4ZFUB

Structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with n-acetyl d galactosamine
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
261
structure length
261
Chain Sequence
NEQCSPQQRTTRISGRDGLCVDVYGALTADGSRVILYPCGQQQNQQWTFYPDNTIRSLGKCLATSALSSGSNVVITNCDYLRYDDGWMVSSSGTMMNKSSHLVLTANAATSRTNLTGENNVFAAKQAWRIGNYVEPIVTTIIGLRHMCLEATDNDTNVWLESCVKNKTKQYWALYSDDTIRVNNNRNLCVSSSTDSSSKLIVIRRCDGSINQRWVFTPQGTISNPGYEAVMDVAQNDVYLKKIVLSSATDKGNGQQWTVFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA N-glycosidase
publication title Structural studies on a non-toxic homologue of type II RIPs from bitter gourd: Molecular basis of non-toxicity, conformational selection and glycan structure.
pubmed rcsb
molecule tags Hydrolase
total genus 77
structure length 261
sequence length 261
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfuB01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfuB02
4F83A 3A07A 1BASA 4AN7B 1CVSA 4OEFA 1R8NA 3WO4A 2KLLA 1CE7B 2MLLB 1A8DA 4X39A 3PMEA 5F8WA 4Q9GA 4IYBA 4GOVA 3ZXDA 3UDAA 3T8SA 4G1RA 4ZOTA 4I4QA 2Q3NB 3FFZA 4QC4A 5HPZA 2VXRA 3V79C 3H6RB 3QYDA 3AH2A 3P53A 1G9BA 2Z48A 2NM1A 5BXRA 1DJSB 3A21A 3ILAA 2D1ZA 4G9MA 4I37A 1YTOA 1I1BA 1HWPB 2K43A 1G9AA 5I1BA 5D61A 3NBCA 3OJVA 21BIA 1IHKA 3IM5A 4OWJA 1S0DA 4QKSA 2FO1A 3BAOA 4P0LA 4OUJA 3NJ5A 3JRRA 9ILBA 1Q1UA 4OW4A 4KEIA 3O44A 1ISWA 4CJMA 4KBBA 3FJHA 1FMMS 1V6UA 3K1XA 4I8MA 3VSZA 3V0AB 3FJIA 4XFSA 3FJKA 1TOOA 5E24E 3CRIA 2NTDA 3Q7YA 1J0SA 2NVHA 5D62A 2FGFA 4QKRA 4USPA 3JUTA 1HKNA 3CRHA 2RSTA 4A7ZA 4I1BA 3WMUA 4EFQA 1XG6A 3UJ0A 4I4SA 4ZFYB 1OQLB 1WD3A 5BOWA 4DEPA 1JT4A 3H6QA 3N7LA 4USOA 3BA4A 1FWVA 1Q03A 3RSJA 1HIBA 4D8HA 1NZKA 2FDBM 4I2SA 2NYYA 1FV2A 3CU1B 1EYLA 1RY7A 4II0A 4ZFUB 4IY9A 3AH4A 2F8XC 2VUAA 3HOMA 1W3AA 4XFTA 5EHAA 1AFCA 2D22A 5GAQA 2VLCA 3BAHA 41BIA 2UUSA 3E8LC 2J3PA 1BLAA 4EEEB 3A22A 1AVWB 4X37A 1DQOA 3BRGC 4IQPA 2GO2A 3I2XA 2NP0A 3RTIB 1Z4SA 2E4MC 4A7YA 2Q9XA 3QR5A 1HWNB 3FJJA 5DSSB 4Z8SB 4XFUA 4QBCA 3BADA 1TFMB 3O4AA 4R6UB 1MC9A 4LO8B 3FGMA 2YUGA 5DZUA 5F8SA 3HN1A 2QYIB 3N7JA 2D20A 2HWAA 2VSAA 2KI6B 3VUOA 3V0AA 1ONKB 3AKHA 3LTQA 3TC2A 4LO0C 4Q91A 2ESUA 2Z49A 1MD6A 4JAWA 2I1BA 4X38A 3OBRA 3O3QA 1EPWA 3V0BB 1DZCA 4I4VA 2Y9FA 3AZVA 1JTCA 1QQLA 4ZKTB 1JLYA 4ENDA 2D23A 2Y9GA 4LO0A 1S0EA 2XOAA 1ISVA 4L4HA 3O4BA 1M2TB 4I4PA 2BEAA 2MC2A 1S0BA 2VXTI 2DS0A 5DVHA 4WBCA 3IM6A 4DENA 5JLVA 1AVUA 3MPPG 4LO2C 3FJAA 2P23A 5FZUA 2Y9WC 3F1RA 2M49A 3P6JA 3SNVA 3AKIA 1S0CA 4KEKA 1WBCA 3ZXGA 1WBAA 4OEGA 5BXTA 1G82A 3FJ8A 3IAGC 2ET2A 1N4KA 2WBCA 4JQ0A 4LO2A 4ZA3B 4H04A 3PUBA 2ZQNA 3BAQA 4J2SA 1QQKA 4QD2C 4LO7C 1ILR1 3W9TA 1ISYA 1BFCA 4IZXA 1SR4C 5FNWA 4HJJA 3WO3A 2DREA 1UPSA 3HSMA 2LIQA 4G9NA 3HMYA 1FWUA 2BFHA 8I1BA 3FJDA 1DFCA 1S0FA 2HWMA 2R9KB 4P0KA 4IONA 1E0OA 4QBVA 3S8JA 4A7KA 1M16A 3POKA 1SR4A 1JT7A 4HR6C 1DIWA 2DRYA 2K8RA 3BAGA 1KNMA 4EB2B 3OGFA 4I4RA 3AJ5A 1FN0A 2KH2A 3N7KA 5DUYA 3AKGA 3O5WB 2DRZA 4I3NA 4I7IA 1IJTA 3CQAA 3VT0A 1S0LA 3FJFA 2AXMA 3H6RA 1YF8B 2GZBA 3RTJB 4EFPA 4TLPA 2X2TA 2D43A 1JT5A 4G6MA 4LO3C 31BIA 1G9DA 2NZ9A 4JKQA 4L4IA 4JRAA 3RMYA 5G00A 5JMCA 3CA3A 3H6SE 1AVXB 1RG8A 3S8KA 2ZR1B 4GP3A 1TWEA 1V6VA 5BP5C 1RMLA 1I1EA 4LO3A 3IM7A 3FJEA 5FZZA 3NBNA 3O4OA 2P39A 1T4QA 4JKXB 1EVTA 3ZC9A 3BA7A 2HZ9A 2MIBA 4EKXB 3PHZA 3NBEA 1YBIA 2KKIA 5FNXA 1SZ6B 1S0GA 3FJBA 5BXSA 2X2SA 5BP5A 3LLPA 4J2YA 1AXMA 5EC5A 1FGAA 3RMXA 1ISZA 4YOLA 5F8YA 4P0JA 2ZQOA 3FUQA 4PC4A 1IT0A 5D63A 5BQUC 3N0KA 2RG9B 3BAUA 3D7WB 1WD4A 2D7IA 4DCKC 3I2AA 1XZZA 3AZWA 1W3GA 3CA6A 3CA0A 1TP0A 1JLXA 3FJCA 4Z9WB 3O49A 3P6IA 2HW9A 1DZDA 2F2FC 1TTUA 4AN6A 4GOYA 5BQUA 3UD7A 1Z2VA 4OWLA 4P6AA 3HALA 3OJ2A 4HA2A 3R4UA 3Q7WA 4QALA 1ITBA 3BRFA 2VU9A 3O4CA 3VEQA 2F2FA 2BEBA 4OWKA 4ISRA 3ZX7A 2IHOA 4IZEA 1FV3A 1G9CA 4KC3A 4JPZA 4I4YA 1BFBA 1YYNA 1ABRB 1K5VA 4LO1C 1BLDA 6I1BA 2Y9XE 3Q7XA 4IY8A 1XYFA 4OEEA 2AQZA 3OBTA 1JY0A 1BA7A 4ZLBB 1PUUB 1PWAA 4Q9PA 1Q04A 1GGPB 4H9WA 1P63A 1FQ9A 1K5UA 2AFGA 1XHBA 1VCLA 3O4DA 4LO1A 4GAFA 4GAIA 1HWOB 4IHZA 3WMVA 1BFGA 3CA5A 4GP0A 3WO2A 1IRAX 1DFQA 1L2HA 3VSFA 3V0BA 3CA4A 4ZGRB 5EG6C 1D0HA 4FGFA 3AKFA 2KI4A 3UD9A 1NUNA 3BTAA 4I6IA 4J23B 3A23A 3PG0A 1TWMA 2RQ9A 3R4SA 2D7RA 4KEJA 1IRPA 5BVPI 4FVVA 5BXPA 3CA1A 3BAVA 4JP0A 1PUMB 7I1BA 4I4OA 3N7MA 4I96A 1F31A 3EF2A 4I0YA 4J2KA 1AVAC 4QO3A 4J2XA 1FMZA 3BX1C 4G6JA 3I29B 3WINC 3OJMA 2FFVA 1R8OA 1YXWA 1AF9A 3AJ6A 5B2HA 1BARA 4X3AA 5FZYA 1II4A 3BB2A 2VSEA 3BRDA 1V6WA 4D0TA 4EFRA 1V6XA 1HWMB 1BFFA 3FJ9A 3F62B 3B9UA 1TIEA 3WINA 3UJ4A 3CRGA 2D44A 2LIEA 1DLLA 1DQGA 1JT3A 1T9FA 3OGGA 3C9ZA 3VWCA 2K4AB 3NBDA 1IOBA 2WRYA 3HBWA 3MALA 1JQZA 4D0ZA 2FFUA 3VT1A 2QN4A 4XKIA 1Z0HA 4ISQA 2ERMA 3UD8A 4I1EA 5F90A 4ZFWB 4F34A 1EV2A 3CAHA 2L5XA 3BA5A 3KMVA 4ZBVB 3WA1A 4I4XA 2D24A 4I4UA 1QXMA 2E4MA 2AAIB 3FUOA 1PC8B 1RZOB 3ZC8A 1ISXA 1PZZA 1HCEA 1IILA 3VT2A 3IIRA 1W3FA 1HCDA 4QD2B 4LO7B 2IWTB 3AH1A
chains in the Genus database with same CATH superfamily
4F83A 3A07A 1BASA 4AN7B 1CVSA 4OEFA 1R8NA 3WO4A 2KLLA 1CE7B 2MLLB 1A8DA 4X39A 3PMEA 5F8WA 4Q9GA 4IYBA 4GOVA 3ZXDA 3UDAA 3T8SA 4G1RA 4ZOTA 4UY4A 4I4QA 2Q3NB 3FFZA 4QC4A 5HPZA 2VXRA 3V79C 3H6RB 3QYDA 3AH2A 3P53A 1G9BA 2Z48A 2NM1A 5BXRA 1DJSB 3A21A 3ILAA 2D1ZA 4G9MA 4I37A 1YTOA 1I1BA 1HWPB 2K43A 1G9AA 5I1BA 2NS2A 5D61A 3NBCA 3OJVA 4MZHA 21BIA 1IHKA 3IM5A 4OWJA 1S0DA 4QKSA 2FO1A 3BAOA 4P0LA 4OUJA 3NJ5A 3JRRA 9ILBA 1Q1UA 4OW4A 4KEIA 3O44A 1ISWA 4CJMA 4KBBA 3FJHA 1FMMS 1V6UA 3K1XA 4I8MA 3VSZA 3V0AB 3FJIA 4XFSA 3FJKA 1TOOA 5E24E 3CRIA 2NTDA 3Q7YA 1J0SA 2NVHA 4MZFB 5D62A 2FGFA 4QKRA 4USPA 3JUTA 1HKNA 3CRHA 2RSTA 4A7ZA 4I1BA 3WMUA 4EFQA 1XG6A 3UJ0A 4I4SA 4ZFYB 1OQLB 1WD3A 5BOWA 4DEPA 1JT4A 3H6QA 3N7LA 4USOA 3BA4A 1FWVA 1Q03A 3RSJA 1HIBA 4D8HA 1NZKA 2FDBM 4I2SA 2NYYA 1FV2A 3CU1B 1EYLA 1RY7A 4II0A 4ZFUB 4IY9A 3AH4A 2F8XC 2VUAA 3HOMA 1W3AA 4XFTA 5EHAA 1AFCA 2D22A 5GAQA 2VLCA 3BAHA 41BIA 2UUSA 3E8LC 2J3PA 1BLAA 4EEEB 3A22A 1AVWB 4X37A 1DQOA 3BRGC 4IQPA 2GO2A 3I2XA 2NP0A 3RTIB 1Z4SA 2E4MC 4A7YA 2Q9XA 3QR5A 1HWNB 3FJJA 5DSSB 4Z8SB 4XFUA 4QBCA 3BADA 1TFMB 3O4AA 4MZGB 4R6UB 1MC9A 4LO8B 3FGMA 2YUGA 5DZUA 5F8SA 3HN1A 2QYIB 3N7JA 2D20A 2HWAA 2VSAA 2KI6B 3VUOA 3V0AA 1ONKB 3AKHA 3LTQA 3TC2A 4LO0C 4Q91A 2ESUA 2Z49A 1MD6A 4JAWA 2I1BA 4X38A 3OBRA 3O3QA 1EPWA 3V0BB 1DZCA 4I4VA 2Y9FA 3AZVA 1JTCA 1QQLA 4ZKTB 1JLYA 4ENDA 2D23A 2Y9GA 4LO0A 1S0EA 2XOAA 1ISVA 4L4HA 3O4BA 1M2TB 4I4PA 2BEAA 2MC2A 1S0BA 2VXTI 2DS0A 5DVHA 4WBCA 3IM6A 4DENA 5JLVA 1AVUA 3MPPG 4LO2C 3FJAA 2P23A 5FZUA 2Y9WC 3F1RA 2M49A 3P6JA 3SNVA 3AKIA 1S0CA 4KEKA 1WBCA 3ZXGA 1WBAA 4OEGA 5BXTA 1G82A 3FJ8A 3IAGC 2ET2A 1N4KA 2WBCA 4JQ0A 4LO2A 4ZA3B 4H04A 3PUBA 2ZQNA 3BAQA 4J2SA 1QQKA 4QD2C 4LO7C 1ILR1 3W9TA 1ISYA 1BFCA 4IZXA 1SR4C 5FNWA 4HJJA 3WO3A 2DREA 1UPSA 3HSMA 2LIQA 4G9NA 3HMYA 1FWUA 2BFHA 8I1BA 3FJDA 1DFCA 1S0FA 2HWMA 2R9KB 4P0KA 4IONA 1E0OA 4QBVA 3S8JA 4A7KA 1M16A 3POKA 1SR4A 1JT7A 4HR6C 1DIWA 2DRYA 2K8RA 3BAGA 1KNMA 4EB2B 3OGFA 4I4RA 3AJ5A 1FN0A 2KH2A 3N7KA 5DUYA 4H75A 3AKGA 3O5WB 2DRZA 4I3NA 4I7IA 1IJTA 3CQAA 3VT0A 1S0LA 3FJFA 2AXMA 3H6RA 1YF8B 2GZBA 3RTJB 4EFPA 4TLPA 2X2TA 2D43A 1JT5A 4G6MA 4LO3C 31BIA 1G9DA 2NZ9A 4JKQA 4L4IA 4JRAA 3RMYA 5G00A 5JMCA 3CA3A 3H6SE 1AVXB 1RG8A 3S8KA 2ZR1B 4GP3A 1TWEA 1V6VA 5BP5C 1RMLA 1I1EA 4LO3A 3IM7A 3FJEA 5FZZA 3NBNA 3O4OA 2P39A 1T4QA 4JKXB 1EVTA 3ZC9A 3BA7A 2HZ9A 2MIBA 4EKXB 3PHZA 3NBEA 1YBIA 2KKIA 5FNXA 1SZ6B 1S0GA 3FJBA 5BXSA 2X2SA 5BP5A 3LLPA 4J2YA 1AXMA 5EC5A 1FGAA 3RMXA 1ISZA 4YOLA 5F8YA 4P0JA 2ZQOA 3FUQA 4PC4A 1IT0A 5D63A 5BQUC 3N0KA 2RG9B 3BAUA 3D7WB 1WD4A 2D7IA 4DCKC 3I2AA 1XZZA 3AZWA 1W3GA 3CA6A 3CA0A 1TP0A 1JLXA 3FJCA 4Z9WB 3O49A 3P6IA 2HW9A 1DZDA 2F2FC 1TTUA 4AN6A 4GOYA 5BQUA 3UD7A 1Z2VA 4OWLA 4P6AA 3HALA 3OJ2A 4HA2A 3R4UA 3Q7WA 4QALA 1ITBA 3BRFA 2VU9A 3O4CA 3VEQA 2F2FA 2BEBA 4OWKA 4ISRA 3ZX7A 2IHOA 4IZEA 1FV3A 1G9CA 4KC3A 4JPZA 4I4YA 1BFBA 1YYNA 1ABRB 1K5VA 4LO1C 1BLDA 6I1BA 2Y9XE 3Q7XA 4IY8A 1XYFA 4OEEA 2AQZA 3OBTA 1JY0A 1BA7A 4ZLBB 1PUUB 1PWAA 4Q9PA 1Q04A 1GGPB 4H9WA 1P63A 1FQ9A 1K5UA 2AFGA 1XHBA 1VCLA 3O4DA 4LO1A 4GAFA 4GAIA 1HWOB 4IHZA 3WMVA 1BFGA 3CA5A 4GP0A 3WO2A 1IRAX 1DFQA 1L2HA 3VSFA 3V0BA 3CA4A 4ZGRB 5EG6C 1D0HA 4FGFA 3AKFA 2KI4A 3UD9A 1NUNA 3BTAA 4I6IA 4J23B 3A23A 3PG0A 1TWMA 2RQ9A 3R4SA 2D7RA 4KEJA 1IRPA 5BVPI 4FVVA 5BXPA 3CA1A 3BAVA 4JP0A 1PUMB 7I1BA 4I4OA 3N7MA 4I96A 1F31A 3EF2A 4I0YA 4J2KA 1AVAC 4QO3A 4J2XA 1FMZA 3BX1C 4G6JA 3I29B 3WINC 3OJMA 2FFVA 1R8OA 1YXWA 1AF9A 3AJ6A 5B2HA 1BARA 4X3AA 5FZYA 1II4A 3BB2A 2VSEA 3BRDA 1V6WA 4D0TA 4EFRA 1V6XA 1HWMB 1BFFA 3FJ9A 3F62B 3B9UA 1TIEA 3WINA 3UJ4A 3CRGA 2D44A 2LIEA 1DLLA 1DQGA 1JT3A 1T9FA 3OGGA 3C9ZA 3VWCA 2K4AB 3NBDA 1IOBA 2WRYA 3HBWA 3MALA 1JQZA 4D0ZA 2FFUA 3VT1A 2QN4A 4XKIA 1Z0HA 4ISQA 2ERMA 3UD8A 4I1EA 5F90A 4ZFWB 4F34A 1EV2A 3CAHA 2L5XA 3BA5A 3KMVA 4ZBVB 3WA1A 4I4XA 2D24A 4I4UA 1QXMA 2E4MA 2AAIB 3FUOA 1PC8B 1RZOB 3ZC8A 1ISXA 1PZZA 1HCEA 1IILA 3VT2A 3IIRA 1W3FA 1HCDA 4QD2B 4LO7B 2IWTB 3AH1A
chains in the Genus database with same CATH topology
4F83A 3A07A 1BASA 4AN7B 1CVSA 4OEFA 1R8NA 3WO4A 2KLLA 1CE7B 2MLLB 1A8DA 4X39A 3PMEA 5F8WA 4Q9GA 4IYBA 4GOVA 3ZXDA 3UDAA 3T8SA 4G1RA 4ZOTA 4UY4A 4I4QA 2Q3NB 3FFZA 4QC4A 5HPZA 2VXRA 3V79C 3H6RB 3QYDA 3AH2A 3P53A 1G9BA 2Z48A 2NM1A 5BXRA 1DJSB 3A21A 3ILAA 2D1ZA 4G9MA 4I37A 1YTOA 1I1BA 1HWPB 2K43A 1G9AA 5I1BA 2NS2A 5D61A 3NBCA 3OJVA 4MZHA 21BIA 1IHKA 3IM5A 4OWJA 1S0DA 4QKSA 2FO1A 3BAOA 4P0LA 4OUJA 3NJ5A 3JRRA 9ILBA 1Q1UA 4OW4A 4KEIA 3O44A 1ISWA 4CJMA 4KBBA 3FJHA 1FMMS 1V6UA 3K1XA 4I8MA 3VSZA 3V0AB 3FJIA 4XFSA 3FJKA 1TOOA 5E24E 3CRIA 2NTDA 3Q7YA 1J0SA 2NVHA 4MZFB 5D62A 2FGFA 4QKRA 4USPA 3JUTA 1HKNA 3CRHA 2RSTA 4A7ZA 4I1BA 3WMUA 4EFQA 1XG6A 3UJ0A 4I4SA 4ZFYB 1OQLB 1WD3A 5BOWA 4DEPA 1JT4A 3H6QA 3N7LA 4USOA 3BA4A 1FWVA 1Q03A 3RSJA 1HIBA 4D8HA 1NZKA 2FDBM 4I2SA 2NYYA 1FV2A 3CU1B 1EYLA 1RY7A 4II0A 4ZFUB 4IY9A 3AH4A 2F8XC 2VUAA 3HOMA 1W3AA 4XFTA 5EHAA 1AFCA 2D22A 5GAQA 2VLCA 3BAHA 41BIA 2UUSA 3E8LC 2J3PA 1BLAA 4EEEB 3A22A 1AVWB 4X37A 1DQOA 3BRGC 4IQPA 2GO2A 3I2XA 2NP0A 3RTIB 1Z4SA 2E4MC 4A7YA 2Q9XA 3QR5A 1HWNB 3FJJA 5DSSB 4Z8SB 4XFUA 4QBCA 3BADA 1TFMB 3O4AA 4MZGB 4R6UB 1MC9A 4LO8B 3FGMA 2YUGA 5DZUA 5F8SA 3HN1A 2QYIB 3N7JA 2D20A 2HWAA 2VSAA 2KI6B 3VUOA 3V0AA 1ONKB 3AKHA 3LTQA 3TC2A 4LO0C 4Q91A 2ESUA 2Z49A 1MD6A 4JAWA 2I1BA 4X38A 3OBRA 3O3QA 1EPWA 3V0BB 1DZCA 4I4VA 2Y9FA 3AZVA 1JTCA 1QQLA 4ZKTB 1JLYA 4ENDA 2D23A 2Y9GA 4LO0A 1S0EA 2XOAA 1ISVA 4L4HA 3O4BA 1M2TB 4I4PA 2BEAA 2MC2A 1S0BA 2VXTI 2DS0A 5DVHA 4WBCA 3IM6A 4DENA 5JLVA 1AVUA 3MPPG 4LO2C 3FJAA 2P23A 5FZUA 2Y9WC 3F1RA 2M49A 3P6JA 3SNVA 3AKIA 1S0CA 4KEKA 1WBCA 3ZXGA 1WBAA 4OEGA 5BXTA 1G82A 3FJ8A 3IAGC 2ET2A 1N4KA 2WBCA 4JQ0A 4LO2A 4ZA3B 4H04A 3PUBA 2ZQNA 3BAQA 4J2SA 1QQKA 4QD2C 4LO7C 1ILR1 3W9TA 1ISYA 1BFCA 4IZXA 1SR4C 5FNWA 4HJJA 3WO3A 2DREA 1UPSA 3HSMA 2LIQA 4G9NA 3HMYA 1FWUA 2BFHA 8I1BA 3FJDA 1DFCA 1S0FA 2HWMA 2R9KB 4P0KA 4IONA 1E0OA 4QBVA 3S8JA 4A7KA 1M16A 3POKA 1SR4A 1JT7A 4HR6C 1DIWA 2DRYA 2K8RA 3BAGA 1KNMA 4EB2B 3OGFA 4I4RA 3AJ5A 1FN0A 2KH2A 3N7KA 5DUYA 4H75A 3AKGA 3O5WB 2DRZA 4I3NA 4I7IA 1IJTA 3CQAA 3VT0A 1S0LA 3FJFA 2AXMA 3H6RA 1YF8B 2GZBA 3RTJB 4EFPA 4TLPA 2X2TA 2D43A 1JT5A 4G6MA 4LO3C 31BIA 1G9DA 2NZ9A 4JKQA 4L4IA 4JRAA 3RMYA 5G00A 5JMCA 3CA3A 3H6SE 1AVXB 1RG8A 3S8KA 2ZR1B 4GP3A 1TWEA 1V6VA 5BP5C 1RMLA 1I1EA 4LO3A 3IM7A 3FJEA 5FZZA 3NBNA 3O4OA 2P39A 1T4QA 4JKXB 1EVTA 3ZC9A 3BA7A 2HZ9A 2MIBA 4EKXB 3PHZA 3NBEA 1YBIA 2KKIA 5FNXA 1SZ6B 1S0GA 3FJBA 5BXSA 2X2SA 5BP5A 3LLPA 4J2YA 1AXMA 5EC5A 1FGAA 3RMXA 1ISZA 4YOLA 5F8YA 4P0JA 2ZQOA 3FUQA 4PC4A 1IT0A 5D63A 5BQUC 3N0KA 2RG9B 3BAUA 3D7WB 1WD4A 2D7IA 4DCKC 3I2AA 1XZZA 3AZWA 1W3GA 3CA6A 3CA0A 1TP0A 1JLXA 3FJCA 4Z9WB 3O49A 3P6IA 2HW9A 1DZDA 2F2FC 1TTUA 4AN6A 4GOYA 5BQUA 3UD7A 1Z2VA 4OWLA 4P6AA 3HALA 3OJ2A 4HA2A 3R4UA 3Q7WA 4QALA 1ITBA 3BRFA 2VU9A 3O4CA 3VEQA 2F2FA 2BEBA 4OWKA 4ISRA 3ZX7A 2IHOA 4IZEA 1FV3A 1G9CA 4KC3A 4JPZA 4I4YA 1BFBA 1YYNA 1ABRB 1K5VA 4LO1C 1BLDA 6I1BA 2Y9XE 3Q7XA 4IY8A 1XYFA 4OEEA 2AQZA 3OBTA 1JY0A 1BA7A 4ZLBB 1PUUB 1PWAA 4Q9PA 1Q04A 1GGPB 4H9WA 1P63A 1FQ9A 1K5UA 2AFGA 1XHBA 1VCLA 3O4DA 4LO1A 4GAFA 4GAIA 1HWOB 4IHZA 3WMVA 1BFGA 3CA5A 4GP0A 3WO2A 1IRAX 1DFQA 1L2HA 3VSFA 3V0BA 3CA4A 4ZGRB 5EG6C 1D0HA 4FGFA 3AKFA 2KI4A 3UD9A 1NUNA 3BTAA 4I6IA 4J23B 3A23A 3PG0A 1TWMA 2RQ9A 3R4SA 2D7RA 4KEJA 1IRPA 5BVPI 4FVVA 5BXPA 3CA1A 3BAVA 4JP0A 1PUMB 7I1BA 4I4OA 3N7MA 4I96A 1F31A 3EF2A 4I0YA 4J2KA 1AVAC 4QO3A 4J2XA 1FMZA 3BX1C 4G6JA 3I29B 3WINC 3OJMA 2FFVA 1R8OA 1YXWA 1AF9A 3AJ6A 5B2HA 1BARA 4X3AA 5FZYA 1II4A 3BB2A 2VSEA 3BRDA 1V6WA 4D0TA 4EFRA 1V6XA 1HWMB 1BFFA 3FJ9A 3F62B 3B9UA 1TIEA 3WINA 3UJ4A 3CRGA 2D44A 2LIEA 1DLLA 1DQGA 1JT3A 1T9FA 3OGGA 3C9ZA 3VWCA 2K4AB 3NBDA 1IOBA 2WRYA 3HBWA 3MALA 1JQZA 4D0ZA 2FFUA 3VT1A 2QN4A 4XKIA 1Z0HA 4ISQA 2ERMA 3UD8A 4I1EA 5F90A 4ZFWB 4F34A 1EV2A 3CAHA 2L5XA 3BA5A 3KMVA 4ZBVB 3WA1A 4I4XA 2D24A 4I4UA 1QXMA 2E4MA 2AAIB 3FUOA 1PC8B 1RZOB 3ZC8A 1ISXA 1PZZA 1HCEA 1IILA 3VT2A 3IIRA 1W3FA 1HCDA 4QD2B 4LO7B 2IWTB 3AH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F83 A;  3A07 A;  1BAS A;  4AN7 B;  1CVS A;  4OEF A;  1R8N A;  3WO4 A;  2KLL A;  1CE7 B;  2MLL B;  1A8D A;  4X39 A;  3PME A;  5F8W A;  4Q9G A;  4IYB A;  4GOV A;  3ZXD A;  3UDA A;  3T8S A;  4G1R A;  4ZOT A;  4I4Q A;  2Q3N B;  3FFZ A;  4QC4 A;  5HPZ A;  2VXR A;  3V79 C;  3H6R B;  3QYD A;  3AH2 A;  3P53 A;  1G9B A;  2Z48 A;  2NM1 A;  5BXR A;  1DJS B;  3A21 A;  3ILA A;  2D1Z A;  4G9M A;  4I37 A;  1YTO A;  1I1B A;  1HWP B;  2K43 A;  1G9A A;  5I1B A;  5D61 A;  3NBC A;  3OJV A;  21BI A;  1IHK A;  3IM5 A;  4OWJ A;  1S0D A;  4QKS A;  2FO1 A;  3BAO A;  4P0L A;  4OUJ A;  3NJ5 A;  3JRR A;  9ILB A;  1Q1U A;  4OW4 A;  4KEI A;  3O44 A;  1ISW A;  4CJM A;  4KBB A;  3FJH A;  1FMM S;  1V6U A;  3K1X A;  4I8M A;  3VSZ A;  3V0A B;  3FJI A;  4XFS A;  3FJK A;  1TOO A;  5E24 E;  3CRI A;  2NTD A;  3Q7Y A;  1J0S A;  2NVH A;  5D62 A;  2FGF A;  4QKR A;  4USP A;  3JUT A;  1HKN A;  3CRH A;  2RST A;  4A7Z A;  4I1B A;  3WMU A;  4EFQ A;  1XG6 A;  3UJ0 A;  4I4S A;  4ZFY B;  1OQL B;  1WD3 A;  5BOW A;  4DEP A;  1JT4 A;  3H6Q A;  3N7L A;  4USO A;  3BA4 A;  1FWV A;  1Q03 A;  3RSJ A;  1HIB A;  4D8H A;  1NZK A;  2FDB M;  4I2S A;  2NYY A;  1FV2 A;  3CU1 B;  1EYL A;  1RY7 A;  4II0 A;  4ZFU B;  4IY9 A;  3AH4 A;  2F8X C;  2VUA A;  3HOM A;  1W3A A;  4XFT A;  5EHA A;  1AFC A;  2D22 A;  5GAQ A;  2VLC A;  3BAH A;  41BI A;  2UUS A;  3E8L C;  2J3P A;  1BLA A;  4EEE B;  3A22 A;  1AVW B;  4X37 A;  1DQO A;  3BRG C;  4IQP A;  2GO2 A;  3I2X A;  2NP0 A;  3RTI B;  1Z4S A;  2E4M C;  4A7Y A;  2Q9X A;  3QR5 A;  1HWN B;  3FJJ A;  5DSS B;  4Z8S B;  4XFU A;  4QBC A;  3BAD A;  1TFM B;  3O4A A;  4R6U B;  1MC9 A;  4LO8 B;  3FGM A;  2YUG A;  5DZU A;  5F8S A;  3HN1 A;  2QYI B;  3N7J A;  2D20 A;  2HWA A;  2VSA A;  2KI6 B;  3VUO A;  3V0A A;  1ONK B;  3AKH A;  3LTQ A;  3TC2 A;  4LO0 C;  4Q91 A;  2ESU A;  2Z49 A;  1MD6 A;  4JAW A;  2I1B A;  4X38 A;  3OBR A;  3O3Q A;  1EPW A;  3V0B B;  1DZC A;  4I4V A;  2Y9F A;  3AZV A;  1JTC A;  1QQL A;  4ZKT B;  1JLY A;  4END A;  2D23 A;  2Y9G A;  4LO0 A;  1S0E A;  2XOA A;  1ISV A;  4L4H A;  3O4B A;  1M2T B;  4I4P A;  2BEA A;  2MC2 A;  1S0B A;  2VXT I;  2DS0 A;  5DVH A;  4WBC A;  3IM6 A;  4DEN A;  5JLV A;  1AVU A;  3MPP G;  4LO2 C;  3FJA A;  2P23 A;  5FZU A;  2Y9W C;  3F1R A;  2M49 A;  3P6J A;  3SNV A;  3AKI A;  1S0C A;  4KEK A;  1WBC A;  3ZXG A;  1WBA A;  4OEG A;  5BXT A;  1G82 A;  3FJ8 A;  3IAG C;  2ET2 A;  1N4K A;  2WBC A;  4JQ0 A;  4LO2 A;  4ZA3 B;  4H04 A;  3PUB A;  2ZQN A;  3BAQ A;  4J2S A;  1QQK A;  4QD2 C;  4LO7 C;  1ILR 1;  3W9T A;  1ISY A;  1BFC A;  4IZX A;  1SR4 C;  5FNW A;  4HJJ A;  3WO3 A;  2DRE A;  1UPS A;  3HSM A;  2LIQ A;  4G9N A;  3HMY A;  1FWU A;  2BFH A;  8I1B A;  3FJD A;  1DFC A;  1S0F A;  2HWM A;  2R9K B;  4P0K A;  4ION A;  1E0O A;  4QBV A;  3S8J A;  4A7K A;  1M16 A;  3POK A;  1SR4 A;  1JT7 A;  4HR6 C;  1DIW A;  2DRY A;  2K8R A;  3BAG A;  1KNM A;  4EB2 B;  3OGF A;  4I4R A;  3AJ5 A;  1FN0 A;  2KH2 A;  3N7K A;  5DUY A;  3AKG A;  3O5W B;  2DRZ A;  4I3N A;  4I7I A;  1IJT A;  3CQA A;  3VT0 A;  1S0L A;  3FJF A;  2AXM A;  3H6R A;  1YF8 B;  2GZB A;  3RTJ B;  4EFP A;  4TLP A;  2X2T A;  2D43 A;  1JT5 A;  4G6M A;  4LO3 C;  31BI A;  1G9D A;  2NZ9 A;  4JKQ A;  4L4I A;  4JRA A;  3RMY A;  5G00 A;  5JMC A;  3CA3 A;  3H6S E;  1AVX B;  1RG8 A;  3S8K A;  2ZR1 B;  4GP3 A;  1TWE A;  1V6V A;  5BP5 C;  1RML A;  1I1E A;  4LO3 A;  3IM7 A;  3FJE A;  5FZZ A;  3NBN A;  3O4O A;  2P39 A;  1T4Q A;  4JKX B;  1EVT A;  3ZC9 A;  3BA7 A;  2HZ9 A;  2MIB A;  4EKX B;  3PHZ A;  3NBE A;  1YBI A;  2KKI A;  5FNX A;  1SZ6 B;  1S0G A;  3FJB A;  5BXS A;  2X2S A;  5BP5 A;  3LLP A;  4J2Y A;  1AXM A;  5EC5 A;  1FGA A;  3RMX A;  1ISZ A;  4YOL A;  5F8Y A;  4P0J A;  2ZQO A;  3FUQ A;  4PC4 A;  1IT0 A;  5D63 A;  5BQU C;  3N0K A;  2RG9 B;  3BAU A;  3D7W B;  1WD4 A;  2D7I A;  4DCK C;  3I2A A;  1XZZ A;  3AZW A;  1W3G A;  3CA6 A;  3CA0 A;  1TP0 A;  1JLX A;  3FJC A;  4Z9W B;  3O49 A;  3P6I A;  2HW9 A;  1DZD A;  2F2F C;  1TTU A;  4AN6 A;  4GOY A;  5BQU A;  3UD7 A;  1Z2V A;  4OWL A;  4P6A A;  3HAL A;  3OJ2 A;  4HA2 A;  3R4U A;  3Q7W A;  4QAL A;  1ITB A;  3BRF A;  2VU9 A;  3O4C A;  3VEQ A;  2F2F A;  2BEB A;  4OWK A;  4ISR A;  3ZX7 A;  2IHO A;  4IZE A;  1FV3 A;  1G9C A;  4KC3 A;  4JPZ A;  4I4Y A;  1BFB A;  1YYN A;  1ABR B;  1K5V A;  4LO1 C;  1BLD A;  6I1B A;  2Y9X E;  3Q7X A;  4IY8 A;  1XYF A;  4OEE A;  2AQZ A;  3OBT A;  1JY0 A;  1BA7 A;  4ZLB B;  1PUU B;  1PWA A;  4Q9P A;  1Q04 A;  1GGP B;  4H9W A;  1P63 A;  1FQ9 A;  1K5U A;  2AFG A;  1XHB A;  1VCL A;  3O4D A;  4LO1 A;  4GAF A;  4GAI A;  1HWO B;  4IHZ A;  3WMV A;  1BFG A;  3CA5 A;  4GP0 A;  3WO2 A;  1IRA X;  1DFQ A;  1L2H A;  3VSF A;  3V0B A;  3CA4 A;  4ZGR B;  5EG6 C;  1D0H A;  4FGF A;  3AKF A;  2KI4 A;  3UD9 A;  1NUN A;  3BTA A;  4I6I A;  4J23 B;  3A23 A;  3PG0 A;  1TWM A;  2RQ9 A;  3R4S A;  2D7R A;  4KEJ A;  1IRP A;  5BVP I;  4FVV A;  5BXP A;  3CA1 A;  3BAV A;  4JP0 A;  1PUM B;  7I1B A;  4I4O A;  3N7M A;  4I96 A;  1F31 A;  3EF2 A;  4I0Y A;  4J2K A;  1AVA C;  4QO3 A;  4J2X A;  1FMZ A;  3BX1 C;  4G6J A;  3I29 B;  3WIN C;  3OJM A;  2FFV A;  1R8O A;  1YXW A;  1AF9 A;  3AJ6 A;  5B2H A;  1BAR A;  4X3A A;  5FZY A;  1II4 A;  3BB2 A;  2VSE A;  3BRD A;  1V6W A;  4D0T A;  4EFR A;  1V6X A;  1HWM B;  1BFF A;  3FJ9 A;  3F62 B;  3B9U A;  1TIE A;  3WIN A;  3UJ4 A;  3CRG A;  2D44 A;  2LIE A;  1DLL A;  1DQG A;  1JT3 A;  1T9F A;  3OGG A;  3C9Z A;  3VWC A;  2K4A B;  3NBD A;  1IOB A;  2WRY A;  3HBW A;  3MAL A;  1JQZ A;  4D0Z A;  2FFU A;  3VT1 A;  2QN4 A;  4XKI A;  1Z0H A;  4ISQ A;  2ERM A;  3UD8 A;  4I1E A;  5F90 A;  4ZFW B;  4F34 A;  1EV2 A;  3CAH A;  2L5X A;  3BA5 A;  3KMV A;  4ZBV B;  3WA1 A;  4I4X A;  2D24 A;  4I4U A;  1QXM A;  2E4M A;  2AAI B;  3FUO A;  1PC8 B;  1RZO B;  3ZC8 A;  1ISX A;  1PZZ A;  1HCE A;  1IIL A;  3VT2 A;  3IIR A;  1W3F A;  1HCD A;  4QD2 B;  4LO7 B;  2IWT B;  3AH1 A; 
#chains in the Genus database with same CATH topology
 4F83 A;  3A07 A;  1BAS A;  4AN7 B;  1CVS A;  4OEF A;  1R8N A;  3WO4 A;  2KLL A;  1CE7 B;  2MLL B;  1A8D A;  4X39 A;  3PME A;  5F8W A;  4Q9G A;  4IYB A;  4GOV A;  3ZXD A;  3UDA A;  3T8S A;  4G1R A;  4ZOT A;  4UY4 A;  4I4Q A;  2Q3N B;  3FFZ A;  4QC4 A;  5HPZ A;  2VXR A;  3V79 C;  3H6R B;  3QYD A;  3AH2 A;  3P53 A;  1G9B A;  2Z48 A;  2NM1 A;  5BXR A;  1DJS B;  3A21 A;  3ILA A;  2D1Z A;  4G9M A;  4I37 A;  1YTO A;  1I1B A;  1HWP B;  2K43 A;  1G9A A;  5I1B A;  2NS2 A;  5D61 A;  3NBC A;  3OJV A;  4MZH A;  21BI A;  1IHK A;  3IM5 A;  4OWJ A;  1S0D A;  4QKS A;  2FO1 A;  3BAO A;  4P0L A;  4OUJ A;  3NJ5 A;  3JRR A;  9ILB A;  1Q1U A;  4OW4 A;  4KEI A;  3O44 A;  1ISW A;  4CJM A;  4KBB A;  3FJH A;  1FMM S;  1V6U A;  3K1X A;  4I8M A;  3VSZ A;  3V0A B;  3FJI A;  4XFS A;  3FJK A;  1TOO A;  5E24 E;  3CRI A;  2NTD A;  3Q7Y A;  1J0S A;  2NVH A;  4MZF B;  5D62 A;  2FGF A;  4QKR A;  4USP A;  3JUT A;  1HKN A;  3CRH A;  2RST A;  4A7Z A;  4I1B A;  3WMU A;  4EFQ A;  1XG6 A;  3UJ0 A;  4I4S A;  4ZFY B;  1OQL B;  1WD3 A;  5BOW A;  4DEP A;  1JT4 A;  3H6Q A;  3N7L A;  4USO A;  3BA4 A;  1FWV A;  1Q03 A;  3RSJ A;  1HIB A;  4D8H A;  1NZK A;  2FDB M;  4I2S A;  2NYY A;  1FV2 A;  3CU1 B;  1EYL A;  1RY7 A;  4II0 A;  4ZFU B;  4IY9 A;  3AH4 A;  2F8X C;  2VUA A;  3HOM A;  1W3A A;  4XFT A;  5EHA A;  1AFC A;  2D22 A;  5GAQ A;  2VLC A;  3BAH A;  41BI A;  2UUS A;  3E8L C;  2J3P A;  1BLA A;  4EEE B;  3A22 A;  1AVW B;  4X37 A;  1DQO A;  3BRG C;  4IQP A;  2GO2 A;  3I2X A;  2NP0 A;  3RTI B;  1Z4S A;  2E4M C;  4A7Y A;  2Q9X A;  3QR5 A;  1HWN B;  3FJJ A;  5DSS B;  4Z8S B;  4XFU A;  4QBC A;  3BAD A;  1TFM B;  3O4A A;  4MZG B;  4R6U B;  1MC9 A;  4LO8 B;  3FGM A;  2YUG A;  5DZU A;  5F8S A;  3HN1 A;  2QYI B;  3N7J A;  2D20 A;  2HWA A;  2VSA A;  2KI6 B;  3VUO A;  3V0A A;  1ONK B;  3AKH A;  3LTQ A;  3TC2 A;  4LO0 C;  4Q91 A;  2ESU A;  2Z49 A;  1MD6 A;  4JAW A;  2I1B A;  4X38 A;  3OBR A;  3O3Q A;  1EPW A;  3V0B B;  1DZC A;  4I4V A;  2Y9F A;  3AZV A;  1JTC A;  1QQL A;  4ZKT B;  1JLY A;  4END A;  2D23 A;  2Y9G A;  4LO0 A;  1S0E A;  2XOA A;  1ISV A;  4L4H A;  3O4B A;  1M2T B;  4I4P A;  2BEA A;  2MC2 A;  1S0B A;  2VXT I;  2DS0 A;  5DVH A;  4WBC A;  3IM6 A;  4DEN A;  5JLV A;  1AVU A;  3MPP G;  4LO2 C;  3FJA A;  2P23 A;  5FZU A;  2Y9W C;  3F1R A;  2M49 A;  3P6J A;  3SNV A;  3AKI A;  1S0C A;  4KEK A;  1WBC A;  3ZXG A;  1WBA A;  4OEG A;  5BXT A;  1G82 A;  3FJ8 A;  3IAG C;  2ET2 A;  1N4K A;  2WBC A;  4JQ0 A;  4LO2 A;  4ZA3 B;  4H04 A;  3PUB A;  2ZQN A;  3BAQ A;  4J2S A;  1QQK A;  4QD2 C;  4LO7 C;  1ILR 1;  3W9T A;  1ISY A;  1BFC A;  4IZX A;  1SR4 C;  5FNW A;  4HJJ A;  3WO3 A;  2DRE A;  1UPS A;  3HSM A;  2LIQ A;  4G9N A;  3HMY A;  1FWU A;  2BFH A;  8I1B A;  3FJD A;  1DFC A;  1S0F A;  2HWM A;  2R9K B;  4P0K A;  4ION A;  1E0O A;  4QBV A;  3S8J A;  4A7K A;  1M16 A;  3POK A;  1SR4 A;  1JT7 A;  4HR6 C;  1DIW A;  2DRY A;  2K8R A;  3BAG A;  1KNM A;  4EB2 B;  3OGF A;  4I4R A;  3AJ5 A;  1FN0 A;  2KH2 A;  3N7K A;  5DUY A;  4H75 A;  3AKG A;  3O5W B;  2DRZ A;  4I3N A;  4I7I A;  1IJT A;  3CQA A;  3VT0 A;  1S0L A;  3FJF A;  2AXM A;  3H6R A;  1YF8 B;  2GZB A;  3RTJ B;  4EFP A;  4TLP A;  2X2T A;  2D43 A;  1JT5 A;  4G6M A;  4LO3 C;  31BI A;  1G9D A;  2NZ9 A;  4JKQ A;  4L4I A;  4JRA A;  3RMY A;  5G00 A;  5JMC A;  3CA3 A;  3H6S E;  1AVX B;  1RG8 A;  3S8K A;  2ZR1 B;  4GP3 A;  1TWE A;  1V6V A;  5BP5 C;  1RML A;  1I1E A;  4LO3 A;  3IM7 A;  3FJE A;  5FZZ A;  3NBN A;  3O4O A;  2P39 A;  1T4Q A;  4JKX B;  1EVT A;  3ZC9 A;  3BA7 A;  2HZ9 A;  2MIB A;  4EKX B;  3PHZ A;  3NBE A;  1YBI A;  2KKI A;  5FNX A;  1SZ6 B;  1S0G A;  3FJB A;  5BXS A;  2X2S A;  5BP5 A;  3LLP A;  4J2Y A;  1AXM A;  5EC5 A;  1FGA A;  3RMX A;  1ISZ A;  4YOL A;  5F8Y A;  4P0J A;  2ZQO A;  3FUQ A;  4PC4 A;  1IT0 A;  5D63 A;  5BQU C;  3N0K A;  2RG9 B;  3BAU A;  3D7W B;  1WD4 A;  2D7I A;  4DCK C;  3I2A A;  1XZZ A;  3AZW A;  1W3G A;  3CA6 A;  3CA0 A;  1TP0 A;  1JLX A;  3FJC A;  4Z9W B;  3O49 A;  3P6I A;  2HW9 A;  1DZD A;  2F2F C;  1TTU A;  4AN6 A;  4GOY A;  5BQU A;  3UD7 A;  1Z2V A;  4OWL A;  4P6A A;  3HAL A;  3OJ2 A;  4HA2 A;  3R4U A;  3Q7W A;  4QAL A;  1ITB A;  3BRF A;  2VU9 A;  3O4C A;  3VEQ A;  2F2F A;  2BEB A;  4OWK A;  4ISR A;  3ZX7 A;  2IHO A;  4IZE A;  1FV3 A;  1G9C A;  4KC3 A;  4JPZ A;  4I4Y A;  1BFB A;  1YYN A;  1ABR B;  1K5V A;  4LO1 C;  1BLD A;  6I1B A;  2Y9X E;  3Q7X A;  4IY8 A;  1XYF A;  4OEE A;  2AQZ A;  3OBT A;  1JY0 A;  1BA7 A;  4ZLB B;  1PUU B;  1PWA A;  4Q9P A;  1Q04 A;  1GGP B;  4H9W A;  1P63 A;  1FQ9 A;  1K5U A;  2AFG A;  1XHB A;  1VCL A;  3O4D A;  4LO1 A;  4GAF A;  4GAI A;  1HWO B;  4IHZ A;  3WMV A;  1BFG A;  3CA5 A;  4GP0 A;  3WO2 A;  1IRA X;  1DFQ A;  1L2H A;  3VSF A;  3V0B A;  3CA4 A;  4ZGR B;  5EG6 C;  1D0H A;  4FGF A;  3AKF A;  2KI4 A;  3UD9 A;  1NUN A;  3BTA A;  4I6I A;  4J23 B;  3A23 A;  3PG0 A;  1TWM A;  2RQ9 A;  3R4S A;  2D7R A;  4KEJ A;  1IRP A;  5BVP I;  4FVV A;  5BXP A;  3CA1 A;  3BAV A;  4JP0 A;  1PUM B;  7I1B A;  4I4O A;  3N7M A;  4I96 A;  1F31 A;  3EF2 A;  4I0Y A;  4J2K A;  1AVA C;  4QO3 A;  4J2X A;  1FMZ A;  3BX1 C;  4G6J A;  3I29 B;  3WIN C;  3OJM A;  2FFV A;  1R8O A;  1YXW A;  1AF9 A;  3AJ6 A;  5B2H A;  1BAR A;  4X3A A;  5FZY A;  1II4 A;  3BB2 A;  2VSE A;  3BRD A;  1V6W A;  4D0T A;  4EFR A;  1V6X A;  1HWM B;  1BFF A;  3FJ9 A;  3F62 B;  3B9U A;  1TIE A;  3WIN A;  3UJ4 A;  3CRG A;  2D44 A;  2LIE A;  1DLL A;  1DQG A;  1JT3 A;  1T9F A;  3OGG A;  3C9Z A;  3VWC A;  2K4A B;  3NBD A;  1IOB A;  2WRY A;  3HBW A;  3MAL A;  1JQZ A;  4D0Z A;  2FFU A;  3VT1 A;  2QN4 A;  4XKI A;  1Z0H A;  4ISQ A;  2ERM A;  3UD8 A;  4I1E A;  5F90 A;  4ZFW B;  4F34 A;  1EV2 A;  3CAH A;  2L5X A;  3BA5 A;  3KMV A;  4ZBV B;  3WA1 A;  4I4X A;  2D24 A;  4I4U A;  1QXM A;  2E4M A;  2AAI B;  3FUO A;  1PC8 B;  1RZO B;  3ZC8 A;  1ISX A;  1PZZ A;  1HCE A;  1IIL A;  3VT2 A;  3IIR A;  1W3F A;  1HCD A;  4QD2 B;  4LO7 B;  2IWT B;  3AH1 A; 
#chains in the Genus database with same CATH homology
 4F83 A;  3A07 A;  1BAS A;  4AN7 B;  1CVS A;  4OEF A;  1R8N A;  3WO4 A;  2KLL A;  1CE7 B;  2MLL B;  1A8D A;  4X39 A;  3PME A;  5F8W A;  4Q9G A;  4IYB A;  4GOV A;  3ZXD A;  3UDA A;  3T8S A;  4G1R A;  4ZOT A;  4UY4 A;  4I4Q A;  2Q3N B;  3FFZ A;  4QC4 A;  5HPZ A;  2VXR A;  3V79 C;  3H6R B;  3QYD A;  3AH2 A;  3P53 A;  1G9B A;  2Z48 A;  2NM1 A;  5BXR A;  1DJS B;  3A21 A;  3ILA A;  2D1Z A;  4G9M A;  4I37 A;  1YTO A;  1I1B A;  1HWP B;  2K43 A;  1G9A A;  5I1B A;  2NS2 A;  5D61 A;  3NBC A;  3OJV A;  4MZH A;  21BI A;  1IHK A;  3IM5 A;  4OWJ A;  1S0D A;  4QKS A;  2FO1 A;  3BAO A;  4P0L A;  4OUJ A;  3NJ5 A;  3JRR A;  9ILB A;  1Q1U A;  4OW4 A;  4KEI A;  3O44 A;  1ISW A;  4CJM A;  4KBB A;  3FJH A;  1FMM S;  1V6U A;  3K1X A;  4I8M A;  3VSZ A;  3V0A B;  3FJI A;  4XFS A;  3FJK A;  1TOO A;  5E24 E;  3CRI A;  2NTD A;  3Q7Y A;  1J0S A;  2NVH A;  4MZF B;  5D62 A;  2FGF A;  4QKR A;  4USP A;  3JUT A;  1HKN A;  3CRH A;  2RST A;  4A7Z A;  4I1B A;  3WMU A;  4EFQ A;  1XG6 A;  3UJ0 A;  4I4S A;  4ZFY B;  1OQL B;  1WD3 A;  5BOW A;  4DEP A;  1JT4 A;  3H6Q A;  3N7L A;  4USO A;  3BA4 A;  1FWV A;  1Q03 A;  3RSJ A;  1HIB A;  4D8H A;  1NZK A;  2FDB M;  4I2S A;  2NYY A;  1FV2 A;  3CU1 B;  1EYL A;  1RY7 A;  4II0 A;  4ZFU B;  4IY9 A;  3AH4 A;  2F8X C;  2VUA A;  3HOM A;  1W3A A;  4XFT A;  5EHA A;  1AFC A;  2D22 A;  5GAQ A;  2VLC A;  3BAH A;  41BI A;  2UUS A;  3E8L C;  2J3P A;  1BLA A;  4EEE B;  3A22 A;  1AVW B;  4X37 A;  1DQO A;  3BRG C;  4IQP A;  2GO2 A;  3I2X A;  2NP0 A;  3RTI B;  1Z4S A;  2E4M C;  4A7Y A;  2Q9X A;  3QR5 A;  1HWN B;  3FJJ A;  5DSS B;  4Z8S B;  4XFU A;  4QBC A;  3BAD A;  1TFM B;  3O4A A;  4MZG B;  4R6U B;  1MC9 A;  4LO8 B;  3FGM A;  2YUG A;  5DZU A;  5F8S A;  3HN1 A;  2QYI B;  3N7J A;  2D20 A;  2HWA A;  2VSA A;  2KI6 B;  3VUO A;  3V0A A;  1ONK B;  3AKH A;  3LTQ A;  3TC2 A;  4LO0 C;  4Q91 A;  2ESU A;  2Z49 A;  1MD6 A;  4JAW A;  2I1B A;  4X38 A;  3OBR A;  3O3Q A;  1EPW A;  3V0B B;  1DZC A;  4I4V A;  2Y9F A;  3AZV A;  1JTC A;  1QQL A;  4ZKT B;  1JLY A;  4END A;  2D23 A;  2Y9G A;  4LO0 A;  1S0E A;  2XOA A;  1ISV A;  4L4H A;  3O4B A;  1M2T B;  4I4P A;  2BEA A;  2MC2 A;  1S0B A;  2VXT I;  2DS0 A;  5DVH A;  4WBC A;  3IM6 A;  4DEN A;  5JLV A;  1AVU A;  3MPP G;  4LO2 C;  3FJA A;  2P23 A;  5FZU A;  2Y9W C;  3F1R A;  2M49 A;  3P6J A;  3SNV A;  3AKI A;  1S0C A;  4KEK A;  1WBC A;  3ZXG A;  1WBA A;  4OEG A;  5BXT A;  1G82 A;  3FJ8 A;  3IAG C;  2ET2 A;  1N4K A;  2WBC A;  4JQ0 A;  4LO2 A;  4ZA3 B;  4H04 A;  3PUB A;  2ZQN A;  3BAQ A;  4J2S A;  1QQK A;  4QD2 C;  4LO7 C;  1ILR 1;  3W9T A;  1ISY A;  1BFC A;  4IZX A;  1SR4 C;  5FNW A;  4HJJ A;  3WO3 A;  2DRE A;  1UPS A;  3HSM A;  2LIQ A;  4G9N A;  3HMY A;  1FWU A;  2BFH A;  8I1B A;  3FJD A;  1DFC A;  1S0F A;  2HWM A;  2R9K B;  4P0K A;  4ION A;  1E0O A;  4QBV A;  3S8J A;  4A7K A;  1M16 A;  3POK A;  1SR4 A;  1JT7 A;  4HR6 C;  1DIW A;  2DRY A;  2K8R A;  3BAG A;  1KNM A;  4EB2 B;  3OGF A;  4I4R A;  3AJ5 A;  1FN0 A;  2KH2 A;  3N7K A;  5DUY A;  4H75 A;  3AKG A;  3O5W B;  2DRZ A;  4I3N A;  4I7I A;  1IJT A;  3CQA A;  3VT0 A;  1S0L A;  3FJF A;  2AXM A;  3H6R A;  1YF8 B;  2GZB A;  3RTJ B;  4EFP A;  4TLP A;  2X2T A;  2D43 A;  1JT5 A;  4G6M A;  4LO3 C;  31BI A;  1G9D A;  2NZ9 A;  4JKQ A;  4L4I A;  4JRA A;  3RMY A;  5G00 A;  5JMC A;  3CA3 A;  3H6S E;  1AVX B;  1RG8 A;  3S8K A;  2ZR1 B;  4GP3 A;  1TWE A;  1V6V A;  5BP5 C;  1RML A;  1I1E A;  4LO3 A;  3IM7 A;  3FJE A;  5FZZ A;  3NBN A;  3O4O A;  2P39 A;  1T4Q A;  4JKX B;  1EVT A;  3ZC9 A;  3BA7 A;  2HZ9 A;  2MIB A;  4EKX B;  3PHZ A;  3NBE A;  1YBI A;  2KKI A;  5FNX A;  1SZ6 B;  1S0G A;  3FJB A;  5BXS A;  2X2S A;  5BP5 A;  3LLP A;  4J2Y A;  1AXM A;  5EC5 A;  1FGA A;  3RMX A;  1ISZ A;  4YOL A;  5F8Y A;  4P0J A;  2ZQO A;  3FUQ A;  4PC4 A;  1IT0 A;  5D63 A;  5BQU C;  3N0K A;  2RG9 B;  3BAU A;  3D7W B;  1WD4 A;  2D7I A;  4DCK C;  3I2A A;  1XZZ A;  3AZW A;  1W3G A;  3CA6 A;  3CA0 A;  1TP0 A;  1JLX A;  3FJC A;  4Z9W B;  3O49 A;  3P6I A;  2HW9 A;  1DZD A;  2F2F C;  1TTU A;  4AN6 A;  4GOY A;  5BQU A;  3UD7 A;  1Z2V A;  4OWL A;  4P6A A;  3HAL A;  3OJ2 A;  4HA2 A;  3R4U A;  3Q7W A;  4QAL A;  1ITB A;  3BRF A;  2VU9 A;  3O4C A;  3VEQ A;  2F2F A;  2BEB A;  4OWK A;  4ISR A;  3ZX7 A;  2IHO A;  4IZE A;  1FV3 A;  1G9C A;  4KC3 A;  4JPZ A;  4I4Y A;  1BFB A;  1YYN A;  1ABR B;  1K5V A;  4LO1 C;  1BLD A;  6I1B A;  2Y9X E;  3Q7X A;  4IY8 A;  1XYF A;  4OEE A;  2AQZ A;  3OBT A;  1JY0 A;  1BA7 A;  4ZLB B;  1PUU B;  1PWA A;  4Q9P A;  1Q04 A;  1GGP B;  4H9W A;  1P63 A;  1FQ9 A;  1K5U A;  2AFG A;  1XHB A;  1VCL A;  3O4D A;  4LO1 A;  4GAF A;  4GAI A;  1HWO B;  4IHZ A;  3WMV A;  1BFG A;  3CA5 A;  4GP0 A;  3WO2 A;  1IRA X;  1DFQ A;  1L2H A;  3VSF A;  3V0B A;  3CA4 A;  4ZGR B;  5EG6 C;  1D0H A;  4FGF A;  3AKF A;  2KI4 A;  3UD9 A;  1NUN A;  3BTA A;  4I6I A;  4J23 B;  3A23 A;  3PG0 A;  1TWM A;  2RQ9 A;  3R4S A;  2D7R A;  4KEJ A;  1IRP A;  5BVP I;  4FVV A;  5BXP A;  3CA1 A;  3BAV A;  4JP0 A;  1PUM B;  7I1B A;  4I4O A;  3N7M A;  4I96 A;  1F31 A;  3EF2 A;  4I0Y A;  4J2K A;  1AVA C;  4QO3 A;  4J2X A;  1FMZ A;  3BX1 C;  4G6J A;  3I29 B;  3WIN C;  3OJM A;  2FFV A;  1R8O A;  1YXW A;  1AF9 A;  3AJ6 A;  5B2H A;  1BAR A;  4X3A A;  5FZY A;  1II4 A;  3BB2 A;  2VSE A;  3BRD A;  1V6W A;  4D0T A;  4EFR A;  1V6X A;  1HWM B;  1BFF A;  3FJ9 A;  3F62 B;  3B9U A;  1TIE A;  3WIN A;  3UJ4 A;  3CRG A;  2D44 A;  2LIE A;  1DLL A;  1DQG A;  1JT3 A;  1T9F A;  3OGG A;  3C9Z A;  3VWC A;  2K4A B;  3NBD A;  1IOB A;  2WRY A;  3HBW A;  3MAL A;  1JQZ A;  4D0Z A;  2FFU A;  3VT1 A;  2QN4 A;  4XKI A;  1Z0H A;  4ISQ A;  2ERM A;  3UD8 A;  4I1E A;  5F90 A;  4ZFW B;  4F34 A;  1EV2 A;  3CAH A;  2L5X A;  3BA5 A;  3KMV A;  4ZBV B;  3WA1 A;  4I4X A;  2D24 A;  4I4U A;  1QXM A;  2E4M A;  2AAI B;  3FUO A;  1PC8 B;  1RZO B;  3ZC8 A;  1ISX A;  1PZZ A;  1HCE A;  1IIL A;  3VT2 A;  3IIR A;  1W3F A;  1HCD A;  4QD2 B;  4LO7 B;  2IWT B;  3AH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...