4ZFUB

Structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with n-acetyl d galactosamine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
261
structure length
261
Chain Sequence
b'NEQCSPQQRTTRISGRDGLCVDVYGALTADGSRVILYPCGQQQNQQWTFYPDNTIRSLGKCLATSALSSGSNVVITNCDYLRYDDGWMVSSSGTMMNKSSHLVLTANAATSRTNLTGENNVFAAKQAWRIGNYVEPIVTTIIGLRHMCLEATDNDTNVWLESCVKNKTKQYWALYSDDTIRVNNNRNLCVSSSTDSSSKLIVIRRCDGSINQRWVFTPQGTISNPGYEAVMDVAQNDVYLKKIVLSSATDKGNGQQWTVFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA N-glycosidase
publication title Structural studies on a non-toxic homologue of type II RIPs from bitter gourd: Molecular basis of non-toxicity, conformational selection and glycan structure.
pubmed rcsb
molecule tags Hydrolase
total genus 77
structure length 261
sequence length 261
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfuB01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfuB02
5FZUA 4I96A 2D22A 2AQZA 2VXRA 3O4AA 3RMYA 2BEBA 3O3QA 3N7KA 4EKXB 1HIBA 3B9UA 3CA5A 3IIRA 1AVWB 3BX1C 1RZOB 3BAHA 2R9KB 1IJTA 2KH2A 1ITBA 4IY9A 4LO7C 4G9MA 4QD2B 1J0SA 1HWOB 3POKA 4X39A 3A22A 1MD6A 4IZEA 3WO2A 1ISWA 3RTIB 3WA1A 3V0BA 3Q7YA 2RG9B 1BFFA 4CJMA 3CRHA 1W3AA 1ISXA 4XKIA 2LIEA 3V0BB 5F8SA 1Q1UA 4IY8A 1W3GA 2WRYA 2FGFA 2P39A 3VT2A 1WD4A 4I1EA 1JT7A 3FJKA 4G6JA 2QYIB 2D20A 1YYNA 2E4MC 3BA5A 5D62A 2GZBA 3F62B 2Y9GA 2RQ9A 4EFQA 3BRFA 1JTCA 1PUUB 3AKHA 2ESUA 5DSSB 4I4QA 1JT4A 5BXPA 3UJ4A 5HPZA 3KMVA 3VSFA 2Z48A 4QKRA 1WBAA 4WBCA 3FJCA 3CA0A 3AJ6A 5DUYA 1IT0A 2FFVA 1PWAA 4ZKTB 5BXTA 3UD7A 2WBCA 2Y9WC 4OW4A 1V6VA 1S0GA 4OWKA 3HOMA 1S0LA 4Z8SB 4AN7B 1YXWA 1XG6A 4J2YA 1ILR1 3IAGC 4KEKA 4LO3C 4QBCA 2VSAA 4F34A 1DZCA 5BVPI 1E0OA 3BAQA 4ENDA 1IRPA 1XYFA 3BAUA 2XOAA 4DENA 2F2FA 4I6IA 3AH4A 4EFRA 4I4OA 1Z2VA 3JRRA 2X2SA 3VSZA 4H04A 2DS0A 4LO0A 4OEGA 2AFGA 2VU9A 4I4SA 4JQ0A 3BB2A 2VXTI 3D7WB 3O49A 3S8JA 1TIEA 1RG8A 3O5WB 1MC9A 4LO1A 2RSTA 2VSEA 1V6WA 2M49A 5BQUA 4X37A 2DREA 5D63A 3HSMA 21BIA 4I3NA 4ZBVB 5DZUA 5GAQA 2ET2A 3FUOA 3ILAA 1T9FA 4I1BA 3RSJA 6I1BA 2UUSA 2VLCA 3NJ5A 2NM1A 3LLPA 3CU1B 3P6IA 3WMVA 5EG6C 1JLXA 4X38A 3FJJA 3EF2A 4L4HA 1JT3A 1R8OA 3FGMA 4OUJA 3Q7XA 3H6RA 5BOWA 3ZXDA 3UD9A 3A07A 3QR5A 4JP0A 5BP5A 3V0AA 1AF9A 4LO2A 1K5UA 3VUOA 4G6MA 4QBVA 1BLDA 3MPPG 1IHKA 5I1BA 2FFUA 1YBIA 1YTOA 2NYYA 1CVSA 3N7LA 3AH1A 1DQOA 1BLAA 1NUNA 1S0DA 5F8YA 4JRAA 3V0AB 1QQKA 1IOBA 4IZXA 5BXSA 1V6UA 1EYLA 1PUMB 4HJJA 4KC3A 1IRAX 1DIWA 3CA4A 3IM5A 3V79C 1TP0A 1SR4A 1FGAA 3FJAA 3Q7WA 1FQ9A 3OJVA 5FNWA 1WBCA 2DRZA 3TC2A 3FJIA 3HALA 1TWEA 3R4UA 3E8LC 1AXMA 4EEEB 4P0JA 2ZR1B 2BEAA 3F1RA 1FMMS 2NP0A 4IQPA 1FV3A 3HN1A 4KEIA 4JKQA 2HWMA 3VWCA 1Q04A 4OEFA 4I4VA 3WINC 4I4UA 4GOVA 3P6JA 3O4CA 1OQLB 1S0EA 1AVUA 1BFBA 3NBCA 4XFTA 2NZ9A 3CA1A 1S0FA 2AAIB 5FZYA 4GOYA 3BRDA 1HKNA 1S0BA 3OJ2A 4KEJA 1XHBA 2X2TA 3N7MA 3PUBA 4I7IA 1IILA 1HCEA 1G82A 1HWNB 4ZOTA 4ZFYB 4ZGRB 3CA6A 2K8RA 3ZC8A 1T4QA 4I8MA 1Z0HA 2HW9A 2KI6B 4QALA 4ISRA 2HWAA 3BADA 1DFCA 4TLPA 1KNMA 4KBBA 3BTAA 1S0CA 1TTUA 4I4YA 5F8WA 3AKIA 1N4KA 2IHOA 4EFPA 3CRIA 4X3AA 1II4A 1P63A 2MIBA 3FJDA 4J23B 3AKGA 4Q9PA 3AZWA 2HZ9A 1DQGA 2Y9XE 3WO3A 4G1RA 2Z49A 5JLVA 3W9TA 3SNVA 3I2XA 4YOLA 2L5XA 4HR6C 1BFCA 31BIA 3RTJB 2P23A 1RMLA 3A21A 2FO1A 4P0KA 4QD2C 3A23A 4ZFUB 2IWTB 3AH2A 2DRYA 3ZC9A 3PG0A 2KLLA 4LO8B 1I1BA 3UD8A 2I1BA 4GAIA 1W3FA 3CA3A 1F31A 3WMUA 4IONA 2E4MA 2ZQOA 4OWJA 4QO3A 3O4OA 2K43A 2VUAA 4USOA 3N0KA 1DFQA 1GGPB 2NTDA 3O4DA 1AVXB 3BRGC 3PMEA 3IM7A 4IYBA 4I0YA 4JAWA 3CRGA 3I2AA 4G9NA 2D7RA 4I37A 1HWPB 5E24E 3AZVA 3OBTA 3VT0A 3BAVA 4J2SA 3H6SE 1ISZA 4D0TA 3H6RB 2KI4A 3O44A 4LO3A 3JUTA 1M2TB 4HA2A 4FGFA 2GO2A 4P0LA 1QXMA 3PHZA 2F8XC 4XFUA 4DEPA 2ERMA 2MC2A 1QQLA 2AXMA 5BXRA 3AJ5A 1R8NA 2MLLB 4L4IA 1SZ6B 4D8HA 1UPSA 4DCKC 1G9AA 1TOOA 3I29B 1ABRB 3FJ8A 1EPWA 1V6XA 3RMXA 3OGGA 7I1BA 3ZXGA 8I1BA 1DLLA 2F2FC 1FN0A 3CAHA 3P53A 1HCDA 4IHZA 5G00A 1BASA 1FWVA 5JMCA 3K1XA 2Y9FA 4ZLBB 4LO0C 2Q3NB 4FVVA 3S8KA 3ZX7A 1FV2A 1AVAC 3BAGA 4LO1C 5BQUC 3HMYA 2D1ZA 3OGFA 1AFCA 3NBEA 3OBRA 4PC4A 3T8SA 3H6QA 4EB2B 2K4AB 3FFZA 1EVTA 4J2XA 1DJSB 5B2HA 2D24A 3MALA 1RY7A 1FMZA 3R4SA 1G9BA 4Z9WB 4Q91A 1ISYA 2KKIA 3FJBA 5FNXA 1HWMB 2J3PA 3VEQA 2D44A 1JY0A 1EV2A 4R6UB 1I1EA 1PC8B 2D23A 9ILBA 4ZFWB 4I4RA 3BA4A 4AN6A 5BP5C 4LO2C 3FJEA 3OJMA 1PZZA 1JLYA 1K5VA 3NBDA 4GP3A 1G9DA 4H9WA 5DVHA 4ZA3B 3AKFA 1DZDA 1BARA 1L2HA 3VT1A 4LO7B 1G9CA 4JKXB 4QKSA 4I4XA 1ONKB 3WO4A 1YF8B 2ZQNA 1Q03A 2D7IA 4I2SA 3BA7A 4F83A 3HBWA 3LTQA 4JPZA 5EC5A 3UDAA 1SR4C 3FJHA 2Q9XA 3FUQA 3BAOA 1D0HA 1BA7A 2NVHA 3WINA 4D0ZA 1WD3A 2FDBM 3QYDA 41BIA 1CE7B 4QC4A 3N7JA 4A7KA 1JQZA 4I4PA 1BFGA 3FJFA 1ISVA 3FJ9A 4A7YA 1NZKA 3IM6A 3O4BA 4GP0A 3UJ0A 2QN4A 3NBNA 1TFMB 4Q9GA 4XFSA 4OEEA 4A7ZA 2YUGA 4II0A 1A8DA 2LIQA 4P6AA 5D61A 5EHAA 4ISQA 1TWMA 1M16A 4GAFA 3CQAA 1Z4SA 1JT5A 1VCLA 2D43A 2BFHA 4USPA 1XZZA 3C9ZA 5F90A 4OWLA 5FZZA 4J2KA 1FWUA
chains in the Genus database with same CATH superfamily
5FZUA 4I96A 2D22A 2AQZA 2VXRA 3O4AA 3RMYA 2BEBA 3O3QA 3N7KA 4EKXB 1HIBA 3B9UA 3CA5A 3IIRA 1AVWB 3BX1C 1RZOB 3BAHA 2R9KB 1IJTA 2KH2A 1ITBA 4IY9A 4LO7C 4G9MA 4QD2B 1J0SA 1HWOB 3POKA 4X39A 3A22A 1MD6A 4IZEA 3WO2A 1ISWA 3RTIB 3WA1A 3V0BA 3Q7YA 2RG9B 1BFFA 4CJMA 3CRHA 1W3AA 1ISXA 4XKIA 2LIEA 3V0BB 5F8SA 1Q1UA 4IY8A 1W3GA 2WRYA 2FGFA 2P39A 3VT2A 1WD4A 4I1EA 1JT7A 3FJKA 4G6JA 2QYIB 2D20A 1YYNA 2E4MC 3BA5A 5D62A 2GZBA 3F62B 2Y9GA 2RQ9A 4EFQA 3BRFA 1JTCA 1PUUB 3AKHA 2ESUA 5DSSB 4I4QA 1JT4A 5BXPA 3UJ4A 5HPZA 3KMVA 3VSFA 2Z48A 4QKRA 1WBAA 4WBCA 3FJCA 3CA0A 3AJ6A 5DUYA 1IT0A 2FFVA 1PWAA 4ZKTB 5BXTA 3UD7A 2WBCA 2Y9WC 4OW4A 1V6VA 1S0GA 4OWKA 3HOMA 1S0LA 4Z8SB 4AN7B 1YXWA 1XG6A 4J2YA 1ILR1 3IAGC 4KEKA 4LO3C 4QBCA 2VSAA 4F34A 1DZCA 5BVPI 1E0OA 3BAQA 4ENDA 1IRPA 1XYFA 3BAUA 2XOAA 4DENA 2F2FA 4I6IA 3AH4A 4EFRA 4I4OA 1Z2VA 3JRRA 2X2SA 3VSZA 4H04A 2DS0A 4LO0A 4OEGA 2AFGA 2VU9A 4I4SA 4JQ0A 3BB2A 2VXTI 3D7WB 3O49A 3S8JA 1TIEA 1RG8A 3O5WB 1MC9A 4LO1A 2RSTA 2VSEA 1V6WA 2M49A 5BQUA 4X37A 2DREA 5D63A 3HSMA 21BIA 4I3NA 4ZBVB 5DZUA 5GAQA 2ET2A 3FUOA 3ILAA 1T9FA 4I1BA 3RSJA 6I1BA 2UUSA 2VLCA 3NJ5A 2NM1A 3LLPA 3CU1B 3P6IA 3WMVA 5EG6C 1JLXA 4X38A 3FJJA 3EF2A 4L4HA 1JT3A 1R8OA 3FGMA 4OUJA 3Q7XA 3H6RA 5BOWA 3ZXDA 3UD9A 3A07A 3QR5A 4JP0A 5BP5A 3V0AA 1AF9A 4LO2A 1K5UA 3VUOA 4G6MA 4QBVA 1BLDA 3MPPG 1IHKA 5I1BA 2FFUA 1YBIA 1YTOA 2NYYA 1CVSA 3N7LA 3AH1A 1DQOA 1BLAA 1NUNA 1S0DA 5F8YA 4JRAA 3V0AB 1QQKA 1IOBA 4IZXA 5BXSA 1V6UA 1EYLA 1PUMB 4HJJA 4KC3A 1IRAX 1DIWA 3CA4A 3IM5A 3V79C 1TP0A 1SR4A 1FGAA 3FJAA 3Q7WA 1FQ9A 3OJVA 5FNWA 1WBCA 2DRZA 3TC2A 3FJIA 3HALA 1TWEA 3R4UA 3E8LC 1AXMA 4EEEB 4P0JA 2ZR1B 2BEAA 3F1RA 1FMMS 2NP0A 4IQPA 1FV3A 3HN1A 4KEIA 4JKQA 2HWMA 3VWCA 1Q04A 4OEFA 4I4VA 3WINC 4I4UA 4GOVA 3P6JA 3O4CA 1OQLB 1S0EA 1AVUA 1BFBA 3NBCA 4XFTA 2NZ9A 3CA1A 1S0FA 2AAIB 5FZYA 4GOYA 3BRDA 1HKNA 1S0BA 3OJ2A 4KEJA 1XHBA 2X2TA 3N7MA 3PUBA 4I7IA 1IILA 1HCEA 1G82A 1HWNB 4ZOTA 4ZFYB 4ZGRB 3CA6A 2K8RA 3ZC8A 1T4QA 4I8MA 1Z0HA 2HW9A 2KI6B 4QALA 4ISRA 2HWAA 3BADA 1DFCA 4MZFB 4TLPA 1KNMA 4KBBA 3BTAA 1S0CA 1TTUA 4H75A 4I4YA 5F8WA 3AKIA 1N4KA 2IHOA 4EFPA 3CRIA 4X3AA 1II4A 1P63A 2MIBA 3FJDA 4J23B 3AKGA 4Q9PA 3AZWA 2HZ9A 1DQGA 2Y9XE 3WO3A 4G1RA 2Z49A 5JLVA 3W9TA 3SNVA 3I2XA 4YOLA 2L5XA 4HR6C 1BFCA 4MZGB 31BIA 4UY4A 3RTJB 2P23A 1RMLA 3A21A 2FO1A 4P0KA 4QD2C 3A23A 4ZFUB 2IWTB 3AH2A 2DRYA 3ZC9A 3PG0A 2KLLA 4LO8B 1I1BA 3UD8A 2I1BA 4GAIA 1W3FA 3CA3A 1F31A 3WMUA 4IONA 2E4MA 2ZQOA 4OWJA 4QO3A 3O4OA 2K43A 2VUAA 4USOA 3N0KA 1DFQA 1GGPB 2NTDA 3O4DA 1AVXB 3BRGC 3PMEA 3IM7A 4IYBA 4I0YA 4JAWA 3CRGA 3I2AA 4G9NA 2D7RA 4I37A 1HWPB 5E24E 3AZVA 3OBTA 3VT0A 3BAVA 4J2SA 3H6SE 1ISZA 4D0TA 3H6RB 2KI4A 3O44A 4LO3A 3JUTA 1M2TB 4HA2A 4FGFA 2GO2A 4P0LA 1QXMA 3PHZA 2F8XC 4XFUA 4DEPA 2ERMA 2MC2A 1QQLA 2AXMA 5BXRA 3AJ5A 1R8NA 2MLLB 4L4IA 1SZ6B 4D8HA 1UPSA 2NS2A 4DCKC 1G9AA 1TOOA 3I29B 1ABRB 3FJ8A 1EPWA 1V6XA 3RMXA 3OGGA 7I1BA 4MZHA 3ZXGA 8I1BA 1DLLA 2F2FC 1FN0A 3CAHA 3P53A 1HCDA 4IHZA 5G00A 1BASA 1FWVA 5JMCA 3K1XA 2Y9FA 4ZLBB 4LO0C 2Q3NB 4FVVA 3S8KA 3ZX7A 1FV2A 1AVAC 3BAGA 4LO1C 5BQUC 3HMYA 2D1ZA 3OGFA 1AFCA 3NBEA 3OBRA 4PC4A 3T8SA 3H6QA 4EB2B 2K4AB 3FFZA 1EVTA 4J2XA 1DJSB 5B2HA 2D24A 3MALA 1RY7A 1FMZA 3R4SA 1G9BA 4Z9WB 4Q91A 1ISYA 2KKIA 3FJBA 5FNXA 1HWMB 2J3PA 3VEQA 2D44A 1JY0A 1EV2A 4R6UB 1I1EA 1PC8B 2D23A 9ILBA 4ZFWB 4I4RA 3BA4A 4AN6A 5BP5C 4LO2C 3FJEA 3OJMA 1PZZA 1JLYA 1K5VA 3NBDA 4GP3A 1G9DA 4H9WA 5DVHA 4ZA3B 3AKFA 1DZDA 1BARA 1L2HA 3VT1A 4LO7B 1G9CA 4JKXB 4QKSA 4I4XA 1ONKB 3WO4A 1YF8B 2ZQNA 1Q03A 2D7IA 4I2SA 3BA7A 4F83A 3HBWA 3LTQA 4JPZA 5EC5A 3UDAA 1SR4C 3FJHA 2Q9XA 3FUQA 3BAOA 1D0HA 1BA7A 2NVHA 3WINA 4D0ZA 1WD3A 2FDBM 3QYDA 41BIA 1CE7B 4QC4A 3N7JA 4A7KA 1JQZA 4I4PA 1BFGA 3FJFA 1ISVA 3FJ9A 4A7YA 1NZKA 3IM6A 3O4BA 4GP0A 3UJ0A 2QN4A 3NBNA 1TFMB 4Q9GA 4XFSA 4OEEA 4A7ZA 2YUGA 4II0A 1A8DA 2LIQA 4P6AA 5D61A 5EHAA 4ISQA 1TWMA 1M16A 4GAFA 3CQAA 1Z4SA 1JT5A 1VCLA 2D43A 2BFHA 4USPA 1XZZA 3C9ZA 5F90A 4OWLA 5FZZA 4J2KA 1FWUA
chains in the Genus database with same CATH topology
5FZUA 4I96A 2D22A 2AQZA 2VXRA 3O4AA 3RMYA 2BEBA 3O3QA 3N7KA 4EKXB 1HIBA 3B9UA 3CA5A 3IIRA 1AVWB 3BX1C 1RZOB 3BAHA 2R9KB 1IJTA 2KH2A 1ITBA 4IY9A 4LO7C 4G9MA 4QD2B 1J0SA 1HWOB 3POKA 4X39A 3A22A 1MD6A 4IZEA 3WO2A 1ISWA 3RTIB 3WA1A 3V0BA 3Q7YA 2RG9B 1BFFA 4CJMA 3CRHA 1W3AA 1ISXA 4XKIA 2LIEA 3V0BB 5F8SA 1Q1UA 4IY8A 1W3GA 2WRYA 2FGFA 2P39A 3VT2A 1WD4A 4I1EA 1JT7A 3FJKA 4G6JA 2QYIB 2D20A 1YYNA 2E4MC 3BA5A 5D62A 2GZBA 3F62B 2Y9GA 2RQ9A 4EFQA 3BRFA 1JTCA 1PUUB 3AKHA 2ESUA 5DSSB 4I4QA 1JT4A 5BXPA 3UJ4A 5HPZA 3KMVA 3VSFA 2Z48A 4QKRA 1WBAA 4WBCA 3FJCA 3CA0A 3AJ6A 5DUYA 1IT0A 2FFVA 1PWAA 4ZKTB 5BXTA 3UD7A 2WBCA 2Y9WC 4OW4A 1V6VA 1S0GA 4OWKA 3HOMA 1S0LA 4Z8SB 4AN7B 1YXWA 1XG6A 4J2YA 1ILR1 3IAGC 4KEKA 4LO3C 4QBCA 2VSAA 4F34A 1DZCA 5BVPI 1E0OA 3BAQA 4ENDA 1IRPA 1XYFA 3BAUA 2XOAA 4DENA 2F2FA 4I6IA 3AH4A 4EFRA 4I4OA 1Z2VA 3JRRA 2X2SA 3VSZA 4H04A 2DS0A 4LO0A 4OEGA 2AFGA 2VU9A 4I4SA 4JQ0A 3BB2A 2VXTI 3D7WB 3O49A 3S8JA 1TIEA 1RG8A 3O5WB 1MC9A 4LO1A 2RSTA 2VSEA 1V6WA 2M49A 5BQUA 4X37A 2DREA 5D63A 3HSMA 21BIA 4I3NA 4ZBVB 5DZUA 5GAQA 2ET2A 3FUOA 3ILAA 1T9FA 4I1BA 3RSJA 6I1BA 2UUSA 2VLCA 3NJ5A 2NM1A 3LLPA 3CU1B 3P6IA 3WMVA 5EG6C 1JLXA 4X38A 3FJJA 3EF2A 4L4HA 1JT3A 1R8OA 3FGMA 4OUJA 3Q7XA 3H6RA 5BOWA 3ZXDA 3UD9A 3A07A 3QR5A 4JP0A 5BP5A 3V0AA 1AF9A 4LO2A 1K5UA 3VUOA 4G6MA 4QBVA 1BLDA 3MPPG 1IHKA 5I1BA 2FFUA 1YBIA 1YTOA 2NYYA 1CVSA 3N7LA 3AH1A 1DQOA 1BLAA 1NUNA 1S0DA 5F8YA 4JRAA 3V0AB 1QQKA 1IOBA 4IZXA 5BXSA 1V6UA 1EYLA 1PUMB 4HJJA 4KC3A 1IRAX 1DIWA 3CA4A 3IM5A 3V79C 1TP0A 1SR4A 1FGAA 3FJAA 3Q7WA 1FQ9A 3OJVA 5FNWA 1WBCA 2DRZA 3TC2A 3FJIA 3HALA 1TWEA 3R4UA 3E8LC 1AXMA 4EEEB 4P0JA 2ZR1B 2BEAA 3F1RA 1FMMS 2NP0A 4IQPA 1FV3A 3HN1A 4KEIA 4JKQA 2HWMA 3VWCA 1Q04A 4OEFA 4I4VA 3WINC 4I4UA 4GOVA 3P6JA 3O4CA 1OQLB 1S0EA 1AVUA 1BFBA 3NBCA 4XFTA 2NZ9A 3CA1A 1S0FA 2AAIB 5FZYA 4GOYA 3BRDA 1HKNA 1S0BA 3OJ2A 4KEJA 1XHBA 2X2TA 3N7MA 3PUBA 4I7IA 1IILA 1HCEA 1G82A 1HWNB 4ZOTA 4ZFYB 4ZGRB 3CA6A 2K8RA 3ZC8A 1T4QA 4I8MA 1Z0HA 2HW9A 2KI6B 4QALA 4ISRA 2HWAA 3BADA 1DFCA 4MZFB 4TLPA 1KNMA 4KBBA 3BTAA 1S0CA 1TTUA 4H75A 4I4YA 5F8WA 3AKIA 1N4KA 2IHOA 4EFPA 3CRIA 4X3AA 1II4A 1P63A 2MIBA 3FJDA 4J23B 3AKGA 4Q9PA 3AZWA 2HZ9A 1DQGA 2Y9XE 3WO3A 4G1RA 2Z49A 5JLVA 3W9TA 3SNVA 3I2XA 4YOLA 2L5XA 4HR6C 1BFCA 4MZGB 31BIA 4UY4A 3RTJB 2P23A 1RMLA 3A21A 2FO1A 4P0KA 4QD2C 3A23A 4ZFUB 2IWTB 3AH2A 2DRYA 3ZC9A 3PG0A 2KLLA 4LO8B 1I1BA 3UD8A 2I1BA 4GAIA 1W3FA 3CA3A 1F31A 3WMUA 4IONA 2E4MA 2ZQOA 4OWJA 4QO3A 3O4OA 2K43A 2VUAA 4USOA 3N0KA 1DFQA 1GGPB 2NTDA 3O4DA 1AVXB 3BRGC 3PMEA 3IM7A 4IYBA 4I0YA 4JAWA 3CRGA 3I2AA 4G9NA 2D7RA 4I37A 1HWPB 5E24E 3AZVA 3OBTA 3VT0A 3BAVA 4J2SA 3H6SE 1ISZA 4D0TA 3H6RB 2KI4A 3O44A 4LO3A 3JUTA 1M2TB 4HA2A 4FGFA 2GO2A 4P0LA 1QXMA 3PHZA 2F8XC 4XFUA 4DEPA 2ERMA 2MC2A 1QQLA 2AXMA 5BXRA 3AJ5A 1R8NA 2MLLB 4L4IA 1SZ6B 4D8HA 1UPSA 2NS2A 4DCKC 1G9AA 1TOOA 3I29B 1ABRB 3FJ8A 1EPWA 1V6XA 3RMXA 3OGGA 7I1BA 4MZHA 3ZXGA 8I1BA 1DLLA 2F2FC 1FN0A 3CAHA 3P53A 1HCDA 4IHZA 5G00A 1BASA 1FWVA 5JMCA 3K1XA 2Y9FA 4ZLBB 4LO0C 2Q3NB 4FVVA 3S8KA 3ZX7A 1FV2A 1AVAC 3BAGA 4LO1C 5BQUC 3HMYA 2D1ZA 3OGFA 1AFCA 3NBEA 3OBRA 4PC4A 3T8SA 3H6QA 4EB2B 2K4AB 3FFZA 1EVTA 4J2XA 1DJSB 5B2HA 2D24A 3MALA 1RY7A 1FMZA 3R4SA 1G9BA 4Z9WB 4Q91A 1ISYA 2KKIA 3FJBA 5FNXA 1HWMB 2J3PA 3VEQA 2D44A 1JY0A 1EV2A 4R6UB 1I1EA 1PC8B 2D23A 9ILBA 4ZFWB 4I4RA 3BA4A 4AN6A 5BP5C 4LO2C 3FJEA 3OJMA 1PZZA 1JLYA 1K5VA 3NBDA 4GP3A 1G9DA 4H9WA 5DVHA 4ZA3B 3AKFA 1DZDA 1BARA 1L2HA 3VT1A 4LO7B 1G9CA 4JKXB 4QKSA 4I4XA 1ONKB 3WO4A 1YF8B 2ZQNA 1Q03A 2D7IA 4I2SA 3BA7A 4F83A 3HBWA 3LTQA 4JPZA 5EC5A 3UDAA 1SR4C 3FJHA 2Q9XA 3FUQA 3BAOA 1D0HA 1BA7A 2NVHA 3WINA 4D0ZA 1WD3A 2FDBM 3QYDA 41BIA 1CE7B 4QC4A 3N7JA 4A7KA 1JQZA 4I4PA 1BFGA 3FJFA 1ISVA 3FJ9A 4A7YA 1NZKA 3IM6A 3O4BA 4GP0A 3UJ0A 2QN4A 3NBNA 1TFMB 4Q9GA 4XFSA 4OEEA 4A7ZA 2YUGA 4II0A 1A8DA 2LIQA 4P6AA 5D61A 5EHAA 4ISQA 1TWMA 1M16A 4GAFA 3CQAA 1Z4SA 1JT5A 1VCLA 2D43A 2BFHA 4USPA 1XZZA 3C9ZA 5F90A 4OWLA 5FZZA 4J2KA 1FWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZU A;  4I96 A;  2D22 A;  2AQZ A;  2VXR A;  3O4A A;  3RMY A;  2BEB A;  3O3Q A;  3N7K A;  4EKX B;  1HIB A;  3B9U A;  3CA5 A;  3IIR A;  1AVW B;  3BX1 C;  1RZO B;  3BAH A;  2R9K B;  1IJT A;  2KH2 A;  1ITB A;  4IY9 A;  4LO7 C;  4G9M A;  4QD2 B;  1J0S A;  1HWO B;  3POK A;  4X39 A;  3A22 A;  1MD6 A;  4IZE A;  3WO2 A;  1ISW A;  3RTI B;  3WA1 A;  3V0B A;  3Q7Y A;  2RG9 B;  1BFF A;  4CJM A;  3CRH A;  1W3A A;  1ISX A;  4XKI A;  2LIE A;  3V0B B;  5F8S A;  1Q1U A;  4IY8 A;  1W3G A;  2WRY A;  2FGF A;  2P39 A;  3VT2 A;  1WD4 A;  4I1E A;  1JT7 A;  3FJK A;  4G6J A;  2QYI B;  2D20 A;  1YYN A;  2E4M C;  3BA5 A;  5D62 A;  2GZB A;  3F62 B;  2Y9G A;  2RQ9 A;  4EFQ A;  3BRF A;  1JTC A;  1PUU B;  3AKH A;  2ESU A;  5DSS B;  4I4Q A;  1JT4 A;  5BXP A;  3UJ4 A;  5HPZ A;  3KMV A;  3VSF A;  2Z48 A;  4QKR A;  1WBA A;  4WBC A;  3FJC A;  3CA0 A;  3AJ6 A;  5DUY A;  1IT0 A;  2FFV A;  1PWA A;  4ZKT B;  5BXT A;  3UD7 A;  2WBC A;  2Y9W C;  4OW4 A;  1V6V A;  1S0G A;  4OWK A;  3HOM A;  1S0L A;  4Z8S B;  4AN7 B;  1YXW A;  1XG6 A;  4J2Y A;  1ILR 1;  3IAG C;  4KEK A;  4LO3 C;  4QBC A;  2VSA A;  4F34 A;  1DZC A;  5BVP I;  1E0O A;  3BAQ A;  4END A;  1IRP A;  1XYF A;  3BAU A;  2XOA A;  4DEN A;  2F2F A;  4I6I A;  3AH4 A;  4EFR A;  4I4O A;  1Z2V A;  3JRR A;  2X2S A;  3VSZ A;  4H04 A;  2DS0 A;  4LO0 A;  4OEG A;  2AFG A;  2VU9 A;  4I4S A;  4JQ0 A;  3BB2 A;  2VXT I;  3D7W B;  3O49 A;  3S8J A;  1TIE A;  1RG8 A;  3O5W B;  1MC9 A;  4LO1 A;  2RST A;  2VSE A;  1V6W A;  2M49 A;  5BQU A;  4X37 A;  2DRE A;  5D63 A;  3HSM A;  21BI A;  4I3N A;  4ZBV B;  5DZU A;  5GAQ A;  2ET2 A;  3FUO A;  3ILA A;  1T9F A;  4I1B A;  3RSJ A;  6I1B A;  2UUS A;  2VLC A;  3NJ5 A;  2NM1 A;  3LLP A;  3CU1 B;  3P6I A;  3WMV A;  5EG6 C;  1JLX A;  4X38 A;  3FJJ A;  3EF2 A;  4L4H A;  1JT3 A;  1R8O A;  3FGM A;  4OUJ A;  3Q7X A;  3H6R A;  5BOW A;  3ZXD A;  3UD9 A;  3A07 A;  3QR5 A;  4JP0 A;  5BP5 A;  3V0A A;  1AF9 A;  4LO2 A;  1K5U A;  3VUO A;  4G6M A;  4QBV A;  1BLD A;  3MPP G;  1IHK A;  5I1B A;  2FFU A;  1YBI A;  1YTO A;  2NYY A;  1CVS A;  3N7L A;  3AH1 A;  1DQO A;  1BLA A;  1NUN A;  1S0D A;  5F8Y A;  4JRA A;  3V0A B;  1QQK A;  1IOB A;  4IZX A;  5BXS A;  1V6U A;  1EYL A;  1PUM B;  4HJJ A;  4KC3 A;  1IRA X;  1DIW A;  3CA4 A;  3IM5 A;  3V79 C;  1TP0 A;  1SR4 A;  1FGA A;  3FJA A;  3Q7W A;  1FQ9 A;  3OJV A;  5FNW A;  1WBC A;  2DRZ A;  3TC2 A;  3FJI A;  3HAL A;  1TWE A;  3R4U A;  3E8L C;  1AXM A;  4EEE B;  4P0J A;  2ZR1 B;  2BEA A;  3F1R A;  1FMM S;  2NP0 A;  4IQP A;  1FV3 A;  3HN1 A;  4KEI A;  4JKQ A;  2HWM A;  3VWC A;  1Q04 A;  4OEF A;  4I4V A;  3WIN C;  4I4U A;  4GOV A;  3P6J A;  3O4C A;  1OQL B;  1S0E A;  1AVU A;  1BFB A;  3NBC A;  4XFT A;  2NZ9 A;  3CA1 A;  1S0F A;  2AAI B;  5FZY A;  4GOY A;  3BRD A;  1HKN A;  1S0B A;  3OJ2 A;  4KEJ A;  1XHB A;  2X2T A;  3N7M A;  3PUB A;  4I7I A;  1IIL A;  1HCE A;  1G82 A;  1HWN B;  4ZOT A;  4ZFY B;  4ZGR B;  3CA6 A;  2K8R A;  3ZC8 A;  1T4Q A;  4I8M A;  1Z0H A;  2HW9 A;  2KI6 B;  4QAL A;  4ISR A;  2HWA A;  3BAD A;  1DFC A;  4TLP A;  1KNM A;  4KBB A;  3BTA A;  1S0C A;  1TTU A;  4I4Y A;  5F8W A;  3AKI A;  1N4K A;  2IHO A;  4EFP A;  3CRI A;  4X3A A;  1II4 A;  1P63 A;  2MIB A;  3FJD A;  4J23 B;  3AKG A;  4Q9P A;  3AZW A;  2HZ9 A;  1DQG A;  2Y9X E;  3WO3 A;  4G1R A;  2Z49 A;  5JLV A;  3W9T A;  3SNV A;  3I2X A;  4YOL A;  2L5X A;  4HR6 C;  1BFC A;  31BI A;  3RTJ B;  2P23 A;  1RML A;  3A21 A;  2FO1 A;  4P0K A;  4QD2 C;  3A23 A;  4ZFU B;  2IWT B;  3AH2 A;  2DRY A;  3ZC9 A;  3PG0 A;  2KLL A;  4LO8 B;  1I1B A;  3UD8 A;  2I1B A;  4GAI A;  1W3F A;  3CA3 A;  1F31 A;  3WMU A;  4ION A;  2E4M A;  2ZQO A;  4OWJ A;  4QO3 A;  3O4O A;  2K43 A;  2VUA A;  4USO A;  3N0K A;  1DFQ A;  1GGP B;  2NTD A;  3O4D A;  1AVX B;  3BRG C;  3PME A;  3IM7 A;  4IYB A;  4I0Y A;  4JAW A;  3CRG A;  3I2A A;  4G9N A;  2D7R A;  4I37 A;  1HWP B;  5E24 E;  3AZV A;  3OBT A;  3VT0 A;  3BAV A;  4J2S A;  3H6S E;  1ISZ A;  4D0T A;  3H6R B;  2KI4 A;  3O44 A;  4LO3 A;  3JUT A;  1M2T B;  4HA2 A;  4FGF A;  2GO2 A;  4P0L A;  1QXM A;  3PHZ A;  2F8X C;  4XFU A;  4DEP A;  2ERM A;  2MC2 A;  1QQL A;  2AXM A;  5BXR A;  3AJ5 A;  1R8N A;  2MLL B;  4L4I A;  1SZ6 B;  4D8H A;  1UPS A;  4DCK C;  1G9A A;  1TOO A;  3I29 B;  1ABR B;  3FJ8 A;  1EPW A;  1V6X A;  3RMX A;  3OGG A;  7I1B A;  3ZXG A;  8I1B A;  1DLL A;  2F2F C;  1FN0 A;  3CAH A;  3P53 A;  1HCD A;  4IHZ A;  5G00 A;  1BAS A;  1FWV A;  5JMC A;  3K1X A;  2Y9F A;  4ZLB B;  4LO0 C;  2Q3N B;  4FVV A;  3S8K A;  3ZX7 A;  1FV2 A;  1AVA C;  3BAG A;  4LO1 C;  5BQU C;  3HMY A;  2D1Z A;  3OGF A;  1AFC A;  3NBE A;  3OBR A;  4PC4 A;  3T8S A;  3H6Q A;  4EB2 B;  2K4A B;  3FFZ A;  1EVT A;  4J2X A;  1DJS B;  5B2H A;  2D24 A;  3MAL A;  1RY7 A;  1FMZ A;  3R4S A;  1G9B A;  4Z9W B;  4Q91 A;  1ISY A;  2KKI A;  3FJB A;  5FNX A;  1HWM B;  2J3P A;  3VEQ A;  2D44 A;  1JY0 A;  1EV2 A;  4R6U B;  1I1E A;  1PC8 B;  2D23 A;  9ILB A;  4ZFW B;  4I4R A;  3BA4 A;  4AN6 A;  5BP5 C;  4LO2 C;  3FJE A;  3OJM A;  1PZZ A;  1JLY A;  1K5V A;  3NBD A;  4GP3 A;  1G9D A;  4H9W A;  5DVH A;  4ZA3 B;  3AKF A;  1DZD A;  1BAR A;  1L2H A;  3VT1 A;  4LO7 B;  1G9C A;  4JKX B;  4QKS A;  4I4X A;  1ONK B;  3WO4 A;  1YF8 B;  2ZQN A;  1Q03 A;  2D7I A;  4I2S A;  3BA7 A;  4F83 A;  3HBW A;  3LTQ A;  4JPZ A;  5EC5 A;  3UDA A;  1SR4 C;  3FJH A;  2Q9X A;  3FUQ A;  3BAO A;  1D0H A;  1BA7 A;  2NVH A;  3WIN A;  4D0Z A;  1WD3 A;  2FDB M;  3QYD A;  41BI A;  1CE7 B;  4QC4 A;  3N7J A;  4A7K A;  1JQZ A;  4I4P A;  1BFG A;  3FJF A;  1ISV A;  3FJ9 A;  4A7Y A;  1NZK A;  3IM6 A;  3O4B A;  4GP0 A;  3UJ0 A;  2QN4 A;  3NBN A;  1TFM B;  4Q9G A;  4XFS A;  4OEE A;  4A7Z A;  2YUG A;  4II0 A;  1A8D A;  2LIQ A;  4P6A A;  5D61 A;  5EHA A;  4ISQ A;  1TWM A;  1M16 A;  4GAF A;  3CQA A;  1Z4S A;  1JT5 A;  1VCL A;  2D43 A;  2BFH A;  4USP A;  1XZZ A;  3C9Z A;  5F90 A;  4OWL A;  5FZZ A;  4J2K A;  1FWU A; 
#chains in the Genus database with same CATH topology
 5FZU A;  4I96 A;  2D22 A;  2AQZ A;  2VXR A;  3O4A A;  3RMY A;  2BEB A;  3O3Q A;  3N7K A;  4EKX B;  1HIB A;  3B9U A;  3CA5 A;  3IIR A;  1AVW B;  3BX1 C;  1RZO B;  3BAH A;  2R9K B;  1IJT A;  2KH2 A;  1ITB A;  4IY9 A;  4LO7 C;  4G9M A;  4QD2 B;  1J0S A;  1HWO B;  3POK A;  4X39 A;  3A22 A;  1MD6 A;  4IZE A;  3WO2 A;  1ISW A;  3RTI B;  3WA1 A;  3V0B A;  3Q7Y A;  2RG9 B;  1BFF A;  4CJM A;  3CRH A;  1W3A A;  1ISX A;  4XKI A;  2LIE A;  3V0B B;  5F8S A;  1Q1U A;  4IY8 A;  1W3G A;  2WRY A;  2FGF A;  2P39 A;  3VT2 A;  1WD4 A;  4I1E A;  1JT7 A;  3FJK A;  4G6J A;  2QYI B;  2D20 A;  1YYN A;  2E4M C;  3BA5 A;  5D62 A;  2GZB A;  3F62 B;  2Y9G A;  2RQ9 A;  4EFQ A;  3BRF A;  1JTC A;  1PUU B;  3AKH A;  2ESU A;  5DSS B;  4I4Q A;  1JT4 A;  5BXP A;  3UJ4 A;  5HPZ A;  3KMV A;  3VSF A;  2Z48 A;  4QKR A;  1WBA A;  4WBC A;  3FJC A;  3CA0 A;  3AJ6 A;  5DUY A;  1IT0 A;  2FFV A;  1PWA A;  4ZKT B;  5BXT A;  3UD7 A;  2WBC A;  2Y9W C;  4OW4 A;  1V6V A;  1S0G A;  4OWK A;  3HOM A;  1S0L A;  4Z8S B;  4AN7 B;  1YXW A;  1XG6 A;  4J2Y A;  1ILR 1;  3IAG C;  4KEK A;  4LO3 C;  4QBC A;  2VSA A;  4F34 A;  1DZC A;  5BVP I;  1E0O A;  3BAQ A;  4END A;  1IRP A;  1XYF A;  3BAU A;  2XOA A;  4DEN A;  2F2F A;  4I6I A;  3AH4 A;  4EFR A;  4I4O A;  1Z2V A;  3JRR A;  2X2S A;  3VSZ A;  4H04 A;  2DS0 A;  4LO0 A;  4OEG A;  2AFG A;  2VU9 A;  4I4S A;  4JQ0 A;  3BB2 A;  2VXT I;  3D7W B;  3O49 A;  3S8J A;  1TIE A;  1RG8 A;  3O5W B;  1MC9 A;  4LO1 A;  2RST A;  2VSE A;  1V6W A;  2M49 A;  5BQU A;  4X37 A;  2DRE A;  5D63 A;  3HSM A;  21BI A;  4I3N A;  4ZBV B;  5DZU A;  5GAQ A;  2ET2 A;  3FUO A;  3ILA A;  1T9F A;  4I1B A;  3RSJ A;  6I1B A;  2UUS A;  2VLC A;  3NJ5 A;  2NM1 A;  3LLP A;  3CU1 B;  3P6I A;  3WMV A;  5EG6 C;  1JLX A;  4X38 A;  3FJJ A;  3EF2 A;  4L4H A;  1JT3 A;  1R8O A;  3FGM A;  4OUJ A;  3Q7X A;  3H6R A;  5BOW A;  3ZXD A;  3UD9 A;  3A07 A;  3QR5 A;  4JP0 A;  5BP5 A;  3V0A A;  1AF9 A;  4LO2 A;  1K5U A;  3VUO A;  4G6M A;  4QBV A;  1BLD A;  3MPP G;  1IHK A;  5I1B A;  2FFU A;  1YBI A;  1YTO A;  2NYY A;  1CVS A;  3N7L A;  3AH1 A;  1DQO A;  1BLA A;  1NUN A;  1S0D A;  5F8Y A;  4JRA A;  3V0A B;  1QQK A;  1IOB A;  4IZX A;  5BXS A;  1V6U A;  1EYL A;  1PUM B;  4HJJ A;  4KC3 A;  1IRA X;  1DIW A;  3CA4 A;  3IM5 A;  3V79 C;  1TP0 A;  1SR4 A;  1FGA A;  3FJA A;  3Q7W A;  1FQ9 A;  3OJV A;  5FNW A;  1WBC A;  2DRZ A;  3TC2 A;  3FJI A;  3HAL A;  1TWE A;  3R4U A;  3E8L C;  1AXM A;  4EEE B;  4P0J A;  2ZR1 B;  2BEA A;  3F1R A;  1FMM S;  2NP0 A;  4IQP A;  1FV3 A;  3HN1 A;  4KEI A;  4JKQ A;  2HWM A;  3VWC A;  1Q04 A;  4OEF A;  4I4V A;  3WIN C;  4I4U A;  4GOV A;  3P6J A;  3O4C A;  1OQL B;  1S0E A;  1AVU A;  1BFB A;  3NBC A;  4XFT A;  2NZ9 A;  3CA1 A;  1S0F A;  2AAI B;  5FZY A;  4GOY A;  3BRD A;  1HKN A;  1S0B A;  3OJ2 A;  4KEJ A;  1XHB A;  2X2T A;  3N7M A;  3PUB A;  4I7I A;  1IIL A;  1HCE A;  1G82 A;  1HWN B;  4ZOT A;  4ZFY B;  4ZGR B;  3CA6 A;  2K8R A;  3ZC8 A;  1T4Q A;  4I8M A;  1Z0H A;  2HW9 A;  2KI6 B;  4QAL A;  4ISR A;  2HWA A;  3BAD A;  1DFC A;  4MZF B;  4TLP A;  1KNM A;  4KBB A;  3BTA A;  1S0C A;  1TTU A;  4H75 A;  4I4Y A;  5F8W A;  3AKI A;  1N4K A;  2IHO A;  4EFP A;  3CRI A;  4X3A A;  1II4 A;  1P63 A;  2MIB A;  3FJD A;  4J23 B;  3AKG A;  4Q9P A;  3AZW A;  2HZ9 A;  1DQG A;  2Y9X E;  3WO3 A;  4G1R A;  2Z49 A;  5JLV A;  3W9T A;  3SNV A;  3I2X A;  4YOL A;  2L5X A;  4HR6 C;  1BFC A;  4MZG B;  31BI A;  4UY4 A;  3RTJ B;  2P23 A;  1RML A;  3A21 A;  2FO1 A;  4P0K A;  4QD2 C;  3A23 A;  4ZFU B;  2IWT B;  3AH2 A;  2DRY A;  3ZC9 A;  3PG0 A;  2KLL A;  4LO8 B;  1I1B A;  3UD8 A;  2I1B A;  4GAI A;  1W3F A;  3CA3 A;  1F31 A;  3WMU A;  4ION A;  2E4M A;  2ZQO A;  4OWJ A;  4QO3 A;  3O4O A;  2K43 A;  2VUA A;  4USO A;  3N0K A;  1DFQ A;  1GGP B;  2NTD A;  3O4D A;  1AVX B;  3BRG C;  3PME A;  3IM7 A;  4IYB A;  4I0Y A;  4JAW A;  3CRG A;  3I2A A;  4G9N A;  2D7R A;  4I37 A;  1HWP B;  5E24 E;  3AZV A;  3OBT A;  3VT0 A;  3BAV A;  4J2S A;  3H6S E;  1ISZ A;  4D0T A;  3H6R B;  2KI4 A;  3O44 A;  4LO3 A;  3JUT A;  1M2T B;  4HA2 A;  4FGF A;  2GO2 A;  4P0L A;  1QXM A;  3PHZ A;  2F8X C;  4XFU A;  4DEP A;  2ERM A;  2MC2 A;  1QQL A;  2AXM A;  5BXR A;  3AJ5 A;  1R8N A;  2MLL B;  4L4I A;  1SZ6 B;  4D8H A;  1UPS A;  2NS2 A;  4DCK C;  1G9A A;  1TOO A;  3I29 B;  1ABR B;  3FJ8 A;  1EPW A;  1V6X A;  3RMX A;  3OGG A;  7I1B A;  4MZH A;  3ZXG A;  8I1B A;  1DLL A;  2F2F C;  1FN0 A;  3CAH A;  3P53 A;  1HCD A;  4IHZ A;  5G00 A;  1BAS A;  1FWV A;  5JMC A;  3K1X A;  2Y9F A;  4ZLB B;  4LO0 C;  2Q3N B;  4FVV A;  3S8K A;  3ZX7 A;  1FV2 A;  1AVA C;  3BAG A;  4LO1 C;  5BQU C;  3HMY A;  2D1Z A;  3OGF A;  1AFC A;  3NBE A;  3OBR A;  4PC4 A;  3T8S A;  3H6Q A;  4EB2 B;  2K4A B;  3FFZ A;  1EVT A;  4J2X A;  1DJS B;  5B2H A;  2D24 A;  3MAL A;  1RY7 A;  1FMZ A;  3R4S A;  1G9B A;  4Z9W B;  4Q91 A;  1ISY A;  2KKI A;  3FJB A;  5FNX A;  1HWM B;  2J3P A;  3VEQ A;  2D44 A;  1JY0 A;  1EV2 A;  4R6U B;  1I1E A;  1PC8 B;  2D23 A;  9ILB A;  4ZFW B;  4I4R A;  3BA4 A;  4AN6 A;  5BP5 C;  4LO2 C;  3FJE A;  3OJM A;  1PZZ A;  1JLY A;  1K5V A;  3NBD A;  4GP3 A;  1G9D A;  4H9W A;  5DVH A;  4ZA3 B;  3AKF A;  1DZD A;  1BAR A;  1L2H A;  3VT1 A;  4LO7 B;  1G9C A;  4JKX B;  4QKS A;  4I4X A;  1ONK B;  3WO4 A;  1YF8 B;  2ZQN A;  1Q03 A;  2D7I A;  4I2S A;  3BA7 A;  4F83 A;  3HBW A;  3LTQ A;  4JPZ A;  5EC5 A;  3UDA A;  1SR4 C;  3FJH A;  2Q9X A;  3FUQ A;  3BAO A;  1D0H A;  1BA7 A;  2NVH A;  3WIN A;  4D0Z A;  1WD3 A;  2FDB M;  3QYD A;  41BI A;  1CE7 B;  4QC4 A;  3N7J A;  4A7K A;  1JQZ A;  4I4P A;  1BFG A;  3FJF A;  1ISV A;  3FJ9 A;  4A7Y A;  1NZK A;  3IM6 A;  3O4B A;  4GP0 A;  3UJ0 A;  2QN4 A;  3NBN A;  1TFM B;  4Q9G A;  4XFS A;  4OEE A;  4A7Z A;  2YUG A;  4II0 A;  1A8D A;  2LIQ A;  4P6A A;  5D61 A;  5EHA A;  4ISQ A;  1TWM A;  1M16 A;  4GAF A;  3CQA A;  1Z4S A;  1JT5 A;  1VCL A;  2D43 A;  2BFH A;  4USP A;  1XZZ A;  3C9Z A;  5F90 A;  4OWL A;  5FZZ A;  4J2K A;  1FWU A; 
#chains in the Genus database with same CATH homology
 5FZU A;  4I96 A;  2D22 A;  2AQZ A;  2VXR A;  3O4A A;  3RMY A;  2BEB A;  3O3Q A;  3N7K A;  4EKX B;  1HIB A;  3B9U A;  3CA5 A;  3IIR A;  1AVW B;  3BX1 C;  1RZO B;  3BAH A;  2R9K B;  1IJT A;  2KH2 A;  1ITB A;  4IY9 A;  4LO7 C;  4G9M A;  4QD2 B;  1J0S A;  1HWO B;  3POK A;  4X39 A;  3A22 A;  1MD6 A;  4IZE A;  3WO2 A;  1ISW A;  3RTI B;  3WA1 A;  3V0B A;  3Q7Y A;  2RG9 B;  1BFF A;  4CJM A;  3CRH A;  1W3A A;  1ISX A;  4XKI A;  2LIE A;  3V0B B;  5F8S A;  1Q1U A;  4IY8 A;  1W3G A;  2WRY A;  2FGF A;  2P39 A;  3VT2 A;  1WD4 A;  4I1E A;  1JT7 A;  3FJK A;  4G6J A;  2QYI B;  2D20 A;  1YYN A;  2E4M C;  3BA5 A;  5D62 A;  2GZB A;  3F62 B;  2Y9G A;  2RQ9 A;  4EFQ A;  3BRF A;  1JTC A;  1PUU B;  3AKH A;  2ESU A;  5DSS B;  4I4Q A;  1JT4 A;  5BXP A;  3UJ4 A;  5HPZ A;  3KMV A;  3VSF A;  2Z48 A;  4QKR A;  1WBA A;  4WBC A;  3FJC A;  3CA0 A;  3AJ6 A;  5DUY A;  1IT0 A;  2FFV A;  1PWA A;  4ZKT B;  5BXT A;  3UD7 A;  2WBC A;  2Y9W C;  4OW4 A;  1V6V A;  1S0G A;  4OWK A;  3HOM A;  1S0L A;  4Z8S B;  4AN7 B;  1YXW A;  1XG6 A;  4J2Y A;  1ILR 1;  3IAG C;  4KEK A;  4LO3 C;  4QBC A;  2VSA A;  4F34 A;  1DZC A;  5BVP I;  1E0O A;  3BAQ A;  4END A;  1IRP A;  1XYF A;  3BAU A;  2XOA A;  4DEN A;  2F2F A;  4I6I A;  3AH4 A;  4EFR A;  4I4O A;  1Z2V A;  3JRR A;  2X2S A;  3VSZ A;  4H04 A;  2DS0 A;  4LO0 A;  4OEG A;  2AFG A;  2VU9 A;  4I4S A;  4JQ0 A;  3BB2 A;  2VXT I;  3D7W B;  3O49 A;  3S8J A;  1TIE A;  1RG8 A;  3O5W B;  1MC9 A;  4LO1 A;  2RST A;  2VSE A;  1V6W A;  2M49 A;  5BQU A;  4X37 A;  2DRE A;  5D63 A;  3HSM A;  21BI A;  4I3N A;  4ZBV B;  5DZU A;  5GAQ A;  2ET2 A;  3FUO A;  3ILA A;  1T9F A;  4I1B A;  3RSJ A;  6I1B A;  2UUS A;  2VLC A;  3NJ5 A;  2NM1 A;  3LLP A;  3CU1 B;  3P6I A;  3WMV A;  5EG6 C;  1JLX A;  4X38 A;  3FJJ A;  3EF2 A;  4L4H A;  1JT3 A;  1R8O A;  3FGM A;  4OUJ A;  3Q7X A;  3H6R A;  5BOW A;  3ZXD A;  3UD9 A;  3A07 A;  3QR5 A;  4JP0 A;  5BP5 A;  3V0A A;  1AF9 A;  4LO2 A;  1K5U A;  3VUO A;  4G6M A;  4QBV A;  1BLD A;  3MPP G;  1IHK A;  5I1B A;  2FFU A;  1YBI A;  1YTO A;  2NYY A;  1CVS A;  3N7L A;  3AH1 A;  1DQO A;  1BLA A;  1NUN A;  1S0D A;  5F8Y A;  4JRA A;  3V0A B;  1QQK A;  1IOB A;  4IZX A;  5BXS A;  1V6U A;  1EYL A;  1PUM B;  4HJJ A;  4KC3 A;  1IRA X;  1DIW A;  3CA4 A;  3IM5 A;  3V79 C;  1TP0 A;  1SR4 A;  1FGA A;  3FJA A;  3Q7W A;  1FQ9 A;  3OJV A;  5FNW A;  1WBC A;  2DRZ A;  3TC2 A;  3FJI A;  3HAL A;  1TWE A;  3R4U A;  3E8L C;  1AXM A;  4EEE B;  4P0J A;  2ZR1 B;  2BEA A;  3F1R A;  1FMM S;  2NP0 A;  4IQP A;  1FV3 A;  3HN1 A;  4KEI A;  4JKQ A;  2HWM A;  3VWC A;  1Q04 A;  4OEF A;  4I4V A;  3WIN C;  4I4U A;  4GOV A;  3P6J A;  3O4C A;  1OQL B;  1S0E A;  1AVU A;  1BFB A;  3NBC A;  4XFT A;  2NZ9 A;  3CA1 A;  1S0F A;  2AAI B;  5FZY A;  4GOY A;  3BRD A;  1HKN A;  1S0B A;  3OJ2 A;  4KEJ A;  1XHB A;  2X2T A;  3N7M A;  3PUB A;  4I7I A;  1IIL A;  1HCE A;  1G82 A;  1HWN B;  4ZOT A;  4ZFY B;  4ZGR B;  3CA6 A;  2K8R A;  3ZC8 A;  1T4Q A;  4I8M A;  1Z0H A;  2HW9 A;  2KI6 B;  4QAL A;  4ISR A;  2HWA A;  3BAD A;  1DFC A;  4MZF B;  4TLP A;  1KNM A;  4KBB A;  3BTA A;  1S0C A;  1TTU A;  4H75 A;  4I4Y A;  5F8W A;  3AKI A;  1N4K A;  2IHO A;  4EFP A;  3CRI A;  4X3A A;  1II4 A;  1P63 A;  2MIB A;  3FJD A;  4J23 B;  3AKG A;  4Q9P A;  3AZW A;  2HZ9 A;  1DQG A;  2Y9X E;  3WO3 A;  4G1R A;  2Z49 A;  5JLV A;  3W9T A;  3SNV A;  3I2X A;  4YOL A;  2L5X A;  4HR6 C;  1BFC A;  4MZG B;  31BI A;  4UY4 A;  3RTJ B;  2P23 A;  1RML A;  3A21 A;  2FO1 A;  4P0K A;  4QD2 C;  3A23 A;  4ZFU B;  2IWT B;  3AH2 A;  2DRY A;  3ZC9 A;  3PG0 A;  2KLL A;  4LO8 B;  1I1B A;  3UD8 A;  2I1B A;  4GAI A;  1W3F A;  3CA3 A;  1F31 A;  3WMU A;  4ION A;  2E4M A;  2ZQO A;  4OWJ A;  4QO3 A;  3O4O A;  2K43 A;  2VUA A;  4USO A;  3N0K A;  1DFQ A;  1GGP B;  2NTD A;  3O4D A;  1AVX B;  3BRG C;  3PME A;  3IM7 A;  4IYB A;  4I0Y A;  4JAW A;  3CRG A;  3I2A A;  4G9N A;  2D7R A;  4I37 A;  1HWP B;  5E24 E;  3AZV A;  3OBT A;  3VT0 A;  3BAV A;  4J2S A;  3H6S E;  1ISZ A;  4D0T A;  3H6R B;  2KI4 A;  3O44 A;  4LO3 A;  3JUT A;  1M2T B;  4HA2 A;  4FGF A;  2GO2 A;  4P0L A;  1QXM A;  3PHZ A;  2F8X C;  4XFU A;  4DEP A;  2ERM A;  2MC2 A;  1QQL A;  2AXM A;  5BXR A;  3AJ5 A;  1R8N A;  2MLL B;  4L4I A;  1SZ6 B;  4D8H A;  1UPS A;  2NS2 A;  4DCK C;  1G9A A;  1TOO A;  3I29 B;  1ABR B;  3FJ8 A;  1EPW A;  1V6X A;  3RMX A;  3OGG A;  7I1B A;  4MZH A;  3ZXG A;  8I1B A;  1DLL A;  2F2F C;  1FN0 A;  3CAH A;  3P53 A;  1HCD A;  4IHZ A;  5G00 A;  1BAS A;  1FWV A;  5JMC A;  3K1X A;  2Y9F A;  4ZLB B;  4LO0 C;  2Q3N B;  4FVV A;  3S8K A;  3ZX7 A;  1FV2 A;  1AVA C;  3BAG A;  4LO1 C;  5BQU C;  3HMY A;  2D1Z A;  3OGF A;  1AFC A;  3NBE A;  3OBR A;  4PC4 A;  3T8S A;  3H6Q A;  4EB2 B;  2K4A B;  3FFZ A;  1EVT A;  4J2X A;  1DJS B;  5B2H A;  2D24 A;  3MAL A;  1RY7 A;  1FMZ A;  3R4S A;  1G9B A;  4Z9W B;  4Q91 A;  1ISY A;  2KKI A;  3FJB A;  5FNX A;  1HWM B;  2J3P A;  3VEQ A;  2D44 A;  1JY0 A;  1EV2 A;  4R6U B;  1I1E A;  1PC8 B;  2D23 A;  9ILB A;  4ZFW B;  4I4R A;  3BA4 A;  4AN6 A;  5BP5 C;  4LO2 C;  3FJE A;  3OJM A;  1PZZ A;  1JLY A;  1K5V A;  3NBD A;  4GP3 A;  1G9D A;  4H9W A;  5DVH A;  4ZA3 B;  3AKF A;  1DZD A;  1BAR A;  1L2H A;  3VT1 A;  4LO7 B;  1G9C A;  4JKX B;  4QKS A;  4I4X A;  1ONK B;  3WO4 A;  1YF8 B;  2ZQN A;  1Q03 A;  2D7I A;  4I2S A;  3BA7 A;  4F83 A;  3HBW A;  3LTQ A;  4JPZ A;  5EC5 A;  3UDA A;  1SR4 C;  3FJH A;  2Q9X A;  3FUQ A;  3BAO A;  1D0H A;  1BA7 A;  2NVH A;  3WIN A;  4D0Z A;  1WD3 A;  2FDB M;  3QYD A;  41BI A;  1CE7 B;  4QC4 A;  3N7J A;  4A7K A;  1JQZ A;  4I4P A;  1BFG A;  3FJF A;  1ISV A;  3FJ9 A;  4A7Y A;  1NZK A;  3IM6 A;  3O4B A;  4GP0 A;  3UJ0 A;  2QN4 A;  3NBN A;  1TFM B;  4Q9G A;  4XFS A;  4OEE A;  4A7Z A;  2YUG A;  4II0 A;  1A8D A;  2LIQ A;  4P6A A;  5D61 A;  5EHA A;  4ISQ A;  1TWM A;  1M16 A;  4GAF A;  3CQA A;  1Z4S A;  1JT5 A;  1VCL A;  2D43 A;  2BFH A;  4USP A;  1XZZ A;  3C9Z A;  5F90 A;  4OWL A;  5FZZ A;  4J2K A;  1FWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...