 A;  1SR4 A;  3CRG A;  1Z0H A;  3N7K A;  2D22 A;  3UDA A;  2AQZ A;  2UUS A;  3O4C A;  3ZC8 A;  4XFT A;  4EB2 B;  4Q9P A;  3PUB A;  5BP5 C;  1DQO A;  1MD6 A;  2VXT I;  5DVH A;  3SNV A;  1P63 A;  2M49 A;  3V79 C;  1JTC A;  3VEQ A;  4ZLB B;  1G9A A;  1S0C A;  3OJV A;  3E8L C;  2HWM A;  3AKG A;  1IJT A;  3BAO A;  4LO8 B;  4IHZ A;  3WO4 A;  1BAR A;  3BA5 A;  1WBC A;  2WRY A;  3AZV A;  3R4U A;  1BA7 A;  2K4A B;  1TIE A;  3UD9 A;  3V0A B;  3S8J A;  3UJ4 A;  1QQK A;  4IYB A;  1SZ6 B;  3P53 A;  3BAH A;  1FWU A;  4ZA3 B;  1TFM B;  1Z2V A;  4JAW A;  3N7M A;  4D0Z A;  1HWP B;  2F2F A;  3LTQ A;  4ZBV B;  1BLD A;  6I1B A;  4IQP A;  4I4X A;  4OWL A;  3CA5 A;  1R8O A;  4LO3 A;  4HR6 C;  4LO0 A;  5F8Y A;  4KC3 A;  4CJM A;  4X3A A;  3MPP G;  1AVX B;  4I6I A;  3FJD A;  1SR4 C;  3IM5 A;  3S8K A;  1RY7 A;  4Q91 A;  1IT0 A;  4J2S A;  1ABR B;  1RG8 A;  4JQ0 A;  3WA1 A;  1A8D A;  1J0S A;  4L4H A;  4QC4 A;  1RML A;  3AKH A;  2R9K B;  3BRF A;  41BI A;  2E4M C;  1T4Q A;  2K43 A;  2VSE A;  4GAF A;  1FMM S;  4GOY A;  1IOB A;  1V6X A;  1AVW B;  3B9U A;  1HWM B;  4I4P A;  2RST A;  4F83 A;  3POK A;  3O4B A;  1DLL A;  1EVT A;  3N7J A;  1AF9 A;  3A23 A;  1FMZ A;  2GO2 A;  3FJJ A;  3NBD A;  3AH1 A;  4HJJ A;  4USO A;  1RZO B;  4A7K A;  2QYI B;  1UPS A;  4QBV A;  2Y9F A;  3CA0 A;  1CE7 B;  2F8X C;  2MLL B;  5BQU C;  4EFR A;  3H6S E;  4IY9 A;  3NBC A;  3IM6 A;  3C9Z A;  4J2K A;  2FFV A;  2HW9 A;  3OGF A;  5BVP I;  4Z9W B;  4I7I A;  2Y9W C;  5F8S A;  4HA2 A;  4LO3 C;  2KI4 A;  4LO0 C;  2LIQ A;  1S0F A;  1Q03 A;  1YXW A;  2D44 A;  3ZC9 A;  1KNM A;  1TP0 A;  4LO1 C;  1NUN A;  3OBR A;  4D0T A;  1HWN B;  3O44 A;  2KH2 A;  1ISY A;  3A22 A;  1K5V A;  3BA4 A;  3HN1 A;  5D62 A;  4ZFW B;  3IIR A;  2K8R A;  1TTU A;  2RQ9 A;  3BA7 A;  4JKQ A;  4GP0 A;  5DZU A;  5DSS B;  5DUY A;  2HZ9 A;  2QN4 A;  4OW4 A;  1TOO A;  2RG9 B;  3ILA A;  3Q7Y A;  4DCK C;  2Y9X E;  3MAL A;  3QR5 A;  4END A;  1JY0 A;  4QAL A;  3V0B B;  4I4Q A;  5BXT A;  1DIW A;  4X38 A;  5BXS A;  4EFP A;  3I29 B;  2L5X A;  1AVA C;  1JLY A;  3H6R A;  1D0H A;  2P23 A;  2Z48 A;  4P0K A;  5F90 A;  1G82 A;  4QD2 B;  4OWK A;  2DRZ A;  4Q9G A;  3CU1 B;  3O5W B;  3ZX7 A;  3HBW A;  5EC5 A;  4GP3 A;  2BFH A;  2D23 A;  3A21 A;  3FUO A;  1BFF A;  3FJE A;  3N0K A;  2DS0 A;  4I4S A;  4XFU A;  2NP0 A;  3WIN C;  2HWA A;  4KEJ A;  1BLA A;  4WBC A;  1L2H A;  1BAS A;  1DZC A;  1AVU A;  1TWM A;  3I2X A;  3O4A A;  2KI6 B;  4JP0 A;  4Z8S B;  1I1B A;  5BXP A;  1FWV A;  1V6W A;  4J2X A;  3F1R A;  4ZGR B;  4IZX A;  3FJ9 A;  4AN7 B;  4QD2 C;  5BXR A;  3JUT A;  4OEG A;  4I1E A;  4I96 A;  4ZFU B;  3UD8 A;  1PWA A;  1BFC A;  4F34 A;  3P6J A;  2MC2 A;  3D7W B;  1DFC A;  5FNW A;  1MC9 A;  3HOM A;  3W9T A;  4EKX B;  5GAQ A;  2VUA A;  2XOA A;  3AKI A;  4I1B A;  1FQ9 A;  1OQL B;  3O49 A;  4P6A A;  1IRA X;  1TWE A;  3AKF A;  4GAI A;  4IZE A;  2NZ9 A;  4JRA A;  4OEF A;  4I4Y A;  3FJC A;  2AFG A;  1HCE A;  4R6U B;  1EV2 A;  1JT5 A;  2NTD A;  3VWC A;  1BFG A;  4KEI A;  4JKX B;  3EF2 A;  5B2H A;  4LO2 A;  1HIB A;  3WMU A;  3HMY A;  2NVH A;  4G9N A;  4P0J A;  1Q1U A;  3K1X A;  5D61 A;  3VUO A;  1W3A A;  2ESU A;  2D24 A;  1FV3 A;  3VSF A;  2ERM A;  1F31 A;  5F8W A;  3OJM A;  1ISZ A;  1G9D A;  2D1Z A;  3P6I A;  2FFU A;  3AJ5 A;  3BRD A;  5BP5 A;  2F2F C;  4J2Y A;  4ISR A;  2VXR A;  3FJH A;  2D7R A;  2Q9X A;  4ZKT B;  2Z49 A;  1S0L A;  3A07 A;  5HPZ A;  1DZD A;  4YOL A;  4FVV A;  5D63 A;  4I0Y A;  4XFS A;  1DQG A;  1EPW A;  5EG6 C;  3FJA A;  4I8M A;  3CA3 A;  5FNX A;  2D7I A;  1YBI A;  4D8H A;  3AH4 A;  1JT7 A;  1JLX A;  1NZK A;  3BX1 C;  3RTI B;  3AH2 A;  4LO7 C;  2FO1 A;  4A7Z A;  3RTJ B;  3F62 B;  2D20 A;  3WO3 A;  4H9W A;  4QKR A;  4IY8 A;  3IAG C;  4I3N A;  4J23 B;  1M2T B;  3UJ0 A;  2DRY A;  2ZQN A;  4QKS A;  3HAL A;  3BB2 A;  5FZU A;  2YUG A;  5I1B A;  1ISV A;  3BAQ A;  1WD3 A;  1ISW A;  4I4V A;  2D43 A;  5BOW A;  3IM7 A;  3OGG A;  5G00 A;  1HCD A;  4I4U A;  1DJS B;  3WO2 A;  3ZXG A;  1XG6 A;  1S0D A;  2NM1 A;  3VSZ A;  3VT2 A;  1PZZ A;  4II0 A;  2DRE A;  3RSJ A;  3V0A A;  1ISX A;  2FDB M;  1S0B A;  1FN0 A;  4A7Y A;  2Q3N B;  3CA6 A;  5FZZ A;  4DEP A;  1CVS A;  5E24 E;  1XYF A;  1PUM B;  1ILR 1;  2KKI A;  3N7L A;  3Q7X A;  3PHZ A;  4PC4 A;  4GOV A;  1I1E A;  4I2S A;  3TC2 A;  3Q7W A;  4G6M A;  2E4M A;  2VLC A;  4I4R A;  2LIE A;  3PG0 A;  1T9F A;  3FGM A;  3CA4 A;  2AXM A;  1XZZ A;  1WBA A;  3H6R B;  1HKN A;  3RMY A;  8I1B A;  3RMX A;  4G9M A;  2VSA A;  4JPZ A;  1FGA A;  3NJ5 A;  3H6Q A;  4FGF A;  3FJB A;  1BFB A;  3LLP A;  21BI A;  1AFC A;  1JT3 A;  1YYN A;  3FJ8 A;  3NBN A;  4QBC A;  3BAV A;  1II4 A;  2KLL A;  3AZW A;  3T8S A;  1G9B A;  4L4I A;  4OEE A;  5BQU A;  2X2S A;  2P39 A;  4EFQ A;  1IIL A;  2BEB A;  2GZB A;  2NYY A;  4ZFY B;  4EEE B;  4OWJ A;  2BEA A;  1Q04 A;  2ET2 A;  3PME A;  4P0L A;  5FZY A;  1S0G A;  1AXM A;  3QYD A;  1W3F A;  1G9C A;  1JQZ A;  3BAU A;  4H04 A;  1R8N A;  4X39 A;  4KBB A;  4XKI A;  4LO1 A;  1EYL A;  3O4D A;  2AAI B;  1VCL A;  1JT4 A;  1YTO A;  1Z4S A;  1V6V A;  3UD7 A;  3FJF A;  1IRP A;  3OJ2 A;  3BAD A;  1N4K A;  5EHA A;  1IHK A;  4DEN A;  5JMC A;  1ONK B;  3FUQ A; 
#chains in the Genus database with same CATH topology
 2X2T A;  5JLV A;  4X37 A;  4KEK A;  4LO7 B;  4USP A;  1QQL A;  1FV2 A;  1PC8 B;  4AN6 A;  3FJK A;  2WBC A;  3CAH A;  4TLP A;  1GGP B;  4ISQ A;  2J3P A;  3JRR A;  3NBE A;  4MZF B;  4G6J A;  31BI A;  2MIB A;  3AJ6 A;  3FJI A;  2ZQO A;  4QO3 A;  1E0O A;  1HWO B;  4ION A;  1ITB A;  1XHB A;  1WD4 A;  3HSM A;  3VT1 A;  1QXM A;  4G1R A;  2IHO A;  3CQA A;  1S0E A;  3CRI A;  4OUJ A;  3OBT A;  1M16 A;  3BRG C;  2IWT B;  3BTA A;  3WIN A;  3WMV A;  3V0B A;  3KMV A;  2ZR1 B;  3CRH A;  4I37 A;  3CA1 A;  3O3Q A;  1V6U A;  1YF8 B;  3ZXD A;  4I4O A;  3FFZ A;  4H75 A;  4ZOT A;  2Y9G A;  3I2A A;  1K5U A;  1W3G A;  2VU9 A;  1DFQ A;  4LO2 C;  2FGF A;  3R4S A;  1PUU B;  2I1B A;  3BAG A;  7I1B A;  9ILB A;  3O4O A;  3VT0 A;  1SR4 A;  3CRG A;  1Z0H A;  3N7K A;  2D22 A;  3UDA A;  2AQZ A;  2UUS A;  3O4C A;  3ZC8 A;  4XFT A;  4EB2 B;  4Q9P A;  3PUB A;  5BP5 C;  1DQO A;  1MD6 A;  2VXT I;  5DVH A;  3SNV A;  1P63 A;  2M49 A;  3V79 C;  1JTC A;  3VEQ A;  4ZLB B;  1G9A A;  1S0C A;  3OJV A;  3E8L C;  2HWM A;  3AKG A;  1IJT A;  3BAO A;  4LO8 B;  4IHZ A;  3WO4 A;  1BAR A;  3BA5 A;  1WBC A;  2WRY A;  3AZV A;  3R4U A;  1BA7 A;  2K4A B;  4UY4 A;  1TIE A;  3UD9 A;  3V0A B;  3S8J A;  3UJ4 A;  1QQK A;  4IYB A;  1SZ6 B;  3P53 A;  3BAH A;  1FWU A;  4ZA3 B;  1TFM B;  1Z2V A;  4JAW A;  3N7M A;  4D0Z A;  1HWP B;  2F2F A;  3LTQ A;  4ZBV B;  1BLD A;  6I1B A;  4IQP A;  4I4X A;  4OWL A;  3CA5 A;  1R8O A;  4LO3 A;  4HR6 C;  4LO0 A;  5F8Y A;  4KC3 A;  4CJM A;  4X3A A;  3MPP G;  1AVX B;  4I6I A;  3FJD A;  1SR4 C;  3IM5 A;  3S8K A;  1RY7 A;  4Q91 A;  1IT0 A;  4J2S A;  1ABR B;  1RG8 A;  4JQ0 A;  3WA1 A;  1A8D A;  1J0S A;  4L4H A;  4QC4 A;  1RML A;  3AKH A;  2R9K B;  3BRF A;  41BI A;  2E4M C;  1T4Q A;  2K43 A;  2VSE A;  4GAF A;  1FMM S;  4GOY A;  1IOB A;  1V6X A;  1AVW B;  3B9U A;  1HWM B;  4I4P A;  2RST A;  4F83 A;  3POK A;  3O4B A;  1DLL A;  1EVT A;  3N7J A;  1AF9 A;  3A23 A;  1FMZ A;  2GO2 A;  3FJJ A;  3NBD A;  3AH1 A;  4HJJ A;  4USO A;  1RZO B;  4A7K A;  2QYI B;  1UPS A;  4QBV A;  4MZG B;  2Y9F A;  3CA0 A;  1CE7 B;  2F8X C;  2MLL B;  5BQU C;  4EFR A;  3H6S E;  4IY9 A;  3NBC A;  3IM6 A;  3C9Z A;  4J2K A;  2FFV A;  2HW9 A;  3OGF A;  5BVP I;  4Z9W B;  4I7I A;  2Y9W C;  5F8S A;  4HA2 A;  4LO3 C;  2KI4 A;  4LO0 C;  2LIQ A;  1S0F A;  1Q03 A;  1YXW A;  2D44 A;  3ZC9 A;  1KNM A;  1TP0 A;  4LO1 C;  1NUN A;  3OBR A;  4D0T A;  1HWN B;  3O44 A;  2KH2 A;  1ISY A;  3A22 A;  1K5V A;  3BA4 A;  3HN1 A;  5D62 A;  4ZFW B;  3IIR A;  2K8R A;  1TTU A;  2RQ9 A;  3BA7 A;  4JKQ A;  4GP0 A;  5DZU A;  5DSS B;  5DUY A;  2HZ9 A;  2QN4 A;  4OW4 A;  1TOO A;  2RG9 B;  3ILA A;  3Q7Y A;  4DCK C;  2Y9X E;  3MAL A;  3QR5 A;  4END A;  2NS2 A;  1JY0 A;  4QAL A;  3V0B B;  4I4Q A;  5BXT A;  1DIW A;  4X38 A;  5BXS A;  4EFP A;  3I29 B;  2L5X A;  1AVA C;  1JLY A;  3H6R A;  1D0H A;  2P23 A;  2Z48 A;  4P0K A;  5F90 A;  1G82 A;  4QD2 B;  4OWK A;  2DRZ A;  4Q9G A;  3CU1 B;  3O5W B;  3ZX7 A;  3HBW A;  5EC5 A;  4GP3 A;  2BFH A;  2D23 A;  3A21 A;  3FUO A;  1BFF A;  3FJE A;  3N0K A;  2DS0 A;  4I4S A;  4XFU A;  2NP0 A;  3WIN C;  2HWA A;  4KEJ A;  1BLA A;  4WBC A;  1L2H A;  1BAS A;  1DZC A;  1AVU A;  1TWM A;  3I2X A;  3O4A A;  2KI6 B;  4JP0 A;  4Z8S B;  1I1B A;  5BXP A;  1FWV A;  1V6W A;  4J2X A;  3F1R A;  4ZGR B;  4IZX A;  3FJ9 A;  4AN7 B;  4QD2 C;  5BXR A;  3JUT A;  4OEG A;  4I1E A;  4I96 A;  4ZFU B;  3UD8 A;  1PWA A;  1BFC A;  4F34 A;  3P6J A;  2MC2 A;  3D7W B;  1DFC A;  5FNW A;  1MC9 A;  3HOM A;  3W9T A;  4EKX B;  5GAQ A;  2VUA A;  2XOA A;  3AKI A;  4I1B A;  1FQ9 A;  1OQL B;  3O49 A;  4P6A A;  1IRA X;  1TWE A;  3AKF A;  4GAI A;  4IZE A;  2NZ9 A;  4JRA A;  4OEF A;  4I4Y A;  3FJC A;  2AFG A;  1HCE A;  4R6U B;  1EV2 A;  1JT5 A;  2NTD A;  3VWC A;  1BFG A;  4KEI A;  4JKX B;  3EF2 A;  5B2H A;  4LO2 A;  1HIB A;  3WMU A;  3HMY A;  2NVH A;  4G9N A;  4P0J A;  1Q1U A;  3K1X A;  5D61 A;  3VUO A;  1W3A A;  2ESU A;  2D24 A;  1FV3 A;  3VSF A;  2ERM A;  1F31 A;  5F8W A;  3OJM A;  1ISZ A;  1G9D A;  2D1Z A;  3P6I A;  2FFU A;  3AJ5 A;  3BRD A;  5BP5 A;  2F2F C;  4J2Y A;  4ISR A;  2VXR A;  3FJH A;  2D7R A;  2Q9X A;  4ZKT B;  2Z49 A;  1S0L A;  3A07 A;  5HPZ A;  1DZD A;  4YOL A;  4FVV A;  5D63 A;  4I0Y A;  4XFS A;  1DQG A;  1EPW A;  5EG6 C;  3FJA A;  4I8M A;  3CA3 A;  5FNX A;  2D7I A;  1YBI A;  4D8H A;  3AH4 A;  1JT7 A;  1JLX A;  1NZK A;  3BX1 C;  3RTI B;  3AH2 A;  4LO7 C;  2FO1 A;  4A7Z A;  3RTJ B;  3F62 B;  2D20 A;  3WO3 A;  4H9W A;  4QKR A;  4IY8 A;  3IAG C;  4I3N A;  4J23 B;  1M2T B;  3UJ0 A;  2DRY A;  2ZQN A;  4QKS A;  3HAL A;  3BB2 A;  5FZU A;  2YUG A;  5I1B A;  1ISV A;  3BAQ A;  1WD3 A;  1ISW A;  4I4V A;  2D43 A;  5BOW A;  3IM7 A;  3OGG A;  5G00 A;  1HCD A;  4I4U A;  1DJS B;  3WO2 A;  3ZXG A;  1XG6 A;  1S0D A;  2NM1 A;  3VSZ A;  3VT2 A;  1PZZ A;  4II0 A;  2DRE A;  3RSJ A;  3V0A A;  1ISX A;  2FDB M;  1S0B A;  4MZH A;  1FN0 A;  4A7Y A;  2Q3N B;  3CA6 A;  5FZZ A;  4DEP A;  1CVS A;  5E24 E;  1XYF A;  1PUM B;  1ILR 1;  2KKI A;  3N7L A;  3Q7X A;  3PHZ A;  4PC4 A;  4GOV A;  1I1E A;  4I2S A;  3TC2 A;  3Q7W A;  4G6M A;  2E4M A;  2VLC A;  4I4R A;  2LIE A;  3PG0 A;  1T9F A;  3FGM A;  3CA4 A;  2AXM A;  1XZZ A;  1WBA A;  3H6R B;  1HKN A;  3RMY A;  8I1B A;  3RMX A;  4G9M A;  2VSA A;  4JPZ A;  1FGA A;  3NJ5 A;  3H6Q A;  4FGF A;  3FJB A;  1BFB A;  3LLP A;  21BI A;  1AFC A;  1JT3 A;  1YYN A;  3FJ8 A;  3NBN A;  4QBC A;  3BAV A;  1II4 A;  2KLL A;  3AZW A;  3T8S A;  1G9B A;  4L4I A;  4OEE A;  5BQU A;  2X2S A;  2P39 A;  4EFQ A;  1IIL A;  2BEB A;  2GZB A;  2NYY A;  4ZFY B;  4EEE B;  4OWJ A;  2BEA A;  1Q04 A;  2ET2 A;  3PME A;  4P0L A;  5FZY A;  1S0G A;  1AXM A;  3QYD A;  1W3F A;  1G9C A;  1JQZ A;  3BAU A;  4H04 A;  1R8N A;  4X39 A;  4KBB A;  4XKI A;  4LO1 A;  1EYL A;  3O4D A;  2AAI B;  1VCL A;  1JT4 A;  1YTO A;  1Z4S A;  1V6V A;  3UD7 A;  3FJF A;  1IRP A;  3OJ2 A;  3BAD A;  1N4K A;  5EHA A;  1IHK A;  4DEN A;  5JMC A;  1ONK B;  3FUQ A; 
#chains in the Genus database with same CATH homology
 2X2T A;  5JLV A;  4X37 A;  4KEK A;  4LO7 B;  4USP A;  1QQL A;  1FV2 A;  1PC8 B;  4AN6 A;  3FJK A;  2WBC A;  3CAH A;  4TLP A;  1GGP B;  4ISQ A;  2J3P A;  3JRR A;  3NBE A;  4MZF B;  4G6J A;  31BI A;  2MIB A;  3AJ6 A;  3FJI A;  2ZQO A;  4QO3 A;  1E0O A;  1HWO B;  4ION A;  1ITB A;  1XHB A;  1WD4 A;  3HSM A;  3VT1 A;  1QXM A;  4G1R A;  2IHO A;  3CQA A;  1S0E A;  3CRI A;  4OUJ A;  3OBT A;  1M16 A;  3BRG C;  2IWT B;  3BTA A;  3WIN A;  3WMV A;  3V0B A;  3KMV A;  2ZR1 B;  3CRH A;  4I37 A;  3CA1 A;  3O3Q A;  1V6U A;  1YF8 B;  3ZXD A;  4I4O A;  3FFZ A;  4H75 A;  4ZOT A;  2Y9G A;  3I2A A;  1K5U A;  1W3G A;  2VU9 A;  1DFQ A;  4LO2 C;  2FGF A;  3R4S A;  1PUU B;  2I1B A;  3BAG A;  7I1B A;  9ILB A;  3O4O A;  3VT0 A;  1SR4 A;  3CRG A;  1Z0H A;  3N7K A;  2D22 A;  3UDA A;  2AQZ A;  2UUS A;  3O4C A;  3ZC8 A;  4XFT A;  4EB2 B;  4Q9P A;  3PUB A;  5BP5 C;  1DQO A;  1MD6 A;  2VXT I;  5DVH A;  3SNV A;  1P63 A;  2M49 A;  3V79 C;  1JTC A;  3VEQ A;  4ZLB B;  1G9A A;  1S0C A;  3OJV A;  3E8L C;  2HWM A;  3AKG A;  1IJT A;  3BAO A;  4LO8 B;  4IHZ A;  3WO4 A;  1BAR A;  3BA5 A;  1WBC A;  2WRY A;  3AZV A;  3R4U A;  1BA7 A;  2K4A B;  4UY4 A;  1TIE A;  3UD9 A;  3V0A B;  3S8J A;  3UJ4 A;  1QQK A;  4IYB A;  1SZ6 B;  3P53 A;  3BAH A;  1FWU A;  4ZA3 B;  1TFM B;  1Z2V A;  4JAW A;  3N7M A;  4D0Z A;  1HWP B;  2F2F A;  3LTQ A;  4ZBV B;  1BLD A;  6I1B A;  4IQP A;  4I4X A;  4OWL A;  3CA5 A;  1R8O A;  4LO3 A;  4HR6 C;  4LO0 A;  5F8Y A;  4KC3 A;  4CJM A;  4X3A A;  3MPP G;  1AVX B;  4I6I A;  3FJD A;  1SR4 C;  3IM5 A;  3S8K A;  1RY7 A;  4Q91 A;  1IT0 A;  4J2S A;  1ABR B;  1RG8 A;  4JQ0 A;  3WA1 A;  1A8D A;  1J0S A;  4L4H A;  4QC4 A;  1RML A;  3AKH A;  2R9K B;  3BRF A;  41BI A;  2E4M C;  1T4Q A;  2K43 A;  2VSE A;  4GAF A;  1FMM S;  4GOY A;  1IOB A;  1V6X A;  1AVW B;  3B9U A;  1HWM B;  4I4P A;  2RST A;  4F83 A;  3POK A;  3O4B A;  1DLL A;  1EVT A;  3N7J A;  1AF9 A;  3A23 A;  1FMZ A;  2GO2 A;  3FJJ A;  3NBD A;  3AH1 A;  4HJJ A;  4USO A;  1RZO B;  4A7K A;  2QYI B;  1UPS A;  4QBV A;  4MZG B;  2Y9F A;  3CA0 A;  1CE7 B;  2F8X C;  2MLL B;  5BQU C;  4EFR A;  3H6S E;  4IY9 A;  3NBC A;  3IM6 A;  3C9Z A;  4J2K A;  2FFV A;  2HW9 A;  3OGF A;  5BVP I;  4Z9W B;  4I7I A;  2Y9W C;  5F8S A;  4HA2 A;  4LO3 C;  2KI4 A;  4LO0 C;  2LIQ A;  1S0F A;  1Q03 A;  1YXW A;  2D44 A;  3ZC9 A;  1KNM A;  1TP0 A;  4LO1 C;  1NUN A;  3OBR A;  4D0T A;  1HWN B;  3O44 A;  2KH2 A;  1ISY A;  3A22 A;  1K5V A;  3BA4 A;  3HN1 A;  5D62 A;  4ZFW B;  3IIR A;  2K8R A;  1TTU A;  2RQ9 A;  3BA7 A;  4JKQ A;  4GP0 A;  5DZU A;  5DSS B;  5DUY A;  2HZ9 A;  2QN4 A;  4OW4 A;  1TOO A;  2RG9 B;  3ILA A;  3Q7Y A;  4DCK C;  2Y9X E;  3MAL A;  3QR5 A;  4END A;  2NS2 A;  1JY0 A;  4QAL A;  3V0B B;  4I4Q A;  5BXT A;  1DIW A;  4X38 A;  5BXS A;  4EFP A;  3I29 B;  2L5X A;  1AVA C;  1JLY A;  3H6R A;  1D0H A;  2P23 A;  2Z48 A;  4P0K A;  5F90 A;  1G82 A;  4QD2 B;  4OWK A;  2DRZ A;  4Q9G A;  3CU1 B;  3O5W B;  3ZX7 A;  3HBW A;  5EC5 A;  4GP3 A;  2BFH A;  2D23 A;  3A21 A;  3FUO A;  1BFF A;  3FJE A;  3N0K A;  2DS0 A;  4I4S A;  4XFU A;  2NP0 A;  3WIN C;  2HWA A;  4KEJ A;  1BLA A;  4WBC A;  1L2H A;  1BAS A;  1DZC A;  1AVU A;  1TWM A;  3I2X A;  3O4A A;  2KI6 B;  4JP0 A;  4Z8S B;  1I1B A;  5BXP A;  1FWV A;  1V6W A;  4J2X A;  3F1R A;  4ZGR B;  4IZX A;  3FJ9 A;  4AN7 B;  4QD2 C;  5BXR A;  3JUT A;  4OEG A;  4I1E A;  4I96 A;  4ZFU B;  3UD8 A;  1PWA A;  1BFC A;  4F34 A;  3P6J A;  2MC2 A;  3D7W B;  1DFC A;  5FNW A;  1MC9 A;  3HOM A;  3W9T A;  4EKX B;  5GAQ A;  2VUA A;  2XOA A;  3AKI A;  4I1B A;  1FQ9 A;  1OQL B;  3O49 A;  4P6A A;  1IRA X;  1TWE A;  3AKF A;  4GAI A;  4IZE A;  2NZ9 A;  4JRA A;  4OEF A;  4I4Y A;  3FJC A;  2AFG A;  1HCE A;  4R6U B;  1EV2 A;  1JT5 A;  2NTD A;  3VWC A;  1BFG A;  4KEI A;  4JKX B;  3EF2 A;  5B2H A;  4LO2 A;  1HIB A;  3WMU A;  3HMY A;  2NVH A;  4G9N A;  4P0J A;  1Q1U A;  3K1X A;  5D61 A;  3VUO A;  1W3A A;  2ESU A;  2D24 A;  1FV3 A;  3VSF A;  2ERM A;  1F31 A;  5F8W A;  3OJM A;  1ISZ A;  1G9D A;  2D1Z A;  3P6I A;  2FFU A;  3AJ5 A;  3BRD A;  5BP5 A;  2F2F C;  4J2Y A;  4ISR A;  2VXR A;  3FJH A;  2D7R A;  2Q9X A;  4ZKT B;  2Z49 A;  1S0L A;  3A07 A;  5HPZ A;  1DZD A;  4YOL A;  4FVV A;  5D63 A;  4I0Y A;  4XFS A;  1DQG A;  1EPW A;  5EG6 C;  3FJA A;  4I8M A;  3CA3 A;  5FNX A;  2D7I A;  1YBI A;  4D8H A;  3AH4 A;  1JT7 A;  1JLX A;  1NZK A;  3BX1 C;  3RTI B;  3AH2 A;  4LO7 C;  2FO1 A;  4A7Z A;  3RTJ B;  3F62 B;  2D20 A;  3WO3 A;  4H9W A;  4QKR A;  4IY8 A;  3IAG C;  4I3N A;  4J23 B;  1M2T B;  3UJ0 A;  2DRY A;  2ZQN A;  4QKS A;  3HAL A;  3BB2 A;  5FZU A;  2YUG A;  5I1B A;  1ISV A;  3BAQ A;  1WD3 A;  1ISW A;  4I4V A;  2D43 A;  5BOW A;  3IM7 A;  3OGG A;  5G00 A;  1HCD A;  4I4U A;  1DJS B;  3WO2 A;  3ZXG A;  1XG6 A;  1S0D A;  2NM1 A;  3VSZ A;  3VT2 A;  1PZZ A;  4II0 A;  2DRE A;  3RSJ A;  3V0A A;  1ISX A;  2FDB M;  1S0B A;  4MZH A;  1FN0 A;  4A7Y A;  2Q3N B;  3CA6 A;  5FZZ A;  4DEP A;  1CVS A;  5E24 E;  1XYF A;  1PUM B;  1ILR 1;  2KKI A;  3N7L A;  3Q7X A;  3PHZ A;  4PC4 A;  4GOV A;  1I1E A;  4I2S A;  3TC2 A;  3Q7W A;  4G6M A;  2E4M A;  2VLC A;  4I4R A;  2LIE A;  3PG0 A;  1T9F A;  3FGM A;  3CA4 A;  2AXM A;  1XZZ A;  1WBA A;  3H6R B;  1HKN A;  3RMY A;  8I1B A;  3RMX A;  4G9M A;  2VSA A;  4JPZ A;  1FGA A;  3NJ5 A;  3H6Q A;  4FGF A;  3FJB A;  1BFB A;  3LLP A;  21BI A;  1AFC A;  1JT3 A;  1YYN A;  3FJ8 A;  3NBN A;  4QBC A;  3BAV A;  1II4 A;  2KLL A;  3AZW A;  3T8S A;  1G9B A;  4L4I A;  4OEE A;  5BQU A;  2X2S A;  2P39 A;  4EFQ A;  1IIL A;  2BEB A;  2GZB A;  2NYY A;  4ZFY B;  4EEE B;  4OWJ A;  2BEA A;  1Q04 A;  2ET2 A;  3PME A;  4P0L A;  5FZY A;  1S0G A;  1AXM A;  3QYD A;  1W3F A;  1G9C A;  1JQZ A;  3BAU A;  4H04 A;  1R8N A;  4X39 A;  4KBB A;  4XKI A;  4LO1 A;  1EYL A;  3O4D A;  2AAI B;  1VCL A;  1JT4 A;  1YTO A;  1Z4S A;  1V6V A;  3UD7 A;  3FJF A;  1IRP A;  3OJ2 A;  3BAD A;  1N4K A;  5EHA A;  1IHK A;  4DEN A;  5JMC A;  1ONK B;  3FUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...