1G82A

Structure of fibroblast growth factor 9
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
157
structure length
157
Chain Sequence
TDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of fibroblast growth factor 9 shows a symmetric dimer with unique receptor- and heparin-binding interfaces.
pubmed doi rcsb
molecule keywords FIBROBLAST GROWTH FACTOR 9
molecule tags Hormone/growth factor
source organism Homo sapiens
total genus 41
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1g82A00
3P53A 2NM1A 3Q7WA 1ITBA 1FMMS 1L2HA 3OJMA 3CRIA 5I1BA 3Q7XA 1WD3A 1DQOA 4USPA 1K5VA 41BIA 3O44A 2MIBA 2M49A 4II0A 5HPZA 4XKIA 1W3FA 4I37A 1AVXB 4J2YA 1F31A 4JPZA 2D23A 3K1XA 1ABRB 1S0CA 1JY0A 1IRAX 3O3QA 4OWKA 4X39A 8I1BA 2HWAA 3NBNA 3CU1B 2FGFA 5BXTA 4IONA 4D8HA 3PG0A 3ZC8A 1V6WA 3W9TA 4YOLA 1FN0A 3BAOA 4ZKTB 4LO1C 4OWLA 2VU9A 1MD6A 1RY7A 2AQZA 1SZ6B 2L5XA 2Q9XA 4Z9WB 1TFMB 1PUUB 31BIA 5BXRA 4I4VA 2WBCA 3A22A 1AVUA 3S8JA 4DENA 2YUGA 2RQ9A 3CA1A 5G00A 2XOAA 2Y9XE 4LO1A 2F2FC 3I29B 4ZOTA 2QYIB 4Z8SB 1IILA 3FJDA 5BQUC 3HOMA 2KI6B 4LO8B 2HZ9A 2FO1A 3I2XA 4I96A 3VT0A 3ZXGA 1K5UA 2P23A 2RSTA 3OJVA 2FDBM 2R9KB 5BOWA 1G9AA 3WO4A 1JQZA 3OGGA 4IY9A 4GAIA 2F2FA 2Z49A 3R4UA 2VXTI 5GAQA 2VUAA 3HBWA 4I4XA 4OEFA 3FUOA 4EFPA 4A7ZA 3V79C 3H6RA 3WINC 4I3NA 3ZX7A 3UD8A 4DCKC 3IM5A 3AJ6A 2Z48A 4G6MA 1DFCA 1T4QA 4X3AA 3F62B 3PMEA 4L4IA 3HN1A 4CJMA 1FV2A 3AH2A 4Q9PA 1BFFA 4I4YA 3FJEA 2VLCA 2MLLB 3WINA 1G9CA 4X37A 2Y9GA 3O4AA 1IT0A 3FJJA 4JP0A 3S8KA 4HA2A 1V6VA 4I0YA 3O49A 2E4MA 1DLLA 3VEQA 3CRGA 4G1RA 1JT3A 3C9ZA 1D0HA 4G9NA 3V0AA 4LO7B 1JLXA 2RG9B 3FJ9A 1DJSB 2NYYA 4DEPA 1JLYA 5E24E 4JRAA 3UD9A 1N4KA 3JRRA 3KMVA 3FJ8A 2D1ZA 1EPWA 3FJIA 3NBCA 2NTDA 2GO2A 4KEIA 5FZUA 1ISYA 1BASA 3CRHA 2D44A 4H9WA 1TWMA 1ISWA 1T9FA 4ZA3B 3BA5A 4P6AA 3O4OA 4XFSA 5BVPI 5JLVA 1PZZA 1TWEA 1PWAA 3CA5A 4QKRA 4QBVA 4F83A 1TIEA 4LO2A 4GAFA 4F34A 1G9BA 2NZ9A 3MALA 3BAUA 3NJ5A 1R8NA 2P39A 3VSFA 4TLPA 1CVSA 4QALA 2IWTB 1S0DA 1EV2A 3A23A 3AKHA 4IYBA 4WBCA 5FZZA 3BRFA 4I1EA 3BADA 3E8LC 1DFQA 4USOA 1IOBA 1GGPB 3LLPA 3AJ5A 1Q03A 2K4AB 3P6IA 4G9MA 1HWOB 2BFHA 2DRZA 3POKA 1QXMA 4I4RA 2D20A 4LO3A 4LO0A 1TP0A 2MC2A 5FZYA 1AVAC 4I4QA 1Z0HA 1TOOA 3TC2A 5D62A 1BFGA 4I2SA 3N7MA 1ILR1 5D63A 1AFCA 3I2AA 4KC3A 4GOYA 3A21A 5BP5A 1YYNA 5F90A 1FWUA 5D61A 4OW4A 2J3PA 1IRPA 4Q91A 3N7KA 9ILBA 2DREA 1AVWB 4L4HA 1OQLB 3UJ4A 1W3GA 1JT5A 2LIQA 1M16A 5DSSB 3P6JA 3CA6A 3A07A 4OUJA 4EFRA 4EKXB 4ZGRB 3CA0A 2D43A 4HJJA 1V6XA 3PHZA 1PC8B 2Q3NB 2AAIB 1ISXA 4KBBA 5F8SA 1VCLA 4OWJA 1UPSA 2K8RA 4IY8A 4ISQA 1V6UA 2VXRA 3N7JA 1II4A 4OEGA 3BA4A 3N0KA 3FGMA 4KEKA 4QD2C 1YTOA 2E4MC 1BFCA 1AF9A 3H6SE 3SNVA 4I4OA 1IJTA 4ZBVB 3MPPG 4GP0A 4P0LA 3D7WB 1EVTA 3QYDA 2D24A 5B2HA 2VSEA 1JT4A 3FJBA 2HWMA 4QO3A 2NP0A 3IIRA 2F8XC 1FQ9A 2KI4A 3QR5A 3AKGA 1ONKB 3O5WB 4JAWA 1RZOB 2ET2A 1W3AA 2LIEA 2NVHA 2FFVA 3VT1A 4ENDA 5DVHA 2DRYA 2K43A 3FJAA 1MC9A 4IHZA 4QKSA 4LO7C 5BXPA 1S0FA 4I1BA 4A7YA 4J2KA 3WO3A 1M2TB 4KEJA 3ZC9A 2IHOA 4H04A 4LO2C 3RMYA 1S0LA 3F1RA 2GZBA 3FJCA 3AKIA 5JMCA 2VSAA 4P0JA 3H6QA 3OBTA 4AN6A 3BX1C 4JKQA 1HKNA 4LO0C 1HWMB 4LO3C 1WBCA 21BIA 5EG6C 4I8MA 1DZDA 4J2SA 3ILAA 3N7LA 1BA7A 1HCDA 1WD4A 1G9DA 4HR6C 3BB2A 2DS0A 5BP5C 4G6JA 1CE7B 3BTAA 3LTQA 2ESUA 3O4BA 3BRDA 1SR4A 4OEEA 1ISVA 4JKXB 2QN4A 5EHAA 1QQLA 2WRYA 2BEAA 3AZWA 3B9UA 3OGFA 5DUYA 3WO2A 1Z4SA 3FJHA 1TTUA 2FFUA 3BAQA 1I1EA 1NUNA 3RSJA 1BARA 2ZR1B 3AZVA 3FUQA 3BAVA 3NBEA 3O4DA 3WMUA 3RMXA 4QC4A 3UD7A 3IM7A 2AXMA 2Y9WC 1XG6A 7I1BA 1FV3A 4ISRA 5FNXA 3V0BB 4GOVA 4AN7B 4I4PA 1DQGA 1HIBA 4Q9GA 3BRGC 3IM6A 3HSMA 3IAGC 1WBAA 5EC5A 1ISZA 3T8SA 1HCEA 3CA4A 4XFTA 1E0OA 1XHBA 2BEBA 3AH4A 3Q7YA 4I4UA 2UUSA 4I6IA 4FGFA 2X2TA 1EYLA 1JT7A 3BAHA 1Z2VA 2KLLA 4PC4A 2KH2A 3OJ2A 3V0BA 3CQAA 4EEEB 3WMVA 4D0ZA 4EB2B 3H6RB 1KNMA 1RG8A 1A8DA 3FJKA 3BAGA 3HALA 4J23B 1S0EA 1FWVA 4D0TA 1P63A 1YF8B 1PUMB 3NBDA 1BLDA 3HMYA 4IQPA 2I1BA 1XZZA 1IHKA 3R4SA 4R6UB 3RTIB 1YBIA 2AFGA 3UDAA 1R8OA 3VSZA 1NZKA 5BQUA 5F8WA 4X38A 1S0BA 3VT2A 4ZFYB 3FFZA 4QD2B 3PUBA 3CAHA 1RMLA 3AKFA 2D7IA 4ZFWB 3V0AB 1BFBA 1FGAA 4I7IA 1G82A 4XFUA 1FMZA 2ZQOA 1BLAA 4GP3A 4I4SA 4QBCA 3O4CA 3BA7A 1HWNB 3AH1A 1JTCA 1HWPB 1QQKA 3JUTA 1Q04A 3UJ0A 5F8YA 3VWCA 4JQ0A 2HW9A 1YXWA 4IZEA 4FVVA 4A7KA 2ERMA 1I1BA 5BXSA 1S0GA 1J0SA 3FJFA 2Y9FA 4J2XA 1DZCA 2ZQNA 1DIWA 3WA1A 3ZXDA 1XYFA 3EF2A 1SR4C 2D7RA 3RTJB 4ZLBB 4IZXA 2D22A 2KKIA 4EFQA 5FNWA 1Q1UA 3VUOA 5DZUA 4ZFUB 4P0KA 1AXMA 3OBRA 6I1BA 2X2SA 3CA3A
chains in the Genus database with same CATH superfamily
3P53A 2NM1A 3Q7WA 1ITBA 1FMMS 1L2HA 3OJMA 3CRIA 5I1BA 3Q7XA 1WD3A 1DQOA 4USPA 1K5VA 41BIA 3O44A 2MIBA 2M49A 4II0A 5HPZA 4XKIA 1W3FA 4I37A 1AVXB 4J2YA 1F31A 4JPZA 2D23A 3K1XA 1ABRB 1S0CA 1JY0A 1IRAX 3O3QA 4OWKA 4X39A 8I1BA 2HWAA 3NBNA 3CU1B 2FGFA 5BXTA 4IONA 4D8HA 3PG0A 3ZC8A 1V6WA 3W9TA 4YOLA 1FN0A 3BAOA 4ZKTB 4LO1C 4OWLA 2VU9A 1MD6A 1RY7A 2AQZA 1SZ6B 2L5XA 2Q9XA 4Z9WB 1TFMB 1PUUB 31BIA 5BXRA 4I4VA 2WBCA 3A22A 1AVUA 3S8JA 4DENA 2YUGA 2RQ9A 3CA1A 5G00A 2XOAA 2Y9XE 4LO1A 2F2FC 3I29B 4ZOTA 2QYIB 4Z8SB 1IILA 3FJDA 5BQUC 3HOMA 2KI6B 4LO8B 2HZ9A 2FO1A 3I2XA 4I96A 3VT0A 3ZXGA 1K5UA 2P23A 2RSTA 3OJVA 2FDBM 2R9KB 5BOWA 1G9AA 3WO4A 1JQZA 3OGGA 4IY9A 4GAIA 2F2FA 2Z49A 3R4UA 2VXTI 5GAQA 2VUAA 3HBWA 4I4XA 4OEFA 3FUOA 4EFPA 4A7ZA 3V79C 3H6RA 3WINC 4I3NA 3ZX7A 3UD8A 4DCKC 3IM5A 3AJ6A 2Z48A 4G6MA 1DFCA 1T4QA 4X3AA 3F62B 3PMEA 4L4IA 3HN1A 4CJMA 1FV2A 3AH2A 4Q9PA 1BFFA 4I4YA 3FJEA 2VLCA 2MLLB 3WINA 1G9CA 4X37A 2Y9GA 3O4AA 1IT0A 3FJJA 4JP0A 3S8KA 4HA2A 1V6VA 4I0YA 3O49A 2E4MA 1DLLA 3VEQA 3CRGA 4G1RA 1JT3A 3C9ZA 1D0HA 4G9NA 3V0AA 4LO7B 1JLXA 2RG9B 3FJ9A 1DJSB 2NYYA 4DEPA 4H75A 1JLYA 5E24E 4MZGB 4JRAA 3UD9A 1N4KA 3JRRA 3KMVA 3FJ8A 2D1ZA 1EPWA 3FJIA 3NBCA 2NTDA 2GO2A 4KEIA 5FZUA 1ISYA 1BASA 3CRHA 2D44A 4H9WA 1TWMA 1ISWA 1T9FA 4ZA3B 3BA5A 4P6AA 3O4OA 4XFSA 5BVPI 5JLVA 1PZZA 1TWEA 1PWAA 3CA5A 4QKRA 4QBVA 4F83A 1TIEA 4LO2A 4GAFA 4F34A 1G9BA 2NZ9A 3MALA 3BAUA 3NJ5A 1R8NA 2P39A 3VSFA 4TLPA 1CVSA 4QALA 2IWTB 1S0DA 1EV2A 3A23A 3AKHA 4IYBA 4WBCA 5FZZA 3BRFA 4I1EA 3BADA 3E8LC 1DFQA 4USOA 1IOBA 1GGPB 3LLPA 3AJ5A 1Q03A 2K4AB 3P6IA 4G9MA 1HWOB 2BFHA 2DRZA 3POKA 1QXMA 4I4RA 2D20A 4LO3A 4LO0A 1TP0A 4MZHA 2MC2A 5FZYA 1AVAC 4I4QA 1Z0HA 1TOOA 2NS2A 3TC2A 5D62A 1BFGA 4I2SA 3N7MA 1ILR1 5D63A 1AFCA 3I2AA 4KC3A 4GOYA 3A21A 5BP5A 1YYNA 5F90A 1FWUA 5D61A 4OW4A 2J3PA 1IRPA 4Q91A 3N7KA 9ILBA 2DREA 1AVWB 4L4HA 1OQLB 3UJ4A 1W3GA 1JT5A 2LIQA 1M16A 5DSSB 3P6JA 3CA6A 3A07A 4OUJA 4EFRA 4EKXB 4ZGRB 3CA0A 2D43A 4HJJA 1V6XA 3PHZA 1PC8B 2Q3NB 2AAIB 1ISXA 4KBBA 5F8SA 1VCLA 4OWJA 1UPSA 2K8RA 4IY8A 4ISQA 1V6UA 2VXRA 3N7JA 1II4A 4OEGA 3BA4A 3N0KA 3FGMA 4KEKA 4QD2C 1YTOA 2E4MC 1BFCA 1AF9A 3H6SE 3SNVA 4I4OA 1IJTA 4ZBVB 3MPPG 4GP0A 4P0LA 3D7WB 1EVTA 3QYDA 2D24A 5B2HA 2VSEA 1JT4A 3FJBA 2HWMA 4QO3A 2NP0A 3IIRA 2F8XC 1FQ9A 2KI4A 3QR5A 3AKGA 1ONKB 3O5WB 4JAWA 1RZOB 2ET2A 1W3AA 2LIEA 2NVHA 2FFVA 3VT1A 4ENDA 5DVHA 2DRYA 2K43A 3FJAA 1MC9A 4IHZA 4QKSA 4LO7C 5BXPA 1S0FA 4I1BA 4A7YA 4J2KA 3WO3A 1M2TB 4KEJA 3ZC9A 2IHOA 4H04A 4LO2C 3RMYA 1S0LA 3F1RA 2GZBA 3FJCA 3AKIA 5JMCA 2VSAA 4P0JA 3H6QA 3OBTA 4AN6A 3BX1C 4JKQA 1HKNA 4LO0C 1HWMB 4LO3C 1WBCA 21BIA 5EG6C 4I8MA 1DZDA 4J2SA 3ILAA 3N7LA 1BA7A 1HCDA 1WD4A 1G9DA 4HR6C 3BB2A 2DS0A 5BP5C 4G6JA 1CE7B 3BTAA 3LTQA 2ESUA 3O4BA 3BRDA 1SR4A 4OEEA 1ISVA 4JKXB 2QN4A 5EHAA 1QQLA 2WRYA 2BEAA 3AZWA 3B9UA 3OGFA 5DUYA 3WO2A 1Z4SA 3FJHA 1TTUA 2FFUA 3BAQA 1I1EA 1NUNA 3RSJA 1BARA 2ZR1B 3AZVA 3FUQA 3BAVA 3NBEA 3O4DA 3WMUA 3RMXA 4QC4A 3UD7A 3IM7A 2AXMA 2Y9WC 1XG6A 7I1BA 1FV3A 4ISRA 5FNXA 3V0BB 4GOVA 4AN7B 4I4PA 1DQGA 1HIBA 4Q9GA 3BRGC 3IM6A 3HSMA 3IAGC 1WBAA 5EC5A 1ISZA 3T8SA 1HCEA 3CA4A 4XFTA 1E0OA 1XHBA 2BEBA 3AH4A 3Q7YA 4I4UA 2UUSA 4I6IA 4FGFA 2X2TA 1EYLA 1JT7A 3BAHA 1Z2VA 2KLLA 4PC4A 2KH2A 3OJ2A 3V0BA 3CQAA 4EEEB 3WMVA 4D0ZA 4EB2B 3H6RB 1KNMA 1RG8A 1A8DA 3FJKA 3BAGA 3HALA 4J23B 1S0EA 1FWVA 4D0TA 1P63A 1YF8B 1PUMB 3NBDA 1BLDA 3HMYA 4IQPA 2I1BA 1XZZA 1IHKA 3R4SA 4R6UB 4UY4A 3RTIB 1YBIA 2AFGA 3UDAA 1R8OA 3VSZA 1NZKA 5BQUA 5F8WA 4X38A 1S0BA 3VT2A 4ZFYB 3FFZA 4QD2B 3PUBA 3CAHA 1RMLA 3AKFA 2D7IA 4ZFWB 3V0AB 1BFBA 1FGAA 4I7IA 1G82A 4XFUA 1FMZA 2ZQOA 1BLAA 4GP3A 4I4SA 4QBCA 3O4CA 3BA7A 1HWNB 3AH1A 1JTCA 1HWPB 1QQKA 3JUTA 1Q04A 3UJ0A 5F8YA 3VWCA 4JQ0A 2HW9A 1YXWA 4IZEA 4FVVA 4A7KA 2ERMA 1I1BA 5BXSA 1S0GA 1J0SA 3FJFA 2Y9FA 4J2XA 1DZCA 2ZQNA 1DIWA 3WA1A 3ZXDA 1XYFA 3EF2A 1SR4C 2D7RA 3RTJB 4ZLBB 4IZXA 2D22A 2KKIA 4EFQA 5FNWA 1Q1UA 4MZFB 3VUOA 5DZUA 4ZFUB 4P0KA 1AXMA 3OBRA 6I1BA 2X2SA 3CA3A
chains in the Genus database with same CATH topology
3P53A 2NM1A 3Q7WA 1ITBA 1FMMS 1L2HA 3OJMA 3CRIA 5I1BA 3Q7XA 1WD3A 1DQOA 4USPA 1K5VA 41BIA 3O44A 2MIBA 2M49A 4II0A 5HPZA 4XKIA 1W3FA 4I37A 1AVXB 4J2YA 1F31A 4JPZA 2D23A 3K1XA 1ABRB 1S0CA 1JY0A 1IRAX 3O3QA 4OWKA 4X39A 8I1BA 2HWAA 3NBNA 3CU1B 2FGFA 5BXTA 4IONA 4D8HA 3PG0A 3ZC8A 1V6WA 3W9TA 4YOLA 1FN0A 3BAOA 4ZKTB 4LO1C 4OWLA 2VU9A 1MD6A 1RY7A 2AQZA 1SZ6B 2L5XA 2Q9XA 4Z9WB 1TFMB 1PUUB 31BIA 5BXRA 4I4VA 2WBCA 3A22A 1AVUA 3S8JA 4DENA 2YUGA 2RQ9A 3CA1A 5G00A 2XOAA 2Y9XE 4LO1A 2F2FC 3I29B 4ZOTA 2QYIB 4Z8SB 1IILA 3FJDA 5BQUC 3HOMA 2KI6B 4LO8B 2HZ9A 2FO1A 3I2XA 4I96A 3VT0A 3ZXGA 1K5UA 2P23A 2RSTA 3OJVA 2FDBM 2R9KB 5BOWA 1G9AA 3WO4A 1JQZA 3OGGA 4IY9A 4GAIA 2F2FA 2Z49A 3R4UA 2VXTI 5GAQA 2VUAA 3HBWA 4I4XA 4OEFA 3FUOA 4EFPA 4A7ZA 3V79C 3H6RA 3WINC 4I3NA 3ZX7A 3UD8A 4DCKC 3IM5A 3AJ6A 2Z48A 4G6MA 1DFCA 1T4QA 4X3AA 3F62B 3PMEA 4L4IA 3HN1A 4CJMA 1FV2A 3AH2A 4Q9PA 1BFFA 4I4YA 3FJEA 2VLCA 2MLLB 3WINA 1G9CA 4X37A 2Y9GA 3O4AA 1IT0A 3FJJA 4JP0A 3S8KA 4HA2A 1V6VA 4I0YA 3O49A 2E4MA 1DLLA 3VEQA 3CRGA 4G1RA 1JT3A 3C9ZA 1D0HA 4G9NA 3V0AA 4LO7B 1JLXA 2RG9B 3FJ9A 1DJSB 2NYYA 4DEPA 4H75A 1JLYA 5E24E 4MZGB 4JRAA 3UD9A 1N4KA 3JRRA 3KMVA 3FJ8A 2D1ZA 1EPWA 3FJIA 3NBCA 2NTDA 2GO2A 4KEIA 5FZUA 1ISYA 1BASA 3CRHA 2D44A 4H9WA 1TWMA 1ISWA 1T9FA 4ZA3B 3BA5A 4P6AA 3O4OA 4XFSA 5BVPI 5JLVA 1PZZA 1TWEA 1PWAA 3CA5A 4QKRA 4QBVA 4F83A 1TIEA 4LO2A 4GAFA 4F34A 1G9BA 2NZ9A 3MALA 3BAUA 3NJ5A 1R8NA 2P39A 3VSFA 4TLPA 1CVSA 4QALA 2IWTB 1S0DA 1EV2A 3A23A 3AKHA 4IYBA 4WBCA 5FZZA 3BRFA 4I1EA 3BADA 3E8LC 1DFQA 4USOA 1IOBA 1GGPB 3LLPA 3AJ5A 1Q03A 2K4AB 3P6IA 4G9MA 1HWOB 2BFHA 2DRZA 3POKA 1QXMA 4I4RA 2D20A 4LO3A 4LO0A 1TP0A 4MZHA 2MC2A 5FZYA 1AVAC 4I4QA 1Z0HA 1TOOA 2NS2A 3TC2A 5D62A 1BFGA 4I2SA 3N7MA 1ILR1 5D63A 1AFCA 3I2AA 4KC3A 4GOYA 3A21A 5BP5A 1YYNA 5F90A 1FWUA 5D61A 4OW4A 2J3PA 1IRPA 4Q91A 3N7KA 9ILBA 2DREA 1AVWB 4L4HA 1OQLB 3UJ4A 1W3GA 1JT5A 2LIQA 1M16A 5DSSB 3P6JA 3CA6A 3A07A 4OUJA 4EFRA 4EKXB 4ZGRB 3CA0A 2D43A 4HJJA 1V6XA 3PHZA 1PC8B 2Q3NB 2AAIB 1ISXA 4KBBA 5F8SA 1VCLA 4OWJA 1UPSA 2K8RA 4IY8A 4ISQA 1V6UA 2VXRA 3N7JA 1II4A 4OEGA 3BA4A 3N0KA 3FGMA 4KEKA 4QD2C 1YTOA 2E4MC 1BFCA 1AF9A 3H6SE 3SNVA 4I4OA 1IJTA 4ZBVB 3MPPG 4GP0A 4P0LA 3D7WB 1EVTA 3QYDA 2D24A 5B2HA 2VSEA 1JT4A 3FJBA 2HWMA 4QO3A 2NP0A 3IIRA 2F8XC 1FQ9A 2KI4A 3QR5A 3AKGA 1ONKB 3O5WB 4JAWA 1RZOB 2ET2A 1W3AA 2LIEA 2NVHA 2FFVA 3VT1A 4ENDA 5DVHA 2DRYA 2K43A 3FJAA 1MC9A 4IHZA 4QKSA 4LO7C 5BXPA 1S0FA 4I1BA 4A7YA 4J2KA 3WO3A 1M2TB 4KEJA 3ZC9A 2IHOA 4H04A 4LO2C 3RMYA 1S0LA 3F1RA 2GZBA 3FJCA 3AKIA 5JMCA 2VSAA 4P0JA 3H6QA 3OBTA 4AN6A 3BX1C 4JKQA 1HKNA 4LO0C 1HWMB 4LO3C 1WBCA 21BIA 5EG6C 4I8MA 1DZDA 4J2SA 3ILAA 3N7LA 1BA7A 1HCDA 1WD4A 1G9DA 4HR6C 3BB2A 2DS0A 5BP5C 4G6JA 1CE7B 3BTAA 3LTQA 2ESUA 3O4BA 3BRDA 1SR4A 4OEEA 1ISVA 4JKXB 2QN4A 5EHAA 1QQLA 2WRYA 2BEAA 3AZWA 3B9UA 3OGFA 5DUYA 3WO2A 1Z4SA 3FJHA 1TTUA 2FFUA 3BAQA 1I1EA 1NUNA 3RSJA 1BARA 2ZR1B 3AZVA 3FUQA 3BAVA 3NBEA 3O4DA 3WMUA 3RMXA 4QC4A 3UD7A 3IM7A 2AXMA 2Y9WC 1XG6A 7I1BA 1FV3A 4ISRA 5FNXA 3V0BB 4GOVA 4AN7B 4I4PA 1DQGA 1HIBA 4Q9GA 3BRGC 3IM6A 3HSMA 3IAGC 1WBAA 5EC5A 1ISZA 3T8SA 1HCEA 3CA4A 4XFTA 1E0OA 1XHBA 2BEBA 3AH4A 3Q7YA 4I4UA 2UUSA 4I6IA 4FGFA 2X2TA 1EYLA 1JT7A 3BAHA 1Z2VA 2KLLA 4PC4A 2KH2A 3OJ2A 3V0BA 3CQAA 4EEEB 3WMVA 4D0ZA 4EB2B 3H6RB 1KNMA 1RG8A 1A8DA 3FJKA 3BAGA 3HALA 4J23B 1S0EA 1FWVA 4D0TA 1P63A 1YF8B 1PUMB 3NBDA 1BLDA 3HMYA 4IQPA 2I1BA 1XZZA 1IHKA 3R4SA 4R6UB 4UY4A 3RTIB 1YBIA 2AFGA 3UDAA 1R8OA 3VSZA 1NZKA 5BQUA 5F8WA 4X38A 1S0BA 3VT2A 4ZFYB 3FFZA 4QD2B 3PUBA 3CAHA 1RMLA 3AKFA 2D7IA 4ZFWB 3V0AB 1BFBA 1FGAA 4I7IA 1G82A 4XFUA 1FMZA 2ZQOA 1BLAA 4GP3A 4I4SA 4QBCA 3O4CA 3BA7A 1HWNB 3AH1A 1JTCA 1HWPB 1QQKA 3JUTA 1Q04A 3UJ0A 5F8YA 3VWCA 4JQ0A 2HW9A 1YXWA 4IZEA 4FVVA 4A7KA 2ERMA 1I1BA 5BXSA 1S0GA 1J0SA 3FJFA 2Y9FA 4J2XA 1DZCA 2ZQNA 1DIWA 3WA1A 3ZXDA 1XYFA 3EF2A 1SR4C 2D7RA 3RTJB 4ZLBB 4IZXA 2D22A 2KKIA 4EFQA 5FNWA 1Q1UA 4MZFB 3VUOA 5DZUA 4ZFUB 4P0KA 1AXMA 3OBRA 6I1BA 2X2SA 3CA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P53 A;  2NM1 A;  3Q7W A;  1ITB A;  1FMM S;  1L2H A;  3OJM A;  3CRI A;  5I1B A;  3Q7X A;  1WD3 A;  1DQO A;  4USP A;  1K5V A;  41BI A;  3O44 A;  2MIB A;  2M49 A;  4II0 A;  5HPZ A;  4XKI A;  1W3F A;  4I37 A;  1AVX B;  4J2Y A;  1F31 A;  4JPZ A;  2D23 A;  3K1X A;  1ABR B;  1S0C A;  1JY0 A;  1IRA X;  3O3Q A;  4OWK A;  4X39 A;  8I1B A;  2HWA A;  3NBN A;  3CU1 B;  2FGF A;  5BXT A;  4ION A;  4D8H A;  3PG0 A;  3ZC8 A;  1V6W A;  3W9T A;  4YOL A;  1FN0 A;  3BAO A;  4ZKT B;  4LO1 C;  4OWL A;  2VU9 A;  1MD6 A;  1RY7 A;  2AQZ A;  1SZ6 B;  2L5X A;  2Q9X A;  4Z9W B;  1TFM B;  1PUU B;  31BI A;  5BXR A;  4I4V A;  2WBC A;  3A22 A;  1AVU A;  3S8J A;  4DEN A;  2YUG A;  2RQ9 A;  3CA1 A;  5G00 A;  2XOA A;  2Y9X E;  4LO1 A;  2F2F C;  3I29 B;  4ZOT A;  2QYI B;  4Z8S B;  1IIL A;  3FJD A;  5BQU C;  3HOM A;  2KI6 B;  4LO8 B;  2HZ9 A;  2FO1 A;  3I2X A;  4I96 A;  3VT0 A;  3ZXG A;  1K5U A;  2P23 A;  2RST A;  3OJV A;  2FDB M;  2R9K B;  5BOW A;  1G9A A;  3WO4 A;  1JQZ A;  3OGG A;  4IY9 A;  4GAI A;  2F2F A;  2Z49 A;  3R4U A;  2VXT I;  5GAQ A;  2VUA A;  3HBW A;  4I4X A;  4OEF A;  3FUO A;  4EFP A;  4A7Z A;  3V79 C;  3H6R A;  3WIN C;  4I3N A;  3ZX7 A;  3UD8 A;  4DCK C;  3IM5 A;  3AJ6 A;  2Z48 A;  4G6M A;  1DFC A;  1T4Q A;  4X3A A;  3F62 B;  3PME A;  4L4I A;  3HN1 A;  4CJM A;  1FV2 A;  3AH2 A;  4Q9P A;  1BFF A;  4I4Y A;  3FJE A;  2VLC A;  2MLL B;  3WIN A;  1G9C A;  4X37 A;  2Y9G A;  3O4A A;  1IT0 A;  3FJJ A;  4JP0 A;  3S8K A;  4HA2 A;  1V6V A;  4I0Y A;  3O49 A;  2E4M A;  1DLL A;  3VEQ A;  3CRG A;  4G1R A;  1JT3 A;  3C9Z A;  1D0H A;  4G9N A;  3V0A A;  4LO7 B;  1JLX A;  2RG9 B;  3FJ9 A;  1DJS B;  2NYY A;  4DEP A;  1JLY A;  5E24 E;  4JRA A;  3UD9 A;  1N4K A;  3JRR A;  3KMV A;  3FJ8 A;  2D1Z A;  1EPW A;  3FJI A;  3NBC A;  2NTD A;  2GO2 A;  4KEI A;  5FZU A;  1ISY A;  1BAS A;  3CRH A;  2D44 A;  4H9W A;  1TWM A;  1ISW A;  1T9F A;  4ZA3 B;  3BA5 A;  4P6A A;  3O4O A;  4XFS A;  5BVP I;  5JLV A;  1PZZ A;  1TWE A;  1PWA A;  3CA5 A;  4QKR A;  4QBV A;  4F83 A;  1TIE A;  4LO2 A;  4GAF A;  4F34 A;  1G9B A;  2NZ9 A;  3MAL A;  3BAU A;  3NJ5 A;  1R8N A;  2P39 A;  3VSF A;  4TLP A;  1CVS A;  4QAL A;  2IWT B;  1S0D A;  1EV2 A;  3A23 A;  3AKH A;  4IYB A;  4WBC A;  5FZZ A;  3BRF A;  4I1E A;  3BAD A;  3E8L C;  1DFQ A;  4USO A;  1IOB A;  1GGP B;  3LLP A;  3AJ5 A;  1Q03 A;  2K4A B;  3P6I A;  4G9M A;  1HWO B;  2BFH A;  2DRZ A;  3POK A;  1QXM A;  4I4R A;  2D20 A;  4LO3 A;  4LO0 A;  1TP0 A;  2MC2 A;  5FZY A;  1AVA C;  4I4Q A;  1Z0H A;  1TOO A;  3TC2 A;  5D62 A;  1BFG A;  4I2S A;  3N7M A;  1ILR 1;  5D63 A;  1AFC A;  3I2A A;  4KC3 A;  4GOY A;  3A21 A;  5BP5 A;  1YYN A;  5F90 A;  1FWU A;  5D61 A;  4OW4 A;  2J3P A;  1IRP A;  4Q91 A;  3N7K A;  9ILB A;  2DRE A;  1AVW B;  4L4H A;  1OQL B;  3UJ4 A;  1W3G A;  1JT5 A;  2LIQ A;  1M16 A;  5DSS B;  3P6J A;  3CA6 A;  3A07 A;  4OUJ A;  4EFR A;  4EKX B;  4ZGR B;  3CA0 A;  2D43 A;  4HJJ A;  1V6X A;  3PHZ A;  1PC8 B;  2Q3N B;  2AAI B;  1ISX A;  4KBB A;  5F8S A;  1VCL A;  4OWJ A;  1UPS A;  2K8R A;  4IY8 A;  4ISQ A;  1V6U A;  2VXR A;  3N7J A;  1II4 A;  4OEG A;  3BA4 A;  3N0K A;  3FGM A;  4KEK A;  4QD2 C;  1YTO A;  2E4M C;  1BFC A;  1AF9 A;  3H6S E;  3SNV A;  4I4O A;  1IJT A;  4ZBV B;  3MPP G;  4GP0 A;  4P0L A;  3D7W B;  1EVT A;  3QYD A;  2D24 A;  5B2H A;  2VSE A;  1JT4 A;  3FJB A;  2HWM A;  4QO3 A;  2NP0 A;  3IIR A;  2F8X C;  1FQ9 A;  2KI4 A;  3QR5 A;  3AKG A;  1ONK B;  3O5W B;  4JAW A;  1RZO B;  2ET2 A;  1W3A A;  2LIE A;  2NVH A;  2FFV A;  3VT1 A;  4END A;  5DVH A;  2DRY A;  2K43 A;  3FJA A;  1MC9 A;  4IHZ A;  4QKS A;  4LO7 C;  5BXP A;  1S0F A;  4I1B A;  4A7Y A;  4J2K A;  3WO3 A;  1M2T B;  4KEJ A;  3ZC9 A;  2IHO A;  4H04 A;  4LO2 C;  3RMY A;  1S0L A;  3F1R A;  2GZB A;  3FJC A;  3AKI A;  5JMC A;  2VSA A;  4P0J A;  3H6Q A;  3OBT A;  4AN6 A;  3BX1 C;  4JKQ A;  1HKN A;  4LO0 C;  1HWM B;  4LO3 C;  1WBC A;  21BI A;  5EG6 C;  4I8M A;  1DZD A;  4J2S A;  3ILA A;  3N7L A;  1BA7 A;  1HCD A;  1WD4 A;  1G9D A;  4HR6 C;  3BB2 A;  2DS0 A;  5BP5 C;  4G6J A;  1CE7 B;  3BTA A;  3LTQ A;  2ESU A;  3O4B A;  3BRD A;  1SR4 A;  4OEE A;  1ISV A;  4JKX B;  2QN4 A;  5EHA A;  1QQL A;  2WRY A;  2BEA A;  3AZW A;  3B9U A;  3OGF A;  5DUY A;  3WO2 A;  1Z4S A;  3FJH A;  1TTU A;  2FFU A;  3BAQ A;  1I1E A;  1NUN A;  3RSJ A;  1BAR A;  2ZR1 B;  3AZV A;  3FUQ A;  3BAV A;  3NBE A;  3O4D A;  3WMU A;  3RMX A;  4QC4 A;  3UD7 A;  3IM7 A;  2AXM A;  2Y9W C;  1XG6 A;  7I1B A;  1FV3 A;  4ISR A;  5FNX A;  3V0B B;  4GOV A;  4AN7 B;  4I4P A;  1DQG A;  1HIB A;  4Q9G A;  3BRG C;  3IM6 A;  3HSM A;  3IAG C;  1WBA A;  5EC5 A;  1ISZ A;  3T8S A;  1HCE A;  3CA4 A;  4XFT A;  1E0O A;  1XHB A;  2BEB A;  3AH4 A;  3Q7Y A;  4I4U A;  2UUS A;  4I6I A;  4FGF A;  2X2T A;  1EYL A;  1JT7 A;  3BAH A;  1Z2V A;  2KLL A;  4PC4 A;  2KH2 A;  3OJ2 A;  3V0B A;  3CQA A;  4EEE B;  3WMV A;  4D0Z A;  4EB2 B;  3H6R B;  1KNM A;  1RG8 A;  1A8D A;  3FJK A;  3BAG A;  3HAL A;  4J23 B;  1S0E A;  1FWV A;  4D0T A;  1P63 A;  1YF8 B;  1PUM B;  3NBD A;  1BLD A;  3HMY A;  4IQP A;  2I1B A;  1XZZ A;  1IHK A;  3R4S A;  4R6U B;  3RTI B;  1YBI A;  2AFG A;  3UDA A;  1R8O A;  3VSZ A;  1NZK A;  5BQU A;  5F8W A;  4X38 A;  1S0B A;  3VT2 A;  4ZFY B;  3FFZ A;  4QD2 B;  3PUB A;  3CAH A;  1RML A;  3AKF A;  2D7I A;  4ZFW B;  3V0A B;  1BFB A;  1FGA A;  4I7I A;  1G82 A;  4XFU A;  1FMZ A;  2ZQO A;  1BLA A;  4GP3 A;  4I4S A;  4QBC A;  3O4C A;  3BA7 A;  1HWN B;  3AH1 A;  1JTC A;  1HWP B;  1QQK A;  3JUT A;  1Q04 A;  3UJ0 A;  5F8Y A;  3VWC A;  4JQ0 A;  2HW9 A;  1YXW A;  4IZE A;  4FVV A;  4A7K A;  2ERM A;  1I1B A;  5BXS A;  1S0G A;  1J0S A;  3FJF A;  2Y9F A;  4J2X A;  1DZC A;  2ZQN A;  1DIW A;  3WA1 A;  3ZXD A;  1XYF A;  3EF2 A;  1SR4 C;  2D7R A;  3RTJ B;  4ZLB B;  4IZX A;  2D22 A;  2KKI A;  4EFQ A;  5FNW A;  1Q1U A;  3VUO A;  5DZU A;  4ZFU B;  4P0K A;  1AXM A;  3OBR A;  6I1B A;  2X2S A;  3CA3 A; 
#chains in the Genus database with same CATH topology
 3P53 A;  2NM1 A;  3Q7W A;  1ITB A;  1FMM S;  1L2H A;  3OJM A;  3CRI A;  5I1B A;  3Q7X A;  1WD3 A;  1DQO A;  4USP A;  1K5V A;  41BI A;  3O44 A;  2MIB A;  2M49 A;  4II0 A;  5HPZ A;  4XKI A;  1W3F A;  4I37 A;  1AVX B;  4J2Y A;  1F31 A;  4JPZ A;  2D23 A;  3K1X A;  1ABR B;  1S0C A;  1JY0 A;  1IRA X;  3O3Q A;  4OWK A;  4X39 A;  8I1B A;  2HWA A;  3NBN A;  3CU1 B;  2FGF A;  5BXT A;  4ION A;  4D8H A;  3PG0 A;  3ZC8 A;  1V6W A;  3W9T A;  4YOL A;  1FN0 A;  3BAO A;  4ZKT B;  4LO1 C;  4OWL A;  2VU9 A;  1MD6 A;  1RY7 A;  2AQZ A;  1SZ6 B;  2L5X A;  2Q9X A;  4Z9W B;  1TFM B;  1PUU B;  31BI A;  5BXR A;  4I4V A;  2WBC A;  3A22 A;  1AVU A;  3S8J A;  4DEN A;  2YUG A;  2RQ9 A;  3CA1 A;  5G00 A;  2XOA A;  2Y9X E;  4LO1 A;  2F2F C;  3I29 B;  4ZOT A;  2QYI B;  4Z8S B;  1IIL A;  3FJD A;  5BQU C;  3HOM A;  2KI6 B;  4LO8 B;  2HZ9 A;  2FO1 A;  3I2X A;  4I96 A;  3VT0 A;  3ZXG A;  1K5U A;  2P23 A;  2RST A;  3OJV A;  2FDB M;  2R9K B;  5BOW A;  1G9A A;  3WO4 A;  1JQZ A;  3OGG A;  4IY9 A;  4GAI A;  2F2F A;  2Z49 A;  3R4U A;  2VXT I;  5GAQ A;  2VUA A;  3HBW A;  4I4X A;  4OEF A;  3FUO A;  4EFP A;  4A7Z A;  3V79 C;  3H6R A;  3WIN C;  4I3N A;  3ZX7 A;  3UD8 A;  4DCK C;  3IM5 A;  3AJ6 A;  2Z48 A;  4G6M A;  1DFC A;  1T4Q A;  4X3A A;  3F62 B;  3PME A;  4L4I A;  3HN1 A;  4CJM A;  1FV2 A;  3AH2 A;  4Q9P A;  1BFF A;  4I4Y A;  3FJE A;  2VLC A;  2MLL B;  3WIN A;  1G9C A;  4X37 A;  2Y9G A;  3O4A A;  1IT0 A;  3FJJ A;  4JP0 A;  3S8K A;  4HA2 A;  1V6V A;  4I0Y A;  3O49 A;  2E4M A;  1DLL A;  3VEQ A;  3CRG A;  4G1R A;  1JT3 A;  3C9Z A;  1D0H A;  4G9N A;  3V0A A;  4LO7 B;  1JLX A;  2RG9 B;  3FJ9 A;  1DJS B;  2NYY A;  4DEP A;  4H75 A;  1JLY A;  5E24 E;  4MZG B;  4JRA A;  3UD9 A;  1N4K A;  3JRR A;  3KMV A;  3FJ8 A;  2D1Z A;  1EPW A;  3FJI A;  3NBC A;  2NTD A;  2GO2 A;  4KEI A;  5FZU A;  1ISY A;  1BAS A;  3CRH A;  2D44 A;  4H9W A;  1TWM A;  1ISW A;  1T9F A;  4ZA3 B;  3BA5 A;  4P6A A;  3O4O A;  4XFS A;  5BVP I;  5JLV A;  1PZZ A;  1TWE A;  1PWA A;  3CA5 A;  4QKR A;  4QBV A;  4F83 A;  1TIE A;  4LO2 A;  4GAF A;  4F34 A;  1G9B A;  2NZ9 A;  3MAL A;  3BAU A;  3NJ5 A;  1R8N A;  2P39 A;  3VSF A;  4TLP A;  1CVS A;  4QAL A;  2IWT B;  1S0D A;  1EV2 A;  3A23 A;  3AKH A;  4IYB A;  4WBC A;  5FZZ A;  3BRF A;  4I1E A;  3BAD A;  3E8L C;  1DFQ A;  4USO A;  1IOB A;  1GGP B;  3LLP A;  3AJ5 A;  1Q03 A;  2K4A B;  3P6I A;  4G9M A;  1HWO B;  2BFH A;  2DRZ A;  3POK A;  1QXM A;  4I4R A;  2D20 A;  4LO3 A;  4LO0 A;  1TP0 A;  4MZH A;  2MC2 A;  5FZY A;  1AVA C;  4I4Q A;  1Z0H A;  1TOO A;  2NS2 A;  3TC2 A;  5D62 A;  1BFG A;  4I2S A;  3N7M A;  1ILR 1;  5D63 A;  1AFC A;  3I2A A;  4KC3 A;  4GOY A;  3A21 A;  5BP5 A;  1YYN A;  5F90 A;  1FWU A;  5D61 A;  4OW4 A;  2J3P A;  1IRP A;  4Q91 A;  3N7K A;  9ILB A;  2DRE A;  1AVW B;  4L4H A;  1OQL B;  3UJ4 A;  1W3G A;  1JT5 A;  2LIQ A;  1M16 A;  5DSS B;  3P6J A;  3CA6 A;  3A07 A;  4OUJ A;  4EFR A;  4EKX B;  4ZGR B;  3CA0 A;  2D43 A;  4HJJ A;  1V6X A;  3PHZ A;  1PC8 B;  2Q3N B;  2AAI B;  1ISX A;  4KBB A;  5F8S A;  1VCL A;  4OWJ A;  1UPS A;  2K8R A;  4IY8 A;  4ISQ A;  1V6U A;  2VXR A;  3N7J A;  1II4 A;  4OEG A;  3BA4 A;  3N0K A;  3FGM A;  4KEK A;  4QD2 C;  1YTO A;  2E4M C;  1BFC A;  1AF9 A;  3H6S E;  3SNV A;  4I4O A;  1IJT A;  4ZBV B;  3MPP G;  4GP0 A;  4P0L A;  3D7W B;  1EVT A;  3QYD A;  2D24 A;  5B2H A;  2VSE A;  1JT4 A;  3FJB A;  2HWM A;  4QO3 A;  2NP0 A;  3IIR A;  2F8X C;  1FQ9 A;  2KI4 A;  3QR5 A;  3AKG A;  1ONK B;  3O5W B;  4JAW A;  1RZO B;  2ET2 A;  1W3A A;  2LIE A;  2NVH A;  2FFV A;  3VT1 A;  4END A;  5DVH A;  2DRY A;  2K43 A;  3FJA A;  1MC9 A;  4IHZ A;  4QKS A;  4LO7 C;  5BXP A;  1S0F A;  4I1B A;  4A7Y A;  4J2K A;  3WO3 A;  1M2T B;  4KEJ A;  3ZC9 A;  2IHO A;  4H04 A;  4LO2 C;  3RMY A;  1S0L A;  3F1R A;  2GZB A;  3FJC A;  3AKI A;  5JMC A;  2VSA A;  4P0J A;  3H6Q A;  3OBT A;  4AN6 A;  3BX1 C;  4JKQ A;  1HKN A;  4LO0 C;  1HWM B;  4LO3 C;  1WBC A;  21BI A;  5EG6 C;  4I8M A;  1DZD A;  4J2S A;  3ILA A;  3N7L A;  1BA7 A;  1HCD A;  1WD4 A;  1G9D A;  4HR6 C;  3BB2 A;  2DS0 A;  5BP5 C;  4G6J A;  1CE7 B;  3BTA A;  3LTQ A;  2ESU A;  3O4B A;  3BRD A;  1SR4 A;  4OEE A;  1ISV A;  4JKX B;  2QN4 A;  5EHA A;  1QQL A;  2WRY A;  2BEA A;  3AZW A;  3B9U A;  3OGF A;  5DUY A;  3WO2 A;  1Z4S A;  3FJH A;  1TTU A;  2FFU A;  3BAQ A;  1I1E A;  1NUN A;  3RSJ A;  1BAR A;  2ZR1 B;  3AZV A;  3FUQ A;  3BAV A;  3NBE A;  3O4D A;  3WMU A;  3RMX A;  4QC4 A;  3UD7 A;  3IM7 A;  2AXM A;  2Y9W C;  1XG6 A;  7I1B A;  1FV3 A;  4ISR A;  5FNX A;  3V0B B;  4GOV A;  4AN7 B;  4I4P A;  1DQG A;  1HIB A;  4Q9G A;  3BRG C;  3IM6 A;  3HSM A;  3IAG C;  1WBA A;  5EC5 A;  1ISZ A;  3T8S A;  1HCE A;  3CA4 A;  4XFT A;  1E0O A;  1XHB A;  2BEB A;  3AH4 A;  3Q7Y A;  4I4U A;  2UUS A;  4I6I A;  4FGF A;  2X2T A;  1EYL A;  1JT7 A;  3BAH A;  1Z2V A;  2KLL A;  4PC4 A;  2KH2 A;  3OJ2 A;  3V0B A;  3CQA A;  4EEE B;  3WMV A;  4D0Z A;  4EB2 B;  3H6R B;  1KNM A;  1RG8 A;  1A8D A;  3FJK A;  3BAG A;  3HAL A;  4J23 B;  1S0E A;  1FWV A;  4D0T A;  1P63 A;  1YF8 B;  1PUM B;  3NBD A;  1BLD A;  3HMY A;  4IQP A;  2I1B A;  1XZZ A;  1IHK A;  3R4S A;  4R6U B;  4UY4 A;  3RTI B;  1YBI A;  2AFG A;  3UDA A;  1R8O A;  3VSZ A;  1NZK A;  5BQU A;  5F8W A;  4X38 A;  1S0B A;  3VT2 A;  4ZFY B;  3FFZ A;  4QD2 B;  3PUB A;  3CAH A;  1RML A;  3AKF A;  2D7I A;  4ZFW B;  3V0A B;  1BFB A;  1FGA A;  4I7I A;  1G82 A;  4XFU A;  1FMZ A;  2ZQO A;  1BLA A;  4GP3 A;  4I4S A;  4QBC A;  3O4C A;  3BA7 A;  1HWN B;  3AH1 A;  1JTC A;  1HWP B;  1QQK A;  3JUT A;  1Q04 A;  3UJ0 A;  5F8Y A;  3VWC A;  4JQ0 A;  2HW9 A;  1YXW A;  4IZE A;  4FVV A;  4A7K A;  2ERM A;  1I1B A;  5BXS A;  1S0G A;  1J0S A;  3FJF A;  2Y9F A;  4J2X A;  1DZC A;  2ZQN A;  1DIW A;  3WA1 A;  3ZXD A;  1XYF A;  3EF2 A;  1SR4 C;  2D7R A;  3RTJ B;  4ZLB B;  4IZX A;  2D22 A;  2KKI A;  4EFQ A;  5FNW A;  1Q1U A;  4MZF B;  3VUO A;  5DZU A;  4ZFU B;  4P0K A;  1AXM A;  3OBR A;  6I1B A;  2X2S A;  3CA3 A; 
#chains in the Genus database with same CATH homology
 3P53 A;  2NM1 A;  3Q7W A;  1ITB A;  1FMM S;  1L2H A;  3OJM A;  3CRI A;  5I1B A;  3Q7X A;  1WD3 A;  1DQO A;  4USP A;  1K5V A;  41BI A;  3O44 A;  2MIB A;  2M49 A;  4II0 A;  5HPZ A;  4XKI A;  1W3F A;  4I37 A;  1AVX B;  4J2Y A;  1F31 A;  4JPZ A;  2D23 A;  3K1X A;  1ABR B;  1S0C A;  1JY0 A;  1IRA X;  3O3Q A;  4OWK A;  4X39 A;  8I1B A;  2HWA A;  3NBN A;  3CU1 B;  2FGF A;  5BXT A;  4ION A;  4D8H A;  3PG0 A;  3ZC8 A;  1V6W A;  3W9T A;  4YOL A;  1FN0 A;  3BAO A;  4ZKT B;  4LO1 C;  4OWL A;  2VU9 A;  1MD6 A;  1RY7 A;  2AQZ A;  1SZ6 B;  2L5X A;  2Q9X A;  4Z9W B;  1TFM B;  1PUU B;  31BI A;  5BXR A;  4I4V A;  2WBC A;  3A22 A;  1AVU A;  3S8J A;  4DEN A;  2YUG A;  2RQ9 A;  3CA1 A;  5G00 A;  2XOA A;  2Y9X E;  4LO1 A;  2F2F C;  3I29 B;  4ZOT A;  2QYI B;  4Z8S B;  1IIL A;  3FJD A;  5BQU C;  3HOM A;  2KI6 B;  4LO8 B;  2HZ9 A;  2FO1 A;  3I2X A;  4I96 A;  3VT0 A;  3ZXG A;  1K5U A;  2P23 A;  2RST A;  3OJV A;  2FDB M;  2R9K B;  5BOW A;  1G9A A;  3WO4 A;  1JQZ A;  3OGG A;  4IY9 A;  4GAI A;  2F2F A;  2Z49 A;  3R4U A;  2VXT I;  5GAQ A;  2VUA A;  3HBW A;  4I4X A;  4OEF A;  3FUO A;  4EFP A;  4A7Z A;  3V79 C;  3H6R A;  3WIN C;  4I3N A;  3ZX7 A;  3UD8 A;  4DCK C;  3IM5 A;  3AJ6 A;  2Z48 A;  4G6M A;  1DFC A;  1T4Q A;  4X3A A;  3F62 B;  3PME A;  4L4I A;  3HN1 A;  4CJM A;  1FV2 A;  3AH2 A;  4Q9P A;  1BFF A;  4I4Y A;  3FJE A;  2VLC A;  2MLL B;  3WIN A;  1G9C A;  4X37 A;  2Y9G A;  3O4A A;  1IT0 A;  3FJJ A;  4JP0 A;  3S8K A;  4HA2 A;  1V6V A;  4I0Y A;  3O49 A;  2E4M A;  1DLL A;  3VEQ A;  3CRG A;  4G1R A;  1JT3 A;  3C9Z A;  1D0H A;  4G9N A;  3V0A A;  4LO7 B;  1JLX A;  2RG9 B;  3FJ9 A;  1DJS B;  2NYY A;  4DEP A;  4H75 A;  1JLY A;  5E24 E;  4MZG B;  4JRA A;  3UD9 A;  1N4K A;  3JRR A;  3KMV A;  3FJ8 A;  2D1Z A;  1EPW A;  3FJI A;  3NBC A;  2NTD A;  2GO2 A;  4KEI A;  5FZU A;  1ISY A;  1BAS A;  3CRH A;  2D44 A;  4H9W A;  1TWM A;  1ISW A;  1T9F A;  4ZA3 B;  3BA5 A;  4P6A A;  3O4O A;  4XFS A;  5BVP I;  5JLV A;  1PZZ A;  1TWE A;  1PWA A;  3CA5 A;  4QKR A;  4QBV A;  4F83 A;  1TIE A;  4LO2 A;  4GAF A;  4F34 A;  1G9B A;  2NZ9 A;  3MAL A;  3BAU A;  3NJ5 A;  1R8N A;  2P39 A;  3VSF A;  4TLP A;  1CVS A;  4QAL A;  2IWT B;  1S0D A;  1EV2 A;  3A23 A;  3AKH A;  4IYB A;  4WBC A;  5FZZ A;  3BRF A;  4I1E A;  3BAD A;  3E8L C;  1DFQ A;  4USO A;  1IOB A;  1GGP B;  3LLP A;  3AJ5 A;  1Q03 A;  2K4A B;  3P6I A;  4G9M A;  1HWO B;  2BFH A;  2DRZ A;  3POK A;  1QXM A;  4I4R A;  2D20 A;  4LO3 A;  4LO0 A;  1TP0 A;  4MZH A;  2MC2 A;  5FZY A;  1AVA C;  4I4Q A;  1Z0H A;  1TOO A;  2NS2 A;  3TC2 A;  5D62 A;  1BFG A;  4I2S A;  3N7M A;  1ILR 1;  5D63 A;  1AFC A;  3I2A A;  4KC3 A;  4GOY A;  3A21 A;  5BP5 A;  1YYN A;  5F90 A;  1FWU A;  5D61 A;  4OW4 A;  2J3P A;  1IRP A;  4Q91 A;  3N7K A;  9ILB A;  2DRE A;  1AVW B;  4L4H A;  1OQL B;  3UJ4 A;  1W3G A;  1JT5 A;  2LIQ A;  1M16 A;  5DSS B;  3P6J A;  3CA6 A;  3A07 A;  4OUJ A;  4EFR A;  4EKX B;  4ZGR B;  3CA0 A;  2D43 A;  4HJJ A;  1V6X A;  3PHZ A;  1PC8 B;  2Q3N B;  2AAI B;  1ISX A;  4KBB A;  5F8S A;  1VCL A;  4OWJ A;  1UPS A;  2K8R A;  4IY8 A;  4ISQ A;  1V6U A;  2VXR A;  3N7J A;  1II4 A;  4OEG A;  3BA4 A;  3N0K A;  3FGM A;  4KEK A;  4QD2 C;  1YTO A;  2E4M C;  1BFC A;  1AF9 A;  3H6S E;  3SNV A;  4I4O A;  1IJT A;  4ZBV B;  3MPP G;  4GP0 A;  4P0L A;  3D7W B;  1EVT A;  3QYD A;  2D24 A;  5B2H A;  2VSE A;  1JT4 A;  3FJB A;  2HWM A;  4QO3 A;  2NP0 A;  3IIR A;  2F8X C;  1FQ9 A;  2KI4 A;  3QR5 A;  3AKG A;  1ONK B;  3O5W B;  4JAW A;  1RZO B;  2ET2 A;  1W3A A;  2LIE A;  2NVH A;  2FFV A;  3VT1 A;  4END A;  5DVH A;  2DRY A;  2K43 A;  3FJA A;  1MC9 A;  4IHZ A;  4QKS A;  4LO7 C;  5BXP A;  1S0F A;  4I1B A;  4A7Y A;  4J2K A;  3WO3 A;  1M2T B;  4KEJ A;  3ZC9 A;  2IHO A;  4H04 A;  4LO2 C;  3RMY A;  1S0L A;  3F1R A;  2GZB A;  3FJC A;  3AKI A;  5JMC A;  2VSA A;  4P0J A;  3H6Q A;  3OBT A;  4AN6 A;  3BX1 C;  4JKQ A;  1HKN A;  4LO0 C;  1HWM B;  4LO3 C;  1WBC A;  21BI A;  5EG6 C;  4I8M A;  1DZD A;  4J2S A;  3ILA A;  3N7L A;  1BA7 A;  1HCD A;  1WD4 A;  1G9D A;  4HR6 C;  3BB2 A;  2DS0 A;  5BP5 C;  4G6J A;  1CE7 B;  3BTA A;  3LTQ A;  2ESU A;  3O4B A;  3BRD A;  1SR4 A;  4OEE A;  1ISV A;  4JKX B;  2QN4 A;  5EHA A;  1QQL A;  2WRY A;  2BEA A;  3AZW A;  3B9U A;  3OGF A;  5DUY A;  3WO2 A;  1Z4S A;  3FJH A;  1TTU A;  2FFU A;  3BAQ A;  1I1E A;  1NUN A;  3RSJ A;  1BAR A;  2ZR1 B;  3AZV A;  3FUQ A;  3BAV A;  3NBE A;  3O4D A;  3WMU A;  3RMX A;  4QC4 A;  3UD7 A;  3IM7 A;  2AXM A;  2Y9W C;  1XG6 A;  7I1B A;  1FV3 A;  4ISR A;  5FNX A;  3V0B B;  4GOV A;  4AN7 B;  4I4P A;  1DQG A;  1HIB A;  4Q9G A;  3BRG C;  3IM6 A;  3HSM A;  3IAG C;  1WBA A;  5EC5 A;  1ISZ A;  3T8S A;  1HCE A;  3CA4 A;  4XFT A;  1E0O A;  1XHB A;  2BEB A;  3AH4 A;  3Q7Y A;  4I4U A;  2UUS A;  4I6I A;  4FGF A;  2X2T A;  1EYL A;  1JT7 A;  3BAH A;  1Z2V A;  2KLL A;  4PC4 A;  2KH2 A;  3OJ2 A;  3V0B A;  3CQA A;  4EEE B;  3WMV A;  4D0Z A;  4EB2 B;  3H6R B;  1KNM A;  1RG8 A;  1A8D A;  3FJK A;  3BAG A;  3HAL A;  4J23 B;  1S0E A;  1FWV A;  4D0T A;  1P63 A;  1YF8 B;  1PUM B;  3NBD A;  1BLD A;  3HMY A;  4IQP A;  2I1B A;  1XZZ A;  1IHK A;  3R4S A;  4R6U B;  4UY4 A;  3RTI B;  1YBI A;  2AFG A;  3UDA A;  1R8O A;  3VSZ A;  1NZK A;  5BQU A;  5F8W A;  4X38 A;  1S0B A;  3VT2 A;  4ZFY B;  3FFZ A;  4QD2 B;  3PUB A;  3CAH A;  1RML A;  3AKF A;  2D7I A;  4ZFW B;  3V0A B;  1BFB A;  1FGA A;  4I7I A;  1G82 A;  4XFU A;  1FMZ A;  2ZQO A;  1BLA A;  4GP3 A;  4I4S A;  4QBC A;  3O4C A;  3BA7 A;  1HWN B;  3AH1 A;  1JTC A;  1HWP B;  1QQK A;  3JUT A;  1Q04 A;  3UJ0 A;  5F8Y A;  3VWC A;  4JQ0 A;  2HW9 A;  1YXW A;  4IZE A;  4FVV A;  4A7K A;  2ERM A;  1I1B A;  5BXS A;  1S0G A;  1J0S A;  3FJF A;  2Y9F A;  4J2X A;  1DZC A;  2ZQN A;  1DIW A;  3WA1 A;  3ZXD A;  1XYF A;  3EF2 A;  1SR4 C;  2D7R A;  3RTJ B;  4ZLB B;  4IZX A;  2D22 A;  2KKI A;  4EFQ A;  5FNW A;  1Q1U A;  4MZF B;  3VUO A;  5DZU A;  4ZFU B;  4P0K A;  1AXM A;  3OBR A;  6I1B A;  2X2S A;  3CA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...