6I1BA

High-resolution three-dimensional structure of interleukin-1 beta in solution by three-and four-dimensional nuclear magnetic resonance spectroscopy
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
153
structure length
153
Chain Sequence
b'APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-1 BETA
publication title High-resolution three-dimensional structure of interleukin 1 beta in solution by three- and four-dimensional nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 16
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 1991-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 6i1bA00
2D7IA 4USOA 21BIA 3V0BB 5BQUC 1W3AA 4LO0C 2AFGA 5BXRA 4HA2A 3OJMA 4I2SA 2Q3NB 1S0LA 4JPZA 1DQOA 3CA6A 3CA1A 1DJSB 3RMYA 1M2TB 4ZOTA 1I1BA 3IM5A 1W3FA 1JT7A 1HCEA 1AVAC 2KI4A 4I4YA 4G9NA 4I4OA 4I4QA 2IHOA 4LO8B 4ZLBB 2L5XA 1YTOA 6I1BA 1FV3A 1FWUA 3UD9A 1DFQA 4HJJA 4WBCA 1G9AA 1HWOB 5BP5C 4IQPA 3BB2A 4XFTA 3IAGC 1ONKB 1T9FA 2J3PA 3WO4A 2K8RA 1XYFA 3BRFA 1AXMA 2HZ9A 1AF9A 2FDBM 1FWVA 2FFUA 3Q7XA 4D8HA 4X3AA 1CVSA 3BA5A 2D23A 4IHZA 4I96A 3VT0A 2AQZA 5EC5A 3WO2A 4EFQA 1MD6A 3ZXDA 3CRIA 1FMMS 2E4MC 4QO3A 1EVTA 1WBAA 4I4SA 4ENDA 2HWMA 2X2SA 4OWKA 3HALA 1JT3A 3OGGA 4QALA 1FQ9A 3H6RB 4AN7B 1G9BA 1HIBA 5DZUA 3AKIA 4ISRA 3PG0A 2RG9B 1RG8A 2D20A 2DRYA 2DS0A 1HKNA 3VT2A 5F8YA 4GOYA 3O4BA 3OBTA 1DIWA 3ZXGA 4I8MA 3VSFA 1DZDA 3HMYA 2DREA 2FFVA 2HW9A 2NYYA 2VSEA 3O5WB 4OEGA 4GAFA 1ISVA 3RMXA 3O4AA 4I4XA 3A07A 3AKGA 3IM6A 4I4UA 1T4QA 1TIEA 2QN4A 1OQLB 1BARA 2DRZA 4PC4A 4J2YA 1JLYA 1YXWA 4P0JA 1HWMB 3PMEA 4G1RA 4QKRA 2VUAA 3AH2A 2LIQA 4ZA3B 4F34A 1AFCA 1V6UA 2YUGA 1JT5A 1TFMB 4ZFWB 3AZWA 3UJ0A 3FJHA 3FJCA 4OEEA 5G00A 1MC9A 2KH2A 4I3NA 3CA5A 5HPZA 4LO1A 1VCLA 4AN6A 3V0AA 2VXRA 4LO2A 3N7MA 7I1BA 3FUOA 5FNWA 3T8SA 4ZFUB 1BFGA 4KBBA 3P6IA 3S8KA 4FVVA 5BXTA 3AJ6A 4QKSA 4LO3C 2GO2A 3CA4A 2ZQNA 3BX1C 4II0A 5FZZA 3BAQA 4USPA 3W9TA 4P0LA 3BAGA 4R6UB 4JP0A 3UJ4A 4KEJA 2ZR1B 3UD7A 1JQZA 3FJBA 3HOMA 1PC8B 3I2XA 3ILAA 4IZEA 3ZX7A 4DENA 3NJ5A 5BOWA 3IM7A 4ZGRB 1FN0A 4IONA 1M16A 3WO3A 3R4UA 4TLPA 1PZZA 1TWEA 2BEAA 1JLXA 5I1BA 1XHBA 2QYIB 1HCDA 1V6XA 1NZKA 3N7LA 2Y9GA 2F2FA 1ISWA 5FNXA 4ZKTB 3BRDA 4JQ0A 1V6VA 1YYNA 2VU9A 1Z4SA 1RMLA 5EG6C 1DZCA 4I4RA 4QC4A 2GZBA 2ZQOA 2VLCA 1FV2A 4F83A 3BADA 3OBRA 4X39A 1PUUB 4EFPA 2F8XC 2AAIB 1BLAA 3A23A 1I1EA 2IWTB 4IY8A 5BQUA 4JRAA 1BFCA 3AZVA 4LO0A 4YOLA 3B9UA 3I2AA 1GGPB 3V0AB 5FZYA 4OEFA 3HBWA 1TWMA 4IY9A 4EB2B 1JY0A 4L4HA 1S0CA 1HWPB 3BRGC 5BXPA 1L2HA 3BAHA 2LIEA 2Z49A 3FUQA 3V79C 3LTQA 4I1BA 1BFFA 3VUOA 1N4KA 2RQ9A 1S0GA 5JLVA 3CA3A 3H6QA 4GP0A 4EKXB 1QQKA 3WMUA 3LLPA 5GAQA 4Q9GA 2D43A 2ET2A 2R9KB 3I29B 4I37A 4KC3A 3MALA 1JTCA 1Q04A 1IRAX 4I0YA 3RTIB 3VWCA 1EYLA 4Q9PA 1UPSA 3OJ2A 2P23A 2X2TA 1FGAA 1F31A 1WD4A 1AVWB 4I6IA 2I1BA 4KEIA 3Q7YA 3FFZA 3WINC 3V0BA 1K5UA 1EPWA 4OUJA 3FJDA 3AH4A 1Q1UA 1G82A 1R8OA 2E4MA 1BASA 5FZUA 2ERMA 2WRYA 4FGFA 2K4AB 3RSJA 4GP3A 5EHAA 1SR4C 4P0KA 8I1BA 1SZ6B 3O4OA 1D0HA 1K5VA 1Z0HA 3F1RA 1PWAA 4JKXB 1G9DA 3FJEA 41BIA 3S8JA 1KNMA 1A8DA 3QYDA 3VSZA 1QXMA 3O49A 3BAOA 1DQGA 4D0TA 2MIBA 1Z2VA 5E24E 3QR5A 4DEPA 1V6WA 2UUSA 4IZXA 1BA7A 1DLLA 2AXMA 4JKQA 4QD2B 3OGFA 3NBEA 3VT1A 3N0KA 4GOVA 1IRPA 3H6RA 5BXSA 3P6JA 1TOOA 31BIA 3K1XA 1YF8B 4G6JA 3BA7A 1S0FA 4IYBA 2D44A 1BFBA 1WBCA 2MLLB 2KKIA 1J0SA 3MPPG 3BAUA 2NM1A 1TTUA 2NVHA 4LO3A 1P63A 4A7ZA 3SNVA 3JRRA 3PUBA 2D7RA 4ISQA 3UD8A 1G9CA 5B2HA 4GAIA 4ZFYB 1S0DA 3HN1A 2NTDA 5F8WA 1S0BA 3CAHA 1R8NA 3FJAA 1ILR1 2M49A 4X37A 4I1EA 4QD2C 1II4A 2KLLA 3F62B 1E0OA 3R4SA 1AVXB 3H6SE 3E8LC 3FJ9A 5BVPI 2NP0A 5D61A 2D22A 4H04A 2XOAA 4I4VA 1CE7B 5D63A 3ZC8A 3O44A 4HR6C 4Z8SB 4EEEB 3O4CA 4ZBVB 9ILBA 1HWNB 3IIRA 3POKA 1EV2A 4D0ZA 3CRHA 2D1ZA 2Y9WC 2FO1A 1ISYA 2P39A 4X38A 3JUTA 1XZZA 5DSSB 4LO7B 4XFSA 2ESUA 2Y9FA 5DVHA 5BP5A 3O3QA 1XG6A 1ISXA 2Q9XA 4J2SA 4A7KA 4G6MA 3NBDA 3PHZA 3BTAA 1IT0A 5F8SA 1WD3A 2KI6B 4DCKC 3A21A 4CJMA 2FGFA 4QBVA 3FJIA 1BLDA 4A7YA 3CQAA 4XFUA 4LO1C 1TP0A 3D7WB 3HSMA 2RSTA 4LO2C 3BAVA 3FJFA 3TC2A 1DFCA 2BFHA 1AVUA 1YBIA 2VSAA 4I7IA 1FMZA 3UDAA 3RTJB 3FJKA 1ISZA 1ITBA 4Z9WB 2D24A 3AJ5A 3AH1A 4OWJA 5JMCA 4H9WA 3NBNA 3AKHA 3N7JA 4LO7C 2VXTI 4KEKA 1JT4A 4XKIA 3CA0A 3EF2A 5DUYA 1RY7A 2WBCA 3Q7WA 1S0EA 3AKFA 4OWLA 1IOBA 3VEQA 4JAWA 2MC2A 4Q91A 1QQLA 2Z48A 4OW4A 3WINA 5D62A 1ABRB 2HWAA 1RZOB 1IJTA 3ZC9A 4J2XA 3WA1A 3FJJA 3P53A 3BA4A 3FJ8A 3N7KA 3CU1B 1NUNA 2Y9XE 4G9MA 4I4PA 2F2FC 4QBCA 5F90A 2BEBA 3FGMA 1SR4A 1W3GA 2K43A 4J2KA 2NZ9A 4J23B 3KMVA 4EFRA 4L4IA 1IHKA 3O4DA 4P6AA 3OJVA 3CRGA 3WMVA 3A22A 3C9ZA 3NBCA 1PUMB 1IILA 1Q03A
chains in the Genus database with same CATH superfamily
2D7IA 4USOA 21BIA 3V0BB 5BQUC 1W3AA 4LO0C 2AFGA 5BXRA 4HA2A 3OJMA 4I2SA 2Q3NB 1S0LA 4JPZA 1DQOA 3CA6A 3CA1A 1DJSB 3RMYA 1M2TB 4ZOTA 1I1BA 3IM5A 1W3FA 1JT7A 1HCEA 1AVAC 2KI4A 4I4YA 4G9NA 4I4OA 4I4QA 2IHOA 4LO8B 4ZLBB 2L5XA 1YTOA 6I1BA 1FV3A 1FWUA 3UD9A 1DFQA 4HJJA 4WBCA 1G9AA 1HWOB 5BP5C 4IQPA 3BB2A 4XFTA 3IAGC 1ONKB 1T9FA 2J3PA 3WO4A 2K8RA 1XYFA 3BRFA 1AXMA 2HZ9A 4H75A 1AF9A 2FDBM 1FWVA 2FFUA 3Q7XA 4D8HA 4X3AA 1CVSA 3BA5A 2D23A 4IHZA 4I96A 3VT0A 2AQZA 5EC5A 3WO2A 4EFQA 1MD6A 3ZXDA 3CRIA 1FMMS 2E4MC 4QO3A 1EVTA 1WBAA 4I4SA 4ENDA 2HWMA 2X2SA 4OWKA 3HALA 1JT3A 3OGGA 4QALA 1FQ9A 3H6RB 4AN7B 1G9BA 4UY4A 1HIBA 5DZUA 3AKIA 4ISRA 3PG0A 2RG9B 1RG8A 2D20A 2DRYA 2DS0A 1HKNA 3VT2A 5F8YA 4GOYA 3O4BA 3OBTA 1DIWA 3ZXGA 4I8MA 3VSFA 1DZDA 3HMYA 2DREA 2FFVA 2HW9A 2NYYA 2VSEA 3O5WB 4OEGA 4GAFA 1ISVA 3RMXA 3O4AA 4I4XA 3A07A 3AKGA 3IM6A 4I4UA 1T4QA 1TIEA 2QN4A 1OQLB 1BARA 2DRZA 4PC4A 4J2YA 1JLYA 1YXWA 4P0JA 1HWMB 3PMEA 4G1RA 4QKRA 2VUAA 3AH2A 2LIQA 4ZA3B 4F34A 1AFCA 1V6UA 2YUGA 1JT5A 1TFMB 4ZFWB 3AZWA 3UJ0A 3FJHA 3FJCA 4OEEA 5G00A 1MC9A 2KH2A 4I3NA 3CA5A 5HPZA 4LO1A 1VCLA 4AN6A 3V0AA 2VXRA 4LO2A 3N7MA 7I1BA 3FUOA 5FNWA 3T8SA 4ZFUB 1BFGA 4KBBA 3P6IA 3S8KA 4FVVA 5BXTA 3AJ6A 4QKSA 4LO3C 2GO2A 3CA4A 2ZQNA 3BX1C 4II0A 5FZZA 3BAQA 4USPA 3W9TA 4P0LA 3BAGA 4R6UB 4JP0A 3UJ4A 4KEJA 2ZR1B 3UD7A 1JQZA 3FJBA 3HOMA 1PC8B 3I2XA 3ILAA 4IZEA 3ZX7A 4DENA 3NJ5A 5BOWA 3IM7A 4ZGRB 1FN0A 4IONA 1M16A 3WO3A 3R4UA 4TLPA 1PZZA 1TWEA 2BEAA 1JLXA 5I1BA 1XHBA 2QYIB 1HCDA 1V6XA 1NZKA 3N7LA 2Y9GA 2F2FA 1ISWA 5FNXA 4ZKTB 3BRDA 4JQ0A 1V6VA 1YYNA 2VU9A 1Z4SA 1RMLA 5EG6C 1DZCA 4I4RA 4QC4A 2GZBA 2ZQOA 2VLCA 1FV2A 4F83A 3BADA 3OBRA 4X39A 1PUUB 4EFPA 2F8XC 2AAIB 1BLAA 3A23A 1I1EA 2IWTB 2NS2A 4IY8A 5BQUA 4JRAA 1BFCA 3AZVA 4LO0A 4YOLA 3B9UA 3I2AA 1GGPB 3V0AB 5FZYA 4OEFA 3HBWA 1TWMA 4IY9A 4EB2B 1JY0A 4L4HA 1S0CA 1HWPB 3BRGC 5BXPA 1L2HA 3BAHA 2LIEA 2Z49A 3FUQA 3V79C 3LTQA 4I1BA 1BFFA 3VUOA 1N4KA 2RQ9A 1S0GA 5JLVA 3CA3A 3H6QA 4GP0A 4EKXB 1QQKA 3WMUA 3LLPA 5GAQA 4Q9GA 2D43A 2ET2A 2R9KB 3I29B 4I37A 4KC3A 3MALA 1JTCA 1Q04A 1IRAX 4I0YA 3RTIB 3VWCA 1EYLA 4Q9PA 1UPSA 3OJ2A 2P23A 2X2TA 1FGAA 1F31A 1WD4A 1AVWB 4I6IA 2I1BA 4KEIA 3Q7YA 3FFZA 3WINC 3V0BA 1K5UA 1EPWA 4OUJA 3FJDA 3AH4A 1Q1UA 1G82A 1R8OA 2E4MA 1BASA 5FZUA 2ERMA 2WRYA 4FGFA 2K4AB 3RSJA 4GP3A 5EHAA 1SR4C 4P0KA 4MZFB 8I1BA 1SZ6B 3O4OA 1D0HA 1K5VA 1Z0HA 3F1RA 1PWAA 4JKXB 1G9DA 3FJEA 41BIA 3S8JA 1KNMA 1A8DA 3QYDA 3VSZA 1QXMA 3O49A 3BAOA 1DQGA 4D0TA 2MIBA 1Z2VA 5E24E 3QR5A 4DEPA 1V6WA 2UUSA 4IZXA 1BA7A 1DLLA 2AXMA 4JKQA 4QD2B 3OGFA 3NBEA 3VT1A 3N0KA 4GOVA 1IRPA 3H6RA 5BXSA 3P6JA 1TOOA 31BIA 3K1XA 1YF8B 4G6JA 3BA7A 1S0FA 4IYBA 2D44A 1BFBA 1WBCA 2MLLB 2KKIA 1J0SA 3MPPG 3BAUA 2NM1A 1TTUA 2NVHA 4LO3A 1P63A 4A7ZA 3SNVA 3JRRA 3PUBA 2D7RA 4ISQA 3UD8A 1G9CA 5B2HA 4GAIA 4ZFYB 1S0DA 3HN1A 2NTDA 5F8WA 4MZGB 1S0BA 3CAHA 1R8NA 3FJAA 1ILR1 2M49A 4X37A 4I1EA 4QD2C 1II4A 2KLLA 3F62B 1E0OA 3R4SA 1AVXB 3H6SE 3E8LC 3FJ9A 5BVPI 2NP0A 5D61A 2D22A 4H04A 2XOAA 4I4VA 1CE7B 5D63A 3ZC8A 3O44A 4HR6C 4Z8SB 4EEEB 3O4CA 4ZBVB 9ILBA 1HWNB 3IIRA 3POKA 1EV2A 4D0ZA 3CRHA 2D1ZA 2Y9WC 2FO1A 1ISYA 2P39A 4X38A 3JUTA 1XZZA 5DSSB 4LO7B 4XFSA 2ESUA 2Y9FA 5DVHA 5BP5A 3O3QA 1XG6A 1ISXA 2Q9XA 4J2SA 4A7KA 4G6MA 3NBDA 3PHZA 3BTAA 1IT0A 5F8SA 1WD3A 2KI6B 4DCKC 3A21A 4CJMA 2FGFA 4QBVA 3FJIA 1BLDA 4A7YA 3CQAA 4XFUA 4LO1C 1TP0A 3D7WB 3HSMA 2RSTA 4LO2C 3BAVA 3FJFA 3TC2A 1DFCA 2BFHA 1AVUA 1YBIA 2VSAA 4I7IA 1FMZA 3UDAA 3RTJB 3FJKA 1ISZA 1ITBA 4Z9WB 2D24A 3AJ5A 3AH1A 4OWJA 5JMCA 4H9WA 3NBNA 3AKHA 3N7JA 4LO7C 2VXTI 4KEKA 1JT4A 4XKIA 3CA0A 3EF2A 5DUYA 1RY7A 2WBCA 3Q7WA 1S0EA 3AKFA 4OWLA 1IOBA 3VEQA 4JAWA 2MC2A 4Q91A 1QQLA 2Z48A 4OW4A 3WINA 5D62A 1ABRB 2HWAA 1RZOB 1IJTA 3ZC9A 4J2XA 3WA1A 3FJJA 3P53A 3BA4A 3FJ8A 3N7KA 3CU1B 1NUNA 2Y9XE 4G9MA 4I4PA 2F2FC 4QBCA 5F90A 2BEBA 3FGMA 1SR4A 1W3GA 2K43A 4J2KA 2NZ9A 4J23B 3KMVA 4EFRA 4L4IA 1IHKA 3O4DA 4P6AA 3OJVA 3CRGA 3WMVA 4MZHA 3A22A 3C9ZA 3NBCA 1PUMB 1IILA 1Q03A
chains in the Genus database with same CATH topology
2D7IA 4USOA 21BIA 3V0BB 5BQUC 1W3AA 4LO0C 2AFGA 5BXRA 4HA2A 3OJMA 4I2SA 2Q3NB 1S0LA 4JPZA 1DQOA 3CA6A 3CA1A 1DJSB 3RMYA 1M2TB 4ZOTA 1I1BA 3IM5A 1W3FA 1JT7A 1HCEA 1AVAC 2KI4A 4I4YA 4G9NA 4I4OA 4I4QA 2IHOA 4LO8B 4ZLBB 2L5XA 1YTOA 6I1BA 1FV3A 1FWUA 3UD9A 1DFQA 4HJJA 4WBCA 1G9AA 1HWOB 5BP5C 4IQPA 3BB2A 4XFTA 3IAGC 1ONKB 1T9FA 2J3PA 3WO4A 2K8RA 1XYFA 3BRFA 1AXMA 2HZ9A 4H75A 1AF9A 2FDBM 1FWVA 2FFUA 3Q7XA 4D8HA 4X3AA 1CVSA 3BA5A 2D23A 4IHZA 4I96A 3VT0A 2AQZA 5EC5A 3WO2A 4EFQA 1MD6A 3ZXDA 3CRIA 1FMMS 2E4MC 4QO3A 1EVTA 1WBAA 4I4SA 4ENDA 2HWMA 2X2SA 4OWKA 3HALA 1JT3A 3OGGA 4QALA 1FQ9A 3H6RB 4AN7B 1G9BA 4UY4A 1HIBA 5DZUA 3AKIA 4ISRA 3PG0A 2RG9B 1RG8A 2D20A 2DRYA 2DS0A 1HKNA 3VT2A 5F8YA 4GOYA 3O4BA 3OBTA 1DIWA 3ZXGA 4I8MA 3VSFA 1DZDA 3HMYA 2DREA 2FFVA 2HW9A 2NYYA 2VSEA 3O5WB 4OEGA 4GAFA 1ISVA 3RMXA 3O4AA 4I4XA 3A07A 3AKGA 3IM6A 4I4UA 1T4QA 1TIEA 2QN4A 1OQLB 1BARA 2DRZA 4PC4A 4J2YA 1JLYA 1YXWA 4P0JA 1HWMB 3PMEA 4G1RA 4QKRA 2VUAA 3AH2A 2LIQA 4ZA3B 4F34A 1AFCA 1V6UA 2YUGA 1JT5A 1TFMB 4ZFWB 3AZWA 3UJ0A 3FJHA 3FJCA 4OEEA 5G00A 1MC9A 2KH2A 4I3NA 3CA5A 5HPZA 4LO1A 1VCLA 4AN6A 3V0AA 2VXRA 4LO2A 3N7MA 7I1BA 3FUOA 5FNWA 3T8SA 4ZFUB 1BFGA 4KBBA 3P6IA 3S8KA 4FVVA 5BXTA 3AJ6A 4QKSA 4LO3C 2GO2A 3CA4A 2ZQNA 3BX1C 4II0A 5FZZA 3BAQA 4USPA 3W9TA 4P0LA 3BAGA 4R6UB 4JP0A 3UJ4A 4KEJA 2ZR1B 3UD7A 1JQZA 3FJBA 3HOMA 1PC8B 3I2XA 3ILAA 4IZEA 3ZX7A 4DENA 3NJ5A 5BOWA 3IM7A 4ZGRB 1FN0A 4IONA 1M16A 3WO3A 3R4UA 4TLPA 1PZZA 1TWEA 2BEAA 1JLXA 5I1BA 1XHBA 2QYIB 1HCDA 1V6XA 1NZKA 3N7LA 2Y9GA 2F2FA 1ISWA 5FNXA 4ZKTB 3BRDA 4JQ0A 1V6VA 1YYNA 2VU9A 1Z4SA 1RMLA 5EG6C 1DZCA 4I4RA 4QC4A 2GZBA 2ZQOA 2VLCA 1FV2A 4F83A 3BADA 3OBRA 4X39A 1PUUB 4EFPA 2F8XC 2AAIB 1BLAA 3A23A 1I1EA 2IWTB 2NS2A 4IY8A 5BQUA 4JRAA 1BFCA 3AZVA 4LO0A 4YOLA 3B9UA 3I2AA 1GGPB 3V0AB 5FZYA 4OEFA 3HBWA 1TWMA 4IY9A 4EB2B 1JY0A 4L4HA 1S0CA 1HWPB 3BRGC 5BXPA 1L2HA 3BAHA 2LIEA 2Z49A 3FUQA 3V79C 3LTQA 4I1BA 1BFFA 3VUOA 1N4KA 2RQ9A 1S0GA 5JLVA 3CA3A 3H6QA 4GP0A 4EKXB 1QQKA 3WMUA 3LLPA 5GAQA 4Q9GA 2D43A 2ET2A 2R9KB 3I29B 4I37A 4KC3A 3MALA 1JTCA 1Q04A 1IRAX 4I0YA 3RTIB 3VWCA 1EYLA 4Q9PA 1UPSA 3OJ2A 2P23A 2X2TA 1FGAA 1F31A 1WD4A 1AVWB 4I6IA 2I1BA 4KEIA 3Q7YA 3FFZA 3WINC 3V0BA 1K5UA 1EPWA 4OUJA 3FJDA 3AH4A 1Q1UA 1G82A 1R8OA 2E4MA 1BASA 5FZUA 2ERMA 2WRYA 4FGFA 2K4AB 3RSJA 4GP3A 5EHAA 1SR4C 4P0KA 4MZFB 8I1BA 1SZ6B 3O4OA 1D0HA 1K5VA 1Z0HA 3F1RA 1PWAA 4JKXB 1G9DA 3FJEA 41BIA 3S8JA 1KNMA 1A8DA 3QYDA 3VSZA 1QXMA 3O49A 3BAOA 1DQGA 4D0TA 2MIBA 1Z2VA 5E24E 3QR5A 4DEPA 1V6WA 2UUSA 4IZXA 1BA7A 1DLLA 2AXMA 4JKQA 4QD2B 3OGFA 3NBEA 3VT1A 3N0KA 4GOVA 1IRPA 3H6RA 5BXSA 3P6JA 1TOOA 31BIA 3K1XA 1YF8B 4G6JA 3BA7A 1S0FA 4IYBA 2D44A 1BFBA 1WBCA 2MLLB 2KKIA 1J0SA 3MPPG 3BAUA 2NM1A 1TTUA 2NVHA 4LO3A 1P63A 4A7ZA 3SNVA 3JRRA 3PUBA 2D7RA 4ISQA 3UD8A 1G9CA 5B2HA 4GAIA 4ZFYB 1S0DA 3HN1A 2NTDA 5F8WA 4MZGB 1S0BA 3CAHA 1R8NA 3FJAA 1ILR1 2M49A 4X37A 4I1EA 4QD2C 1II4A 2KLLA 3F62B 1E0OA 3R4SA 1AVXB 3H6SE 3E8LC 3FJ9A 5BVPI 2NP0A 5D61A 2D22A 4H04A 2XOAA 4I4VA 1CE7B 5D63A 3ZC8A 3O44A 4HR6C 4Z8SB 4EEEB 3O4CA 4ZBVB 9ILBA 1HWNB 3IIRA 3POKA 1EV2A 4D0ZA 3CRHA 2D1ZA 2Y9WC 2FO1A 1ISYA 2P39A 4X38A 3JUTA 1XZZA 5DSSB 4LO7B 4XFSA 2ESUA 2Y9FA 5DVHA 5BP5A 3O3QA 1XG6A 1ISXA 2Q9XA 4J2SA 4A7KA 4G6MA 3NBDA 3PHZA 3BTAA 1IT0A 5F8SA 1WD3A 2KI6B 4DCKC 3A21A 4CJMA 2FGFA 4QBVA 3FJIA 1BLDA 4A7YA 3CQAA 4XFUA 4LO1C 1TP0A 3D7WB 3HSMA 2RSTA 4LO2C 3BAVA 3FJFA 3TC2A 1DFCA 2BFHA 1AVUA 1YBIA 2VSAA 4I7IA 1FMZA 3UDAA 3RTJB 3FJKA 1ISZA 1ITBA 4Z9WB 2D24A 3AJ5A 3AH1A 4OWJA 5JMCA 4H9WA 3NBNA 3AKHA 3N7JA 4LO7C 2VXTI 4KEKA 1JT4A 4XKIA 3CA0A 3EF2A 5DUYA 1RY7A 2WBCA 3Q7WA 1S0EA 3AKFA 4OWLA 1IOBA 3VEQA 4JAWA 2MC2A 4Q91A 1QQLA 2Z48A 4OW4A 3WINA 5D62A 1ABRB 2HWAA 1RZOB 1IJTA 3ZC9A 4J2XA 3WA1A 3FJJA 3P53A 3BA4A 3FJ8A 3N7KA 3CU1B 1NUNA 2Y9XE 4G9MA 4I4PA 2F2FC 4QBCA 5F90A 2BEBA 3FGMA 1SR4A 1W3GA 2K43A 4J2KA 2NZ9A 4J23B 3KMVA 4EFRA 4L4IA 1IHKA 3O4DA 4P6AA 3OJVA 3CRGA 3WMVA 4MZHA 3A22A 3C9ZA 3NBCA 1PUMB 1IILA 1Q03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D7I A;  4USO A;  21BI A;  3V0B B;  5BQU C;  1W3A A;  4LO0 C;  2AFG A;  5BXR A;  4HA2 A;  3OJM A;  4I2S A;  2Q3N B;  1S0L A;  4JPZ A;  1DQO A;  3CA6 A;  3CA1 A;  1DJS B;  3RMY A;  1M2T B;  4ZOT A;  1I1B A;  3IM5 A;  1W3F A;  1JT7 A;  1HCE A;  1AVA C;  2KI4 A;  4I4Y A;  4G9N A;  4I4O A;  4I4Q A;  2IHO A;  4LO8 B;  4ZLB B;  2L5X A;  1YTO A;  6I1B A;  1FV3 A;  1FWU A;  3UD9 A;  1DFQ A;  4HJJ A;  4WBC A;  1G9A A;  1HWO B;  5BP5 C;  4IQP A;  3BB2 A;  4XFT A;  3IAG C;  1ONK B;  1T9F A;  2J3P A;  3WO4 A;  2K8R A;  1XYF A;  3BRF A;  1AXM A;  2HZ9 A;  1AF9 A;  2FDB M;  1FWV A;  2FFU A;  3Q7X A;  4D8H A;  4X3A A;  1CVS A;  3BA5 A;  2D23 A;  4IHZ A;  4I96 A;  3VT0 A;  2AQZ A;  5EC5 A;  3WO2 A;  4EFQ A;  1MD6 A;  3ZXD A;  3CRI A;  1FMM S;  2E4M C;  4QO3 A;  1EVT A;  1WBA A;  4I4S A;  4END A;  2HWM A;  2X2S A;  4OWK A;  3HAL A;  1JT3 A;  3OGG A;  4QAL A;  1FQ9 A;  3H6R B;  4AN7 B;  1G9B A;  1HIB A;  5DZU A;  3AKI A;  4ISR A;  3PG0 A;  2RG9 B;  1RG8 A;  2D20 A;  2DRY A;  2DS0 A;  1HKN A;  3VT2 A;  5F8Y A;  4GOY A;  3O4B A;  3OBT A;  1DIW A;  3ZXG A;  4I8M A;  3VSF A;  1DZD A;  3HMY A;  2DRE A;  2FFV A;  2HW9 A;  2NYY A;  2VSE A;  3O5W B;  4OEG A;  4GAF A;  1ISV A;  3RMX A;  3O4A A;  4I4X A;  3A07 A;  3AKG A;  3IM6 A;  4I4U A;  1T4Q A;  1TIE A;  2QN4 A;  1OQL B;  1BAR A;  2DRZ A;  4PC4 A;  4J2Y A;  1JLY A;  1YXW A;  4P0J A;  1HWM B;  3PME A;  4G1R A;  4QKR A;  2VUA A;  3AH2 A;  2LIQ A;  4ZA3 B;  4F34 A;  1AFC A;  1V6U A;  2YUG A;  1JT5 A;  1TFM B;  4ZFW B;  3AZW A;  3UJ0 A;  3FJH A;  3FJC A;  4OEE A;  5G00 A;  1MC9 A;  2KH2 A;  4I3N A;  3CA5 A;  5HPZ A;  4LO1 A;  1VCL A;  4AN6 A;  3V0A A;  2VXR A;  4LO2 A;  3N7M A;  7I1B A;  3FUO A;  5FNW A;  3T8S A;  4ZFU B;  1BFG A;  4KBB A;  3P6I A;  3S8K A;  4FVV A;  5BXT A;  3AJ6 A;  4QKS A;  4LO3 C;  2GO2 A;  3CA4 A;  2ZQN A;  3BX1 C;  4II0 A;  5FZZ A;  3BAQ A;  4USP A;  3W9T A;  4P0L A;  3BAG A;  4R6U B;  4JP0 A;  3UJ4 A;  4KEJ A;  2ZR1 B;  3UD7 A;  1JQZ A;  3FJB A;  3HOM A;  1PC8 B;  3I2X A;  3ILA A;  4IZE A;  3ZX7 A;  4DEN A;  3NJ5 A;  5BOW A;  3IM7 A;  4ZGR B;  1FN0 A;  4ION A;  1M16 A;  3WO3 A;  3R4U A;  4TLP A;  1PZZ A;  1TWE A;  2BEA A;  1JLX A;  5I1B A;  1XHB A;  2QYI B;  1HCD A;  1V6X A;  1NZK A;  3N7L A;  2Y9G A;  2F2F A;  1ISW A;  5FNX A;  4ZKT B;  3BRD A;  4JQ0 A;  1V6V A;  1YYN A;  2VU9 A;  1Z4S A;  1RML A;  5EG6 C;  1DZC A;  4I4R A;  4QC4 A;  2GZB A;  2ZQO A;  2VLC A;  1FV2 A;  4F83 A;  3BAD A;  3OBR A;  4X39 A;  1PUU B;  4EFP A;  2F8X C;  2AAI B;  1BLA A;  3A23 A;  1I1E A;  2IWT B;  4IY8 A;  5BQU A;  4JRA A;  1BFC A;  3AZV A;  4LO0 A;  4YOL A;  3B9U A;  3I2A A;  1GGP B;  3V0A B;  5FZY A;  4OEF A;  3HBW A;  1TWM A;  4IY9 A;  4EB2 B;  1JY0 A;  4L4H A;  1S0C A;  1HWP B;  3BRG C;  5BXP A;  1L2H A;  3BAH A;  2LIE A;  2Z49 A;  3FUQ A;  3V79 C;  3LTQ A;  4I1B A;  1BFF A;  3VUO A;  1N4K A;  2RQ9 A;  1S0G A;  5JLV A;  3CA3 A;  3H6Q A;  4GP0 A;  4EKX B;  1QQK A;  3WMU A;  3LLP A;  5GAQ A;  4Q9G A;  2D43 A;  2ET2 A;  2R9K B;  3I29 B;  4I37 A;  4KC3 A;  3MAL A;  1JTC A;  1Q04 A;  1IRA X;  4I0Y A;  3RTI B;  3VWC A;  1EYL A;  4Q9P A;  1UPS A;  3OJ2 A;  2P23 A;  2X2T A;  1FGA A;  1F31 A;  1WD4 A;  1AVW B;  4I6I A;  2I1B A;  4KEI A;  3Q7Y A;  3FFZ A;  3WIN C;  3V0B A;  1K5U A;  1EPW A;  4OUJ A;  3FJD A;  3AH4 A;  1Q1U A;  1G82 A;  1R8O A;  2E4M A;  1BAS A;  5FZU A;  2ERM A;  2WRY A;  4FGF A;  2K4A B;  3RSJ A;  4GP3 A;  5EHA A;  1SR4 C;  4P0K A;  8I1B A;  1SZ6 B;  3O4O A;  1D0H A;  1K5V A;  1Z0H A;  3F1R A;  1PWA A;  4JKX B;  1G9D A;  3FJE A;  41BI A;  3S8J A;  1KNM A;  1A8D A;  3QYD A;  3VSZ A;  1QXM A;  3O49 A;  3BAO A;  1DQG A;  4D0T A;  2MIB A;  1Z2V A;  5E24 E;  3QR5 A;  4DEP A;  1V6W A;  2UUS A;  4IZX A;  1BA7 A;  1DLL A;  2AXM A;  4JKQ A;  4QD2 B;  3OGF A;  3NBE A;  3VT1 A;  3N0K A;  4GOV A;  1IRP A;  3H6R A;  5BXS A;  3P6J A;  1TOO A;  31BI A;  3K1X A;  1YF8 B;  4G6J A;  3BA7 A;  1S0F A;  4IYB A;  2D44 A;  1BFB A;  1WBC A;  2MLL B;  2KKI A;  1J0S A;  3MPP G;  3BAU A;  2NM1 A;  1TTU A;  2NVH A;  4LO3 A;  1P63 A;  4A7Z A;  3SNV A;  3JRR A;  3PUB A;  2D7R A;  4ISQ A;  3UD8 A;  1G9C A;  5B2H A;  4GAI A;  4ZFY B;  1S0D A;  3HN1 A;  2NTD A;  5F8W A;  1S0B A;  3CAH A;  1R8N A;  3FJA A;  1ILR 1;  2M49 A;  4X37 A;  4I1E A;  4QD2 C;  1II4 A;  2KLL A;  3F62 B;  1E0O A;  3R4S A;  1AVX B;  3H6S E;  3E8L C;  3FJ9 A;  5BVP I;  2NP0 A;  5D61 A;  2D22 A;  4H04 A;  2XOA A;  4I4V A;  1CE7 B;  5D63 A;  3ZC8 A;  3O44 A;  4HR6 C;  4Z8S B;  4EEE B;  3O4C A;  4ZBV B;  9ILB A;  1HWN B;  3IIR A;  3POK A;  1EV2 A;  4D0Z A;  3CRH A;  2D1Z A;  2Y9W C;  2FO1 A;  1ISY A;  2P39 A;  4X38 A;  3JUT A;  1XZZ A;  5DSS B;  4LO7 B;  4XFS A;  2ESU A;  2Y9F A;  5DVH A;  5BP5 A;  3O3Q A;  1XG6 A;  1ISX A;  2Q9X A;  4J2S A;  4A7K A;  4G6M A;  3NBD A;  3PHZ A;  3BTA A;  1IT0 A;  5F8S A;  1WD3 A;  2KI6 B;  4DCK C;  3A21 A;  4CJM A;  2FGF A;  4QBV A;  3FJI A;  1BLD A;  4A7Y A;  3CQA A;  4XFU A;  4LO1 C;  1TP0 A;  3D7W B;  3HSM A;  2RST A;  4LO2 C;  3BAV A;  3FJF A;  3TC2 A;  1DFC A;  2BFH A;  1AVU A;  1YBI A;  2VSA A;  4I7I A;  1FMZ A;  3UDA A;  3RTJ B;  3FJK A;  1ISZ A;  1ITB A;  4Z9W B;  2D24 A;  3AJ5 A;  3AH1 A;  4OWJ A;  5JMC A;  4H9W A;  3NBN A;  3AKH A;  3N7J A;  4LO7 C;  2VXT I;  4KEK A;  1JT4 A;  4XKI A;  3CA0 A;  3EF2 A;  5DUY A;  1RY7 A;  2WBC A;  3Q7W A;  1S0E A;  3AKF A;  4OWL A;  1IOB A;  3VEQ A;  4JAW A;  2MC2 A;  4Q91 A;  1QQL A;  2Z48 A;  4OW4 A;  3WIN A;  5D62 A;  1ABR B;  2HWA A;  1RZO B;  1IJT A;  3ZC9 A;  4J2X A;  3WA1 A;  3FJJ A;  3P53 A;  3BA4 A;  3FJ8 A;  3N7K A;  3CU1 B;  1NUN A;  2Y9X E;  4G9M A;  4I4P A;  2F2F C;  4QBC A;  5F90 A;  2BEB A;  3FGM A;  1SR4 A;  1W3G A;  2K43 A;  4J2K A;  2NZ9 A;  4J23 B;  3KMV A;  4EFR A;  4L4I A;  1IHK A;  3O4D A;  4P6A A;  3OJV A;  3CRG A;  3WMV A;  3A22 A;  3C9Z A;  3NBC A;  1PUM B;  1IIL A;  1Q03 A; 
#chains in the Genus database with same CATH topology
 2D7I A;  4USO A;  21BI A;  3V0B B;  5BQU C;  1W3A A;  4LO0 C;  2AFG A;  5BXR A;  4HA2 A;  3OJM A;  4I2S A;  2Q3N B;  1S0L A;  4JPZ A;  1DQO A;  3CA6 A;  3CA1 A;  1DJS B;  3RMY A;  1M2T B;  4ZOT A;  1I1B A;  3IM5 A;  1W3F A;  1JT7 A;  1HCE A;  1AVA C;  2KI4 A;  4I4Y A;  4G9N A;  4I4O A;  4I4Q A;  2IHO A;  4LO8 B;  4ZLB B;  2L5X A;  1YTO A;  6I1B A;  1FV3 A;  1FWU A;  3UD9 A;  1DFQ A;  4HJJ A;  4WBC A;  1G9A A;  1HWO B;  5BP5 C;  4IQP A;  3BB2 A;  4XFT A;  3IAG C;  1ONK B;  1T9F A;  2J3P A;  3WO4 A;  2K8R A;  1XYF A;  3BRF A;  1AXM A;  2HZ9 A;  4H75 A;  1AF9 A;  2FDB M;  1FWV A;  2FFU A;  3Q7X A;  4D8H A;  4X3A A;  1CVS A;  3BA5 A;  2D23 A;  4IHZ A;  4I96 A;  3VT0 A;  2AQZ A;  5EC5 A;  3WO2 A;  4EFQ A;  1MD6 A;  3ZXD A;  3CRI A;  1FMM S;  2E4M C;  4QO3 A;  1EVT A;  1WBA A;  4I4S A;  4END A;  2HWM A;  2X2S A;  4OWK A;  3HAL A;  1JT3 A;  3OGG A;  4QAL A;  1FQ9 A;  3H6R B;  4AN7 B;  1G9B A;  4UY4 A;  1HIB A;  5DZU A;  3AKI A;  4ISR A;  3PG0 A;  2RG9 B;  1RG8 A;  2D20 A;  2DRY A;  2DS0 A;  1HKN A;  3VT2 A;  5F8Y A;  4GOY A;  3O4B A;  3OBT A;  1DIW A;  3ZXG A;  4I8M A;  3VSF A;  1DZD A;  3HMY A;  2DRE A;  2FFV A;  2HW9 A;  2NYY A;  2VSE A;  3O5W B;  4OEG A;  4GAF A;  1ISV A;  3RMX A;  3O4A A;  4I4X A;  3A07 A;  3AKG A;  3IM6 A;  4I4U A;  1T4Q A;  1TIE A;  2QN4 A;  1OQL B;  1BAR A;  2DRZ A;  4PC4 A;  4J2Y A;  1JLY A;  1YXW A;  4P0J A;  1HWM B;  3PME A;  4G1R A;  4QKR A;  2VUA A;  3AH2 A;  2LIQ A;  4ZA3 B;  4F34 A;  1AFC A;  1V6U A;  2YUG A;  1JT5 A;  1TFM B;  4ZFW B;  3AZW A;  3UJ0 A;  3FJH A;  3FJC A;  4OEE A;  5G00 A;  1MC9 A;  2KH2 A;  4I3N A;  3CA5 A;  5HPZ A;  4LO1 A;  1VCL A;  4AN6 A;  3V0A A;  2VXR A;  4LO2 A;  3N7M A;  7I1B A;  3FUO A;  5FNW A;  3T8S A;  4ZFU B;  1BFG A;  4KBB A;  3P6I A;  3S8K A;  4FVV A;  5BXT A;  3AJ6 A;  4QKS A;  4LO3 C;  2GO2 A;  3CA4 A;  2ZQN A;  3BX1 C;  4II0 A;  5FZZ A;  3BAQ A;  4USP A;  3W9T A;  4P0L A;  3BAG A;  4R6U B;  4JP0 A;  3UJ4 A;  4KEJ A;  2ZR1 B;  3UD7 A;  1JQZ A;  3FJB A;  3HOM A;  1PC8 B;  3I2X A;  3ILA A;  4IZE A;  3ZX7 A;  4DEN A;  3NJ5 A;  5BOW A;  3IM7 A;  4ZGR B;  1FN0 A;  4ION A;  1M16 A;  3WO3 A;  3R4U A;  4TLP A;  1PZZ A;  1TWE A;  2BEA A;  1JLX A;  5I1B A;  1XHB A;  2QYI B;  1HCD A;  1V6X A;  1NZK A;  3N7L A;  2Y9G A;  2F2F A;  1ISW A;  5FNX A;  4ZKT B;  3BRD A;  4JQ0 A;  1V6V A;  1YYN A;  2VU9 A;  1Z4S A;  1RML A;  5EG6 C;  1DZC A;  4I4R A;  4QC4 A;  2GZB A;  2ZQO A;  2VLC A;  1FV2 A;  4F83 A;  3BAD A;  3OBR A;  4X39 A;  1PUU B;  4EFP A;  2F8X C;  2AAI B;  1BLA A;  3A23 A;  1I1E A;  2IWT B;  2NS2 A;  4IY8 A;  5BQU A;  4JRA A;  1BFC A;  3AZV A;  4LO0 A;  4YOL A;  3B9U A;  3I2A A;  1GGP B;  3V0A B;  5FZY A;  4OEF A;  3HBW A;  1TWM A;  4IY9 A;  4EB2 B;  1JY0 A;  4L4H A;  1S0C A;  1HWP B;  3BRG C;  5BXP A;  1L2H A;  3BAH A;  2LIE A;  2Z49 A;  3FUQ A;  3V79 C;  3LTQ A;  4I1B A;  1BFF A;  3VUO A;  1N4K A;  2RQ9 A;  1S0G A;  5JLV A;  3CA3 A;  3H6Q A;  4GP0 A;  4EKX B;  1QQK A;  3WMU A;  3LLP A;  5GAQ A;  4Q9G A;  2D43 A;  2ET2 A;  2R9K B;  3I29 B;  4I37 A;  4KC3 A;  3MAL A;  1JTC A;  1Q04 A;  1IRA X;  4I0Y A;  3RTI B;  3VWC A;  1EYL A;  4Q9P A;  1UPS A;  3OJ2 A;  2P23 A;  2X2T A;  1FGA A;  1F31 A;  1WD4 A;  1AVW B;  4I6I A;  2I1B A;  4KEI A;  3Q7Y A;  3FFZ A;  3WIN C;  3V0B A;  1K5U A;  1EPW A;  4OUJ A;  3FJD A;  3AH4 A;  1Q1U A;  1G82 A;  1R8O A;  2E4M A;  1BAS A;  5FZU A;  2ERM A;  2WRY A;  4FGF A;  2K4A B;  3RSJ A;  4GP3 A;  5EHA A;  1SR4 C;  4P0K A;  4MZF B;  8I1B A;  1SZ6 B;  3O4O A;  1D0H A;  1K5V A;  1Z0H A;  3F1R A;  1PWA A;  4JKX B;  1G9D A;  3FJE A;  41BI A;  3S8J A;  1KNM A;  1A8D A;  3QYD A;  3VSZ A;  1QXM A;  3O49 A;  3BAO A;  1DQG A;  4D0T A;  2MIB A;  1Z2V A;  5E24 E;  3QR5 A;  4DEP A;  1V6W A;  2UUS A;  4IZX A;  1BA7 A;  1DLL A;  2AXM A;  4JKQ A;  4QD2 B;  3OGF A;  3NBE A;  3VT1 A;  3N0K A;  4GOV A;  1IRP A;  3H6R A;  5BXS A;  3P6J A;  1TOO A;  31BI A;  3K1X A;  1YF8 B;  4G6J A;  3BA7 A;  1S0F A;  4IYB A;  2D44 A;  1BFB A;  1WBC A;  2MLL B;  2KKI A;  1J0S A;  3MPP G;  3BAU A;  2NM1 A;  1TTU A;  2NVH A;  4LO3 A;  1P63 A;  4A7Z A;  3SNV A;  3JRR A;  3PUB A;  2D7R A;  4ISQ A;  3UD8 A;  1G9C A;  5B2H A;  4GAI A;  4ZFY B;  1S0D A;  3HN1 A;  2NTD A;  5F8W A;  4MZG B;  1S0B A;  3CAH A;  1R8N A;  3FJA A;  1ILR 1;  2M49 A;  4X37 A;  4I1E A;  4QD2 C;  1II4 A;  2KLL A;  3F62 B;  1E0O A;  3R4S A;  1AVX B;  3H6S E;  3E8L C;  3FJ9 A;  5BVP I;  2NP0 A;  5D61 A;  2D22 A;  4H04 A;  2XOA A;  4I4V A;  1CE7 B;  5D63 A;  3ZC8 A;  3O44 A;  4HR6 C;  4Z8S B;  4EEE B;  3O4C A;  4ZBV B;  9ILB A;  1HWN B;  3IIR A;  3POK A;  1EV2 A;  4D0Z A;  3CRH A;  2D1Z A;  2Y9W C;  2FO1 A;  1ISY A;  2P39 A;  4X38 A;  3JUT A;  1XZZ A;  5DSS B;  4LO7 B;  4XFS A;  2ESU A;  2Y9F A;  5DVH A;  5BP5 A;  3O3Q A;  1XG6 A;  1ISX A;  2Q9X A;  4J2S A;  4A7K A;  4G6M A;  3NBD A;  3PHZ A;  3BTA A;  1IT0 A;  5F8S A;  1WD3 A;  2KI6 B;  4DCK C;  3A21 A;  4CJM A;  2FGF A;  4QBV A;  3FJI A;  1BLD A;  4A7Y A;  3CQA A;  4XFU A;  4LO1 C;  1TP0 A;  3D7W B;  3HSM A;  2RST A;  4LO2 C;  3BAV A;  3FJF A;  3TC2 A;  1DFC A;  2BFH A;  1AVU A;  1YBI A;  2VSA A;  4I7I A;  1FMZ A;  3UDA A;  3RTJ B;  3FJK A;  1ISZ A;  1ITB A;  4Z9W B;  2D24 A;  3AJ5 A;  3AH1 A;  4OWJ A;  5JMC A;  4H9W A;  3NBN A;  3AKH A;  3N7J A;  4LO7 C;  2VXT I;  4KEK A;  1JT4 A;  4XKI A;  3CA0 A;  3EF2 A;  5DUY A;  1RY7 A;  2WBC A;  3Q7W A;  1S0E A;  3AKF A;  4OWL A;  1IOB A;  3VEQ A;  4JAW A;  2MC2 A;  4Q91 A;  1QQL A;  2Z48 A;  4OW4 A;  3WIN A;  5D62 A;  1ABR B;  2HWA A;  1RZO B;  1IJT A;  3ZC9 A;  4J2X A;  3WA1 A;  3FJJ A;  3P53 A;  3BA4 A;  3FJ8 A;  3N7K A;  3CU1 B;  1NUN A;  2Y9X E;  4G9M A;  4I4P A;  2F2F C;  4QBC A;  5F90 A;  2BEB A;  3FGM A;  1SR4 A;  1W3G A;  2K43 A;  4J2K A;  2NZ9 A;  4J23 B;  3KMV A;  4EFR A;  4L4I A;  1IHK A;  3O4D A;  4P6A A;  3OJV A;  3CRG A;  3WMV A;  4MZH A;  3A22 A;  3C9Z A;  3NBC A;  1PUM B;  1IIL A;  1Q03 A; 
#chains in the Genus database with same CATH homology
 2D7I A;  4USO A;  21BI A;  3V0B B;  5BQU C;  1W3A A;  4LO0 C;  2AFG A;  5BXR A;  4HA2 A;  3OJM A;  4I2S A;  2Q3N B;  1S0L A;  4JPZ A;  1DQO A;  3CA6 A;  3CA1 A;  1DJS B;  3RMY A;  1M2T B;  4ZOT A;  1I1B A;  3IM5 A;  1W3F A;  1JT7 A;  1HCE A;  1AVA C;  2KI4 A;  4I4Y A;  4G9N A;  4I4O A;  4I4Q A;  2IHO A;  4LO8 B;  4ZLB B;  2L5X A;  1YTO A;  6I1B A;  1FV3 A;  1FWU A;  3UD9 A;  1DFQ A;  4HJJ A;  4WBC A;  1G9A A;  1HWO B;  5BP5 C;  4IQP A;  3BB2 A;  4XFT A;  3IAG C;  1ONK B;  1T9F A;  2J3P A;  3WO4 A;  2K8R A;  1XYF A;  3BRF A;  1AXM A;  2HZ9 A;  4H75 A;  1AF9 A;  2FDB M;  1FWV A;  2FFU A;  3Q7X A;  4D8H A;  4X3A A;  1CVS A;  3BA5 A;  2D23 A;  4IHZ A;  4I96 A;  3VT0 A;  2AQZ A;  5EC5 A;  3WO2 A;  4EFQ A;  1MD6 A;  3ZXD A;  3CRI A;  1FMM S;  2E4M C;  4QO3 A;  1EVT A;  1WBA A;  4I4S A;  4END A;  2HWM A;  2X2S A;  4OWK A;  3HAL A;  1JT3 A;  3OGG A;  4QAL A;  1FQ9 A;  3H6R B;  4AN7 B;  1G9B A;  4UY4 A;  1HIB A;  5DZU A;  3AKI A;  4ISR A;  3PG0 A;  2RG9 B;  1RG8 A;  2D20 A;  2DRY A;  2DS0 A;  1HKN A;  3VT2 A;  5F8Y A;  4GOY A;  3O4B A;  3OBT A;  1DIW A;  3ZXG A;  4I8M A;  3VSF A;  1DZD A;  3HMY A;  2DRE A;  2FFV A;  2HW9 A;  2NYY A;  2VSE A;  3O5W B;  4OEG A;  4GAF A;  1ISV A;  3RMX A;  3O4A A;  4I4X A;  3A07 A;  3AKG A;  3IM6 A;  4I4U A;  1T4Q A;  1TIE A;  2QN4 A;  1OQL B;  1BAR A;  2DRZ A;  4PC4 A;  4J2Y A;  1JLY A;  1YXW A;  4P0J A;  1HWM B;  3PME A;  4G1R A;  4QKR A;  2VUA A;  3AH2 A;  2LIQ A;  4ZA3 B;  4F34 A;  1AFC A;  1V6U A;  2YUG A;  1JT5 A;  1TFM B;  4ZFW B;  3AZW A;  3UJ0 A;  3FJH A;  3FJC A;  4OEE A;  5G00 A;  1MC9 A;  2KH2 A;  4I3N A;  3CA5 A;  5HPZ A;  4LO1 A;  1VCL A;  4AN6 A;  3V0A A;  2VXR A;  4LO2 A;  3N7M A;  7I1B A;  3FUO A;  5FNW A;  3T8S A;  4ZFU B;  1BFG A;  4KBB A;  3P6I A;  3S8K A;  4FVV A;  5BXT A;  3AJ6 A;  4QKS A;  4LO3 C;  2GO2 A;  3CA4 A;  2ZQN A;  3BX1 C;  4II0 A;  5FZZ A;  3BAQ A;  4USP A;  3W9T A;  4P0L A;  3BAG A;  4R6U B;  4JP0 A;  3UJ4 A;  4KEJ A;  2ZR1 B;  3UD7 A;  1JQZ A;  3FJB A;  3HOM A;  1PC8 B;  3I2X A;  3ILA A;  4IZE A;  3ZX7 A;  4DEN A;  3NJ5 A;  5BOW A;  3IM7 A;  4ZGR B;  1FN0 A;  4ION A;  1M16 A;  3WO3 A;  3R4U A;  4TLP A;  1PZZ A;  1TWE A;  2BEA A;  1JLX A;  5I1B A;  1XHB A;  2QYI B;  1HCD A;  1V6X A;  1NZK A;  3N7L A;  2Y9G A;  2F2F A;  1ISW A;  5FNX A;  4ZKT B;  3BRD A;  4JQ0 A;  1V6V A;  1YYN A;  2VU9 A;  1Z4S A;  1RML A;  5EG6 C;  1DZC A;  4I4R A;  4QC4 A;  2GZB A;  2ZQO A;  2VLC A;  1FV2 A;  4F83 A;  3BAD A;  3OBR A;  4X39 A;  1PUU B;  4EFP A;  2F8X C;  2AAI B;  1BLA A;  3A23 A;  1I1E A;  2IWT B;  2NS2 A;  4IY8 A;  5BQU A;  4JRA A;  1BFC A;  3AZV A;  4LO0 A;  4YOL A;  3B9U A;  3I2A A;  1GGP B;  3V0A B;  5FZY A;  4OEF A;  3HBW A;  1TWM A;  4IY9 A;  4EB2 B;  1JY0 A;  4L4H A;  1S0C A;  1HWP B;  3BRG C;  5BXP A;  1L2H A;  3BAH A;  2LIE A;  2Z49 A;  3FUQ A;  3V79 C;  3LTQ A;  4I1B A;  1BFF A;  3VUO A;  1N4K A;  2RQ9 A;  1S0G A;  5JLV A;  3CA3 A;  3H6Q A;  4GP0 A;  4EKX B;  1QQK A;  3WMU A;  3LLP A;  5GAQ A;  4Q9G A;  2D43 A;  2ET2 A;  2R9K B;  3I29 B;  4I37 A;  4KC3 A;  3MAL A;  1JTC A;  1Q04 A;  1IRA X;  4I0Y A;  3RTI B;  3VWC A;  1EYL A;  4Q9P A;  1UPS A;  3OJ2 A;  2P23 A;  2X2T A;  1FGA A;  1F31 A;  1WD4 A;  1AVW B;  4I6I A;  2I1B A;  4KEI A;  3Q7Y A;  3FFZ A;  3WIN C;  3V0B A;  1K5U A;  1EPW A;  4OUJ A;  3FJD A;  3AH4 A;  1Q1U A;  1G82 A;  1R8O A;  2E4M A;  1BAS A;  5FZU A;  2ERM A;  2WRY A;  4FGF A;  2K4A B;  3RSJ A;  4GP3 A;  5EHA A;  1SR4 C;  4P0K A;  4MZF B;  8I1B A;  1SZ6 B;  3O4O A;  1D0H A;  1K5V A;  1Z0H A;  3F1R A;  1PWA A;  4JKX B;  1G9D A;  3FJE A;  41BI A;  3S8J A;  1KNM A;  1A8D A;  3QYD A;  3VSZ A;  1QXM A;  3O49 A;  3BAO A;  1DQG A;  4D0T A;  2MIB A;  1Z2V A;  5E24 E;  3QR5 A;  4DEP A;  1V6W A;  2UUS A;  4IZX A;  1BA7 A;  1DLL A;  2AXM A;  4JKQ A;  4QD2 B;  3OGF A;  3NBE A;  3VT1 A;  3N0K A;  4GOV A;  1IRP A;  3H6R A;  5BXS A;  3P6J A;  1TOO A;  31BI A;  3K1X A;  1YF8 B;  4G6J A;  3BA7 A;  1S0F A;  4IYB A;  2D44 A;  1BFB A;  1WBC A;  2MLL B;  2KKI A;  1J0S A;  3MPP G;  3BAU A;  2NM1 A;  1TTU A;  2NVH A;  4LO3 A;  1P63 A;  4A7Z A;  3SNV A;  3JRR A;  3PUB A;  2D7R A;  4ISQ A;  3UD8 A;  1G9C A;  5B2H A;  4GAI A;  4ZFY B;  1S0D A;  3HN1 A;  2NTD A;  5F8W A;  4MZG B;  1S0B A;  3CAH A;  1R8N A;  3FJA A;  1ILR 1;  2M49 A;  4X37 A;  4I1E A;  4QD2 C;  1II4 A;  2KLL A;  3F62 B;  1E0O A;  3R4S A;  1AVX B;  3H6S E;  3E8L C;  3FJ9 A;  5BVP I;  2NP0 A;  5D61 A;  2D22 A;  4H04 A;  2XOA A;  4I4V A;  1CE7 B;  5D63 A;  3ZC8 A;  3O44 A;  4HR6 C;  4Z8S B;  4EEE B;  3O4C A;  4ZBV B;  9ILB A;  1HWN B;  3IIR A;  3POK A;  1EV2 A;  4D0Z A;  3CRH A;  2D1Z A;  2Y9W C;  2FO1 A;  1ISY A;  2P39 A;  4X38 A;  3JUT A;  1XZZ A;  5DSS B;  4LO7 B;  4XFS A;  2ESU A;  2Y9F A;  5DVH A;  5BP5 A;  3O3Q A;  1XG6 A;  1ISX A;  2Q9X A;  4J2S A;  4A7K A;  4G6M A;  3NBD A;  3PHZ A;  3BTA A;  1IT0 A;  5F8S A;  1WD3 A;  2KI6 B;  4DCK C;  3A21 A;  4CJM A;  2FGF A;  4QBV A;  3FJI A;  1BLD A;  4A7Y A;  3CQA A;  4XFU A;  4LO1 C;  1TP0 A;  3D7W B;  3HSM A;  2RST A;  4LO2 C;  3BAV A;  3FJF A;  3TC2 A;  1DFC A;  2BFH A;  1AVU A;  1YBI A;  2VSA A;  4I7I A;  1FMZ A;  3UDA A;  3RTJ B;  3FJK A;  1ISZ A;  1ITB A;  4Z9W B;  2D24 A;  3AJ5 A;  3AH1 A;  4OWJ A;  5JMC A;  4H9W A;  3NBN A;  3AKH A;  3N7J A;  4LO7 C;  2VXT I;  4KEK A;  1JT4 A;  4XKI A;  3CA0 A;  3EF2 A;  5DUY A;  1RY7 A;  2WBC A;  3Q7W A;  1S0E A;  3AKF A;  4OWL A;  1IOB A;  3VEQ A;  4JAW A;  2MC2 A;  4Q91 A;  1QQL A;  2Z48 A;  4OW4 A;  3WIN A;  5D62 A;  1ABR B;  2HWA A;  1RZO B;  1IJT A;  3ZC9 A;  4J2X A;  3WA1 A;  3FJJ A;  3P53 A;  3BA4 A;  3FJ8 A;  3N7K A;  3CU1 B;  1NUN A;  2Y9X E;  4G9M A;  4I4P A;  2F2F C;  4QBC A;  5F90 A;  2BEB A;  3FGM A;  1SR4 A;  1W3G A;  2K43 A;  4J2K A;  2NZ9 A;  4J23 B;  3KMV A;  4EFR A;  4L4I A;  1IHK A;  3O4D A;  4P6A A;  3OJV A;  3CRG A;  3WMV A;  4MZH A;  3A22 A;  3C9Z A;  3NBC A;  1PUM B;  1IIL A;  1Q03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...