3BAQA

Crystal structure of l26a mutant of human acidic fibroblast growth factor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
b'HHHHFNLPPGNYKKPKLLYCSNGGHFLRIAPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3baqA00
4I4OA 2K43A 2J3PA 4P6AA 1WD3A 1I1BA 3WO2A 3UDAA 1BLDA 1RZOB 3OJMA 4ZLBB 2MLLB 4QD2B 1S0FA 4LO7C 4EFQA 4I7IA 4A7YA 3JRRA 6I1BA 3BAHA 3CRGA 4JQ0A 4GP3A 4WBCA 3UD8A 4FGFA 2NVHA 3O49A 2MC2A 3O5WB 1AXMA 3BTAA 2ZQNA 4LO7B 2GO2A 3AZWA 2UUSA 3CAHA 4JAWA 3HSMA 3H6QA 3OBRA 5BVPI 1R8OA 3AH2A 4LO0C 4X39A 5B2HA 1FQ9A 3LLPA 1HKNA 3E8LC 1EPWA 4LO2C 3VEQA 4KC3A 2VU9A 4IZXA 4D8HA 3OGFA 1I1EA 2F2FC 1BA7A 9ILBA 1V6UA 5I1BA 4I4RA 4I4UA 2AQZA 1TIEA 2DRYA 4ZBVB 1MD6A 4JRAA 1G9AA 1AVAC 5BQUA 5D62A 1RG8A 3FJHA 1BASA 4II0A 1ABRB 3SNVA 2ZQOA 4USOA 4LO3A 5D63A 2KKIA 3AZVA 3CRIA 3UD7A 2Q9XA 3S8KA 1K5VA 3O4AA 2FDBM 2DRZA 1V6VA 3AKFA 4QKRA 1CVSA 1IRAX 2E4MC 3FJCA 2D7IA 4QC4A 3HN1A 4I96A 5JMCA 1S0LA 4JKQA 2FFUA 3HALA 4I4SA 4I6IA 5DZUA 3WO4A 1JLYA 3KMVA 2F8XC 4LO1C 3CRHA 2RG9B 1XG6A 2P39A 4XKIA 3IM6A 4P0KA 3WMVA 1PZZA 2ZR1B 1DQGA 3POKA 4DCKC 3BX1C 1G82A 3FJFA 2L5XA 5HPZA 1XZZA 2HWMA 3FJEA 4EFRA 4J2KA 3O4OA 4A7KA 1SZ6B 2ESUA 2VXTI 3HMYA 4X37A 1XYFA 3R4UA 2LIQA 3O4DA 2VSAA 4I4VA 1YTOA 2D24A 4DEPA 3OJVA 2QYIB 2Z49A 3RMYA 3P6JA 1DFCA 1DJSB 4G6MA 1TWMA 1XHBA 4OEEA 1ISVA 1HWOB 2K8RA 2LIEA 3VSFA 1BFFA 1DLLA 1CE7B 3V0BB 1IHKA 5F90A 4ZFYB 41BIA 3N7KA 3HBWA 1EYLA 2FGFA 1QXMA 3TC2A 3FJJA 1N4KA 2NP0A 2NTDA 4F34A 1FMMS 3RSJA 3AKGA 1ISWA 1QQLA 1Q04A 5EC5A 3VUOA 3VT0A 1E0OA 3V0AB 2D1ZA 3PUBA 4OEFA 3HOMA 1MC9A 3EF2A 4G1RA 1Z4SA 4LO2A 8I1BA 3IAGC 2NZ9A 3I2AA 5D61A 2YUGA 2F2FA 1A8DA 3O4CA 2XOAA 4EFPA 4IHZA 4GOYA 3R4SA 3ZC8A 4PC4A 2Q3NB 3W9TA 2RQ9A 3VT2A 3F1RA 1JT7A 1G9CA 3H6SE 4I4XA 1K5UA 4LO8B 1IT0A 5FZZA 3NBEA 4R6UB 3O44A 3VWCA 1PC8B 5F8YA 2X2TA 1S0BA 3UJ0A 4ZKTB 3Q7YA 4OW4A 2AFGA 1II4A 2E4MA 1ITBA 2VLCA 4HA2A 3AH1A 1FWVA 3N7JA 3T8SA 3FUQA 4I0YA 4IONA 2BFHA 2KLLA 1FV2A 1S0DA 4LO1A 3BAUA 1ISZA 4ZGRB 2D7RA 3VSZA 1T4QA 3IM7A 4EKXB 3P6IA 3BAGA 1D0HA 1ISXA 4DENA 5FZYA 4XFTA 1DZDA 5BP5C 3FUOA 1BFBA 3WMUA 1L2HA 2HW9A 1AVUA 4J2XA 4ISRA 2D43A 3PG0A 4QKSA 1W3FA 1J0SA 1PUUB 1OQLB 1RY7A 31BIA 2D44A 3VT1A 3FJIA 3FJDA 5BXRA 1AVWB 1S0CA 1T9FA 3FGMA 5DSSB 1TFMB 4P0JA 4I2SA 3BAVA 1NUNA 2WRYA 5GAQA 4J2SA 4Q9PA 3RTJB 4CJMA 3ZXGA 1W3GA 2IWTB 2QN4A 3NJ5A 5FZUA 1FGAA 4A7ZA 2Y9FA 3ZXDA 1AFCA 4L4HA 2Y9XE 3I2XA 1DZCA 2AAIB 1HIBA 2Z48A 4I1BA 21BIA 3C9ZA 3AJ6A 4XFUA 5FNXA 5BXTA 3PHZA 4EB2B 3AKHA 1Q1UA 1TWEA 1SR4C 3A22A 4USPA 2Y9GA 3QR5A 1WBAA 3IM5A 3FJ8A 1IOBA 3WA1A 4ZOTA 3QYDA 4Z8SB 3S8JA 1S0GA 5E24E 3V79C 1FN0A 1WBCA 3FJBA 4P0LA 3N7LA 4JP0A 4GAFA 1YBIA 4I4PA 4LO0A 4QALA 1BFCA 1NZKA 1GGPB 3BAQA 1JY0A 3CA5A 4QO3A 4HJJA 3CU1B 4KEIA 3AJ5A 4OEGA 3AH4A 4Q9GA 3NBNA 1UPSA 4JKXB 4L4IA 5EHAA 3O3QA 4ZA3B 1FV3A 4XFSA 2D22A 1V6XA 3BAOA 4IY8A 3BRDA 4ZFUB 1ISYA 5G00A 5BXSA 3CA4A 5JLVA 1JTCA 1QQKA 1DQOA 3A07A 1DIWA 3UJ4A 2HWAA 2I1BA 4GAIA 3H6RB 4IYBA 3CA6A 4IZEA 2VUAA 4AN6A 4H9WA 3JUTA 2D20A 1HWNB 1M2TB 4F83A 5BXPA 5BP5A 5DVHA 1W3AA 4IQPA 3A21A 3OGGA 4OWLA 1EV2A 1TP0A 1G9DA 2AXMA 3A23A 4D0TA 4I4QA 3FJ9A 4G9MA 3WINC 4I1EA 4OWJA 3UD9A 1IRPA 1HWPB 3FJAA 5F8SA 3ZX7A 3Q7XA 2KH2A 3NBDA 3NBCA 4D0ZA 1YYNA 3D7WB 1IJTA 1F31A 3BA7A 4G9NA 1S0EA 1V6WA 2P23A 4I3NA 2DS0A 3BA4A 3K1XA 3ZC9A 1ONKB 3IIRA 4ENDA 5FNWA 4ISQA 1VCLA 3V0BA 5F8WA 3AKIA 2WBCA 3CA1A 3O4BA 4OUJA 1G9BA 4HR6C 4FVVA 1R8NA 1AF9A 1RMLA 2ERMA 3BADA 1YXWA 1SR4A 3Q7WA 1HWMB 2KI6B 3LTQA 2R9KB 4J23B 1M16A 1ILR1 1JLXA 1BFGA 1PUMB 2IHOA 3V0AA 2VXRA 1YF8B 3BB2A 1FWUA 1EVTA 1FMZA 2BEAA 4X38A 2M49A 1BARA 2BEBA 1AVXB 3BRFA 1TOOA 4Q91A 1JQZA 1DFQA 2MIBA 2NYYA 4QBVA 3RTIB 1JT5A 2HZ9A 3MPPG 4YOLA 4TLPA 3OJ2A 4J2YA 3H6RA 5BQUC 2VSEA 2KI4A 5EG6C 2D23A 3B9UA 3ILAA 1JT4A 4LO3C 3RMXA 3OBTA 4KEKA 2X2SA 2Y9WC 4KEJA 4ZFWB 1IILA 4IY9A 5DUYA 2FO1A 1Q03A 4EEEB 3WO3A 3N0KA 4GP0A 3N7MA 4H04A 4KBBA 1KNMA 3F62B 4QBCA 1HCDA 3CA3A 4I37A 3BRGC 4GOVA 3CA0A 4X3AA 3BA5A 2GZBA 1Z2VA 4G6JA 4AN7B 5BOWA 1TTUA 3PMEA 2FFVA 2K4AB 3I29B 1PWAA 1HCEA 3FFZA 4JPZA 2ET2A 7I1BA 1JT3A 2DREA 4I8MA 2RSTA 3P53A 3MALA 1BLAA 4OWKA 3WINA 4QD2C 1WD4A 3CQAA 1P63A 3FJKA 1Z0HA 4Z9WB 4I4YA 2NM1A
chains in the Genus database with same CATH superfamily
4I4OA 2K43A 2J3PA 4P6AA 1WD3A 1I1BA 3WO2A 3UDAA 1BLDA 1RZOB 3OJMA 4ZLBB 2MLLB 4QD2B 1S0FA 4LO7C 4EFQA 4I7IA 4A7YA 3JRRA 6I1BA 3BAHA 3CRGA 4JQ0A 4GP3A 4WBCA 3UD8A 4FGFA 2NVHA 3O49A 2MC2A 3O5WB 1AXMA 3BTAA 2ZQNA 4LO7B 2GO2A 3AZWA 2UUSA 3CAHA 4JAWA 3HSMA 3H6QA 3OBRA 4MZFB 5BVPI 1R8OA 3AH2A 4LO0C 4X39A 5B2HA 1FQ9A 3LLPA 1HKNA 3E8LC 1EPWA 4LO2C 3VEQA 4KC3A 2VU9A 4IZXA 4D8HA 3OGFA 1I1EA 2F2FC 1BA7A 9ILBA 2NS2A 1V6UA 5I1BA 4I4RA 4I4UA 2AQZA 1TIEA 2DRYA 4ZBVB 1MD6A 4JRAA 1G9AA 1AVAC 5BQUA 5D62A 1RG8A 3FJHA 1BASA 4II0A 1ABRB 3SNVA 2ZQOA 4MZHA 4USOA 4LO3A 5D63A 2KKIA 3AZVA 3CRIA 3UD7A 2Q9XA 3S8KA 1K5VA 3O4AA 2FDBM 2DRZA 1V6VA 3AKFA 4QKRA 1CVSA 1IRAX 2E4MC 3FJCA 2D7IA 4QC4A 3HN1A 4I96A 5JMCA 1S0LA 4JKQA 2FFUA 3HALA 4I4SA 4I6IA 5DZUA 3WO4A 1JLYA 3KMVA 2F8XC 4LO1C 3CRHA 2RG9B 1XG6A 2P39A 4XKIA 3IM6A 4P0KA 3WMVA 1PZZA 2ZR1B 1DQGA 3POKA 4DCKC 3BX1C 1G82A 3FJFA 2L5XA 5HPZA 1XZZA 2HWMA 3FJEA 4EFRA 4J2KA 3O4OA 4A7KA 1SZ6B 2ESUA 2VXTI 3HMYA 4X37A 1XYFA 3R4UA 2LIQA 3O4DA 2VSAA 4I4VA 1YTOA 2D24A 4DEPA 3OJVA 2QYIB 2Z49A 3RMYA 3P6JA 1DFCA 1DJSB 4G6MA 1TWMA 1XHBA 4OEEA 1ISVA 1HWOB 2K8RA 2LIEA 3VSFA 1BFFA 1DLLA 1CE7B 3V0BB 1IHKA 5F90A 4ZFYB 41BIA 3N7KA 3HBWA 1EYLA 2FGFA 1QXMA 3TC2A 3FJJA 1N4KA 2NP0A 2NTDA 4F34A 1FMMS 3RSJA 3AKGA 1ISWA 1QQLA 1Q04A 5EC5A 3VUOA 3VT0A 1E0OA 3V0AB 2D1ZA 3PUBA 4OEFA 3HOMA 1MC9A 3EF2A 4G1RA 1Z4SA 4LO2A 8I1BA 3IAGC 2NZ9A 3I2AA 5D61A 2YUGA 2F2FA 1A8DA 3O4CA 2XOAA 4EFPA 4IHZA 4GOYA 3R4SA 3ZC8A 4PC4A 2Q3NB 3W9TA 2RQ9A 3VT2A 3F1RA 1JT7A 1G9CA 3H6SE 4I4XA 1K5UA 4LO8B 1IT0A 5FZZA 3NBEA 4R6UB 3O44A 3VWCA 1PC8B 5F8YA 2X2TA 1S0BA 3UJ0A 4ZKTB 3Q7YA 4OW4A 2AFGA 1II4A 2E4MA 1ITBA 2VLCA 4HA2A 3AH1A 1FWVA 3N7JA 3T8SA 3FUQA 4I0YA 4IONA 2BFHA 2KLLA 1FV2A 1S0DA 4LO1A 3BAUA 1ISZA 4ZGRB 2D7RA 3VSZA 1T4QA 3IM7A 4EKXB 3P6IA 3BAGA 1D0HA 1ISXA 4DENA 5FZYA 4XFTA 1DZDA 5BP5C 1BFBA 3FUOA 3WMUA 1L2HA 2HW9A 1AVUA 4J2XA 4ISRA 2D43A 3PG0A 4QKSA 1W3FA 1J0SA 1PUUB 1OQLB 1RY7A 31BIA 2D44A 3VT1A 3FJIA 3FJDA 5BXRA 1AVWB 1S0CA 1T9FA 3FGMA 5DSSB 1TFMB 4P0JA 4I2SA 3BAVA 1NUNA 2WRYA 5GAQA 4J2SA 4Q9PA 3RTJB 4CJMA 3ZXGA 1W3GA 2IWTB 2QN4A 3NJ5A 5FZUA 1FGAA 4A7ZA 2Y9FA 3ZXDA 1AFCA 4H75A 4L4HA 2Y9XE 3I2XA 1DZCA 2AAIB 1HIBA 2Z48A 4I1BA 21BIA 3C9ZA 3AJ6A 4XFUA 5FNXA 5BXTA 3PHZA 4EB2B 3AKHA 1Q1UA 1TWEA 1SR4C 3A22A 4USPA 2Y9GA 3QR5A 1WBAA 3IM5A 3FJ8A 1IOBA 3WA1A 4ZOTA 3QYDA 4Z8SB 3S8JA 1S0GA 5E24E 3V79C 1FN0A 1WBCA 3FJBA 4P0LA 3N7LA 4JP0A 4GAFA 1YBIA 4I4PA 4LO0A 4QALA 1BFCA 1NZKA 1GGPB 3BAQA 1JY0A 3CA5A 4QO3A 4HJJA 3CU1B 4KEIA 3AJ5A 4OEGA 3AH4A 4Q9GA 3NBNA 1UPSA 4JKXB 4L4IA 5EHAA 3O3QA 4ZA3B 1FV3A 4XFSA 2D22A 1V6XA 3BAOA 4IY8A 3BRDA 4ZFUB 1ISYA 5G00A 5BXSA 3CA4A 5JLVA 1JTCA 1QQKA 1DQOA 3A07A 1DIWA 3UJ4A 2HWAA 2I1BA 4GAIA 3H6RB 4IYBA 3CA6A 4IZEA 2VUAA 4AN6A 4H9WA 3JUTA 2D20A 1HWNB 1M2TB 4F83A 5BXPA 5BP5A 5DVHA 1W3AA 4IQPA 3A21A 3OGGA 4OWLA 1EV2A 1TP0A 1G9DA 2AXMA 3A23A 4D0TA 4I4QA 3FJ9A 4G9MA 3WINC 4I1EA 4OWJA 3UD9A 1IRPA 1HWPB 3FJAA 5F8SA 3ZX7A 3Q7XA 2KH2A 3NBDA 3NBCA 4D0ZA 1YYNA 3D7WB 1IJTA 1F31A 3BA7A 4G9NA 1S0EA 1V6WA 2P23A 4I3NA 2DS0A 3BA4A 3K1XA 3ZC9A 1ONKB 3IIRA 4ENDA 5FNWA 4ISQA 4MZGB 1VCLA 3V0BA 5F8WA 3AKIA 2WBCA 3CA1A 3O4BA 4OUJA 1G9BA 4UY4A 4HR6C 4FVVA 1R8NA 1AF9A 1RMLA 2ERMA 3BADA 1YXWA 1SR4A 3Q7WA 1HWMB 2KI6B 3LTQA 2R9KB 4J23B 1M16A 1ILR1 1JLXA 1BFGA 1PUMB 2IHOA 3V0AA 2VXRA 1YF8B 3BB2A 1FWUA 1EVTA 1FMZA 2BEAA 4X38A 2M49A 1BARA 2BEBA 1AVXB 3BRFA 1TOOA 4Q91A 1JQZA 1DFQA 2MIBA 2NYYA 4QBVA 3RTIB 1JT5A 2HZ9A 3MPPG 4YOLA 4TLPA 3OJ2A 4J2YA 3H6RA 5BQUC 2VSEA 2KI4A 5EG6C 2D23A 3B9UA 3ILAA 1JT4A 4LO3C 3RMXA 3OBTA 4KEKA 2X2SA 2Y9WC 4KEJA 4ZFWB 1IILA 4IY9A 5DUYA 2FO1A 1Q03A 4EEEB 3WO3A 3N0KA 4GP0A 3N7MA 4H04A 4KBBA 1KNMA 3F62B 4QBCA 1HCDA 3CA3A 4I37A 3BRGC 4GOVA 3CA0A 4X3AA 3BA5A 2GZBA 1Z2VA 4G6JA 4AN7B 5BOWA 1TTUA 3PMEA 2FFVA 2K4AB 3I29B 1PWAA 1HCEA 3FFZA 4JPZA 2ET2A 7I1BA 1JT3A 2DREA 4I8MA 2RSTA 3P53A 3MALA 1BLAA 4OWKA 3WINA 4QD2C 1WD4A 3CQAA 1P63A 3FJKA 1Z0HA 4Z9WB 4I4YA 2NM1A
chains in the Genus database with same CATH topology
4I4OA 2K43A 2J3PA 4P6AA 1WD3A 1I1BA 3WO2A 3UDAA 1BLDA 1RZOB 3OJMA 4ZLBB 2MLLB 4QD2B 1S0FA 4LO7C 4EFQA 4I7IA 4A7YA 3JRRA 6I1BA 3BAHA 3CRGA 4JQ0A 4GP3A 4WBCA 3UD8A 4FGFA 2NVHA 3O49A 2MC2A 3O5WB 1AXMA 3BTAA 2ZQNA 4LO7B 2GO2A 3AZWA 2UUSA 3CAHA 4JAWA 3HSMA 3H6QA 3OBRA 4MZFB 5BVPI 1R8OA 3AH2A 4LO0C 4X39A 5B2HA 1FQ9A 3LLPA 1HKNA 3E8LC 1EPWA 4LO2C 3VEQA 4KC3A 2VU9A 4IZXA 4D8HA 3OGFA 1I1EA 2F2FC 1BA7A 9ILBA 2NS2A 1V6UA 5I1BA 4I4RA 4I4UA 2AQZA 1TIEA 2DRYA 4ZBVB 1MD6A 4JRAA 1G9AA 1AVAC 5BQUA 5D62A 1RG8A 3FJHA 1BASA 4II0A 1ABRB 3SNVA 2ZQOA 4MZHA 4USOA 4LO3A 5D63A 2KKIA 3AZVA 3CRIA 3UD7A 2Q9XA 3S8KA 1K5VA 3O4AA 2FDBM 2DRZA 1V6VA 3AKFA 4QKRA 1CVSA 1IRAX 2E4MC 3FJCA 2D7IA 4QC4A 3HN1A 4I96A 5JMCA 1S0LA 4JKQA 2FFUA 3HALA 4I4SA 4I6IA 5DZUA 3WO4A 1JLYA 3KMVA 2F8XC 4LO1C 3CRHA 2RG9B 1XG6A 2P39A 4XKIA 3IM6A 4P0KA 3WMVA 1PZZA 2ZR1B 1DQGA 3POKA 4DCKC 3BX1C 1G82A 3FJFA 2L5XA 5HPZA 1XZZA 2HWMA 3FJEA 4EFRA 4J2KA 3O4OA 4A7KA 1SZ6B 2ESUA 2VXTI 3HMYA 4X37A 1XYFA 3R4UA 2LIQA 3O4DA 2VSAA 4I4VA 1YTOA 2D24A 4DEPA 3OJVA 2QYIB 2Z49A 3RMYA 3P6JA 1DFCA 1DJSB 4G6MA 1TWMA 1XHBA 4OEEA 1ISVA 1HWOB 2K8RA 2LIEA 3VSFA 1BFFA 1DLLA 1CE7B 3V0BB 1IHKA 5F90A 4ZFYB 41BIA 3N7KA 3HBWA 1EYLA 2FGFA 1QXMA 3TC2A 3FJJA 1N4KA 2NP0A 2NTDA 4F34A 1FMMS 3RSJA 3AKGA 1ISWA 1QQLA 1Q04A 5EC5A 3VUOA 3VT0A 1E0OA 3V0AB 2D1ZA 3PUBA 4OEFA 3HOMA 1MC9A 3EF2A 4G1RA 1Z4SA 4LO2A 8I1BA 3IAGC 2NZ9A 3I2AA 5D61A 2YUGA 2F2FA 1A8DA 3O4CA 2XOAA 4EFPA 4IHZA 4GOYA 3R4SA 3ZC8A 4PC4A 2Q3NB 3W9TA 2RQ9A 3VT2A 3F1RA 1JT7A 1G9CA 3H6SE 4I4XA 1K5UA 4LO8B 1IT0A 5FZZA 3NBEA 4R6UB 3O44A 3VWCA 1PC8B 5F8YA 2X2TA 1S0BA 3UJ0A 4ZKTB 3Q7YA 4OW4A 2AFGA 1II4A 2E4MA 1ITBA 2VLCA 4HA2A 3AH1A 1FWVA 3N7JA 3T8SA 3FUQA 4I0YA 4IONA 2BFHA 2KLLA 1FV2A 1S0DA 4LO1A 3BAUA 1ISZA 4ZGRB 2D7RA 3VSZA 1T4QA 3IM7A 4EKXB 3P6IA 3BAGA 1D0HA 1ISXA 4DENA 5FZYA 4XFTA 1DZDA 5BP5C 1BFBA 3FUOA 3WMUA 1L2HA 2HW9A 1AVUA 4J2XA 4ISRA 2D43A 3PG0A 4QKSA 1W3FA 1J0SA 1PUUB 1OQLB 1RY7A 31BIA 2D44A 3VT1A 3FJIA 3FJDA 5BXRA 1AVWB 1S0CA 1T9FA 3FGMA 5DSSB 1TFMB 4P0JA 4I2SA 3BAVA 1NUNA 2WRYA 5GAQA 4J2SA 4Q9PA 3RTJB 4CJMA 3ZXGA 1W3GA 2IWTB 2QN4A 3NJ5A 5FZUA 1FGAA 4A7ZA 2Y9FA 3ZXDA 1AFCA 4H75A 4L4HA 2Y9XE 3I2XA 1DZCA 2AAIB 1HIBA 2Z48A 4I1BA 21BIA 3C9ZA 3AJ6A 4XFUA 5FNXA 5BXTA 3PHZA 4EB2B 3AKHA 1Q1UA 1TWEA 1SR4C 3A22A 4USPA 2Y9GA 3QR5A 1WBAA 3IM5A 3FJ8A 1IOBA 3WA1A 4ZOTA 3QYDA 4Z8SB 3S8JA 1S0GA 5E24E 3V79C 1FN0A 1WBCA 3FJBA 4P0LA 3N7LA 4JP0A 4GAFA 1YBIA 4I4PA 4LO0A 4QALA 1BFCA 1NZKA 1GGPB 3BAQA 1JY0A 3CA5A 4QO3A 4HJJA 3CU1B 4KEIA 3AJ5A 4OEGA 3AH4A 4Q9GA 3NBNA 1UPSA 4JKXB 4L4IA 5EHAA 3O3QA 4ZA3B 1FV3A 4XFSA 2D22A 1V6XA 3BAOA 4IY8A 3BRDA 4ZFUB 1ISYA 5G00A 5BXSA 3CA4A 5JLVA 1JTCA 1QQKA 1DQOA 3A07A 1DIWA 3UJ4A 2HWAA 2I1BA 4GAIA 3H6RB 4IYBA 3CA6A 4IZEA 2VUAA 4AN6A 4H9WA 3JUTA 2D20A 1HWNB 1M2TB 4F83A 5BXPA 5BP5A 5DVHA 1W3AA 4IQPA 3A21A 3OGGA 4OWLA 1EV2A 1TP0A 1G9DA 2AXMA 3A23A 4D0TA 4I4QA 3FJ9A 4G9MA 3WINC 4I1EA 4OWJA 3UD9A 1IRPA 1HWPB 3FJAA 5F8SA 3ZX7A 3Q7XA 2KH2A 3NBDA 3NBCA 4D0ZA 1YYNA 3D7WB 1IJTA 1F31A 3BA7A 4G9NA 1S0EA 1V6WA 2P23A 4I3NA 2DS0A 3BA4A 3K1XA 3ZC9A 1ONKB 3IIRA 4ENDA 5FNWA 4ISQA 4MZGB 1VCLA 3V0BA 5F8WA 3AKIA 2WBCA 3CA1A 3O4BA 4OUJA 1G9BA 4UY4A 4HR6C 4FVVA 1R8NA 1AF9A 1RMLA 2ERMA 3BADA 1YXWA 1SR4A 3Q7WA 1HWMB 2KI6B 3LTQA 2R9KB 4J23B 1M16A 1ILR1 1JLXA 1BFGA 1PUMB 2IHOA 3V0AA 2VXRA 1YF8B 3BB2A 1FWUA 1EVTA 1FMZA 2BEAA 4X38A 2M49A 1BARA 2BEBA 1AVXB 3BRFA 1TOOA 4Q91A 1JQZA 1DFQA 2MIBA 2NYYA 4QBVA 3RTIB 1JT5A 2HZ9A 3MPPG 4YOLA 4TLPA 3OJ2A 4J2YA 3H6RA 5BQUC 2VSEA 2KI4A 5EG6C 2D23A 3B9UA 3ILAA 1JT4A 4LO3C 3RMXA 3OBTA 4KEKA 2X2SA 2Y9WC 4KEJA 4ZFWB 1IILA 4IY9A 5DUYA 2FO1A 1Q03A 4EEEB 3WO3A 3N0KA 4GP0A 3N7MA 4H04A 4KBBA 1KNMA 3F62B 4QBCA 1HCDA 3CA3A 4I37A 3BRGC 4GOVA 3CA0A 4X3AA 3BA5A 2GZBA 1Z2VA 4G6JA 4AN7B 5BOWA 1TTUA 3PMEA 2FFVA 2K4AB 3I29B 1PWAA 1HCEA 3FFZA 4JPZA 2ET2A 7I1BA 1JT3A 2DREA 4I8MA 2RSTA 3P53A 3MALA 1BLAA 4OWKA 3WINA 4QD2C 1WD4A 3CQAA 1P63A 3FJKA 1Z0HA 4Z9WB 4I4YA 2NM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4O A;  2K43 A;  2J3P A;  4P6A A;  1WD3 A;  1I1B A;  3WO2 A;  3UDA A;  1BLD A;  1RZO B;  3OJM A;  4ZLB B;  2MLL B;  4QD2 B;  1S0F A;  4LO7 C;  4EFQ A;  4I7I A;  4A7Y A;  3JRR A;  6I1B A;  3BAH A;  3CRG A;  4JQ0 A;  4GP3 A;  4WBC A;  3UD8 A;  4FGF A;  2NVH A;  3O49 A;  2MC2 A;  3O5W B;  1AXM A;  3BTA A;  2ZQN A;  4LO7 B;  2GO2 A;  3AZW A;  2UUS A;  3CAH A;  4JAW A;  3HSM A;  3H6Q A;  3OBR A;  5BVP I;  1R8O A;  3AH2 A;  4LO0 C;  4X39 A;  5B2H A;  1FQ9 A;  3LLP A;  1HKN A;  3E8L C;  1EPW A;  4LO2 C;  3VEQ A;  4KC3 A;  2VU9 A;  4IZX A;  4D8H A;  3OGF A;  1I1E A;  2F2F C;  1BA7 A;  9ILB A;  1V6U A;  5I1B A;  4I4R A;  4I4U A;  2AQZ A;  1TIE A;  2DRY A;  4ZBV B;  1MD6 A;  4JRA A;  1G9A A;  1AVA C;  5BQU A;  5D62 A;  1RG8 A;  3FJH A;  1BAS A;  4II0 A;  1ABR B;  3SNV A;  2ZQO A;  4USO A;  4LO3 A;  5D63 A;  2KKI A;  3AZV A;  3CRI A;  3UD7 A;  2Q9X A;  3S8K A;  1K5V A;  3O4A A;  2FDB M;  2DRZ A;  1V6V A;  3AKF A;  4QKR A;  1CVS A;  1IRA X;  2E4M C;  3FJC A;  2D7I A;  4QC4 A;  3HN1 A;  4I96 A;  5JMC A;  1S0L A;  4JKQ A;  2FFU A;  3HAL A;  4I4S A;  4I6I A;  5DZU A;  3WO4 A;  1JLY A;  3KMV A;  2F8X C;  4LO1 C;  3CRH A;  2RG9 B;  1XG6 A;  2P39 A;  4XKI A;  3IM6 A;  4P0K A;  3WMV A;  1PZZ A;  2ZR1 B;  1DQG A;  3POK A;  4DCK C;  3BX1 C;  1G82 A;  3FJF A;  2L5X A;  5HPZ A;  1XZZ A;  2HWM A;  3FJE A;  4EFR A;  4J2K A;  3O4O A;  4A7K A;  1SZ6 B;  2ESU A;  2VXT I;  3HMY A;  4X37 A;  1XYF A;  3R4U A;  2LIQ A;  3O4D A;  2VSA A;  4I4V A;  1YTO A;  2D24 A;  4DEP A;  3OJV A;  2QYI B;  2Z49 A;  3RMY A;  3P6J A;  1DFC A;  1DJS B;  4G6M A;  1TWM A;  1XHB A;  4OEE A;  1ISV A;  1HWO B;  2K8R A;  2LIE A;  3VSF A;  1BFF A;  1DLL A;  1CE7 B;  3V0B B;  1IHK A;  5F90 A;  4ZFY B;  41BI A;  3N7K A;  3HBW A;  1EYL A;  2FGF A;  1QXM A;  3TC2 A;  3FJJ A;  1N4K A;  2NP0 A;  2NTD A;  4F34 A;  1FMM S;  3RSJ A;  3AKG A;  1ISW A;  1QQL A;  1Q04 A;  5EC5 A;  3VUO A;  3VT0 A;  1E0O A;  3V0A B;  2D1Z A;  3PUB A;  4OEF A;  3HOM A;  1MC9 A;  3EF2 A;  4G1R A;  1Z4S A;  4LO2 A;  8I1B A;  3IAG C;  2NZ9 A;  3I2A A;  5D61 A;  2YUG A;  2F2F A;  1A8D A;  3O4C A;  2XOA A;  4EFP A;  4IHZ A;  4GOY A;  3R4S A;  3ZC8 A;  4PC4 A;  2Q3N B;  3W9T A;  2RQ9 A;  3VT2 A;  3F1R A;  1JT7 A;  1G9C A;  3H6S E;  4I4X A;  1K5U A;  4LO8 B;  1IT0 A;  5FZZ A;  3NBE A;  4R6U B;  3O44 A;  3VWC A;  1PC8 B;  5F8Y A;  2X2T A;  1S0B A;  3UJ0 A;  4ZKT B;  3Q7Y A;  4OW4 A;  2AFG A;  1II4 A;  2E4M A;  1ITB A;  2VLC A;  4HA2 A;  3AH1 A;  1FWV A;  3N7J A;  3T8S A;  3FUQ A;  4I0Y A;  4ION A;  2BFH A;  2KLL A;  1FV2 A;  1S0D A;  4LO1 A;  3BAU A;  1ISZ A;  4ZGR B;  2D7R A;  3VSZ A;  1T4Q A;  3IM7 A;  4EKX B;  3P6I A;  3BAG A;  1D0H A;  1ISX A;  4DEN A;  5FZY A;  4XFT A;  1DZD A;  5BP5 C;  3FUO A;  1BFB A;  3WMU A;  1L2H A;  2HW9 A;  1AVU A;  4J2X A;  4ISR A;  2D43 A;  3PG0 A;  4QKS A;  1W3F A;  1J0S A;  1PUU B;  1OQL B;  1RY7 A;  31BI A;  2D44 A;  3VT1 A;  3FJI A;  3FJD A;  5BXR A;  1AVW B;  1S0C A;  1T9F A;  3FGM A;  5DSS B;  1TFM B;  4P0J A;  4I2S A;  3BAV A;  1NUN A;  2WRY A;  5GAQ A;  4J2S A;  4Q9P A;  3RTJ B;  4CJM A;  3ZXG A;  1W3G A;  2IWT B;  2QN4 A;  3NJ5 A;  5FZU A;  1FGA A;  4A7Z A;  2Y9F A;  3ZXD A;  1AFC A;  4L4H A;  2Y9X E;  3I2X A;  1DZC A;  2AAI B;  1HIB A;  2Z48 A;  4I1B A;  21BI A;  3C9Z A;  3AJ6 A;  4XFU A;  5FNX A;  5BXT A;  3PHZ A;  4EB2 B;  3AKH A;  1Q1U A;  1TWE A;  1SR4 C;  3A22 A;  4USP A;  2Y9G A;  3QR5 A;  1WBA A;  3IM5 A;  3FJ8 A;  1IOB A;  3WA1 A;  4ZOT A;  3QYD A;  4Z8S B;  3S8J A;  1S0G A;  5E24 E;  3V79 C;  1FN0 A;  1WBC A;  3FJB A;  4P0L A;  3N7L A;  4JP0 A;  4GAF A;  1YBI A;  4I4P A;  4LO0 A;  4QAL A;  1BFC A;  1NZK A;  1GGP B;  3BAQ A;  1JY0 A;  3CA5 A;  4QO3 A;  4HJJ A;  3CU1 B;  4KEI A;  3AJ5 A;  4OEG A;  3AH4 A;  4Q9G A;  3NBN A;  1UPS A;  4JKX B;  4L4I A;  5EHA A;  3O3Q A;  4ZA3 B;  1FV3 A;  4XFS A;  2D22 A;  1V6X A;  3BAO A;  4IY8 A;  3BRD A;  4ZFU B;  1ISY A;  5G00 A;  5BXS A;  3CA4 A;  5JLV A;  1JTC A;  1QQK A;  1DQO A;  3A07 A;  1DIW A;  3UJ4 A;  2HWA A;  2I1B A;  4GAI A;  3H6R B;  4IYB A;  3CA6 A;  4IZE A;  2VUA A;  4AN6 A;  4H9W A;  3JUT A;  2D20 A;  1HWN B;  1M2T B;  4F83 A;  5BXP A;  5BP5 A;  5DVH A;  1W3A A;  4IQP A;  3A21 A;  3OGG A;  4OWL A;  1EV2 A;  1TP0 A;  1G9D A;  2AXM A;  3A23 A;  4D0T A;  4I4Q A;  3FJ9 A;  4G9M A;  3WIN C;  4I1E A;  4OWJ A;  3UD9 A;  1IRP A;  1HWP B;  3FJA A;  5F8S A;  3ZX7 A;  3Q7X A;  2KH2 A;  3NBD A;  3NBC A;  4D0Z A;  1YYN A;  3D7W B;  1IJT A;  1F31 A;  3BA7 A;  4G9N A;  1S0E A;  1V6W A;  2P23 A;  4I3N A;  2DS0 A;  3BA4 A;  3K1X A;  3ZC9 A;  1ONK B;  3IIR A;  4END A;  5FNW A;  4ISQ A;  1VCL A;  3V0B A;  5F8W A;  3AKI A;  2WBC A;  3CA1 A;  3O4B A;  4OUJ A;  1G9B A;  4HR6 C;  4FVV A;  1R8N A;  1AF9 A;  1RML A;  2ERM A;  3BAD A;  1YXW A;  1SR4 A;  3Q7W A;  1HWM B;  2KI6 B;  3LTQ A;  2R9K B;  4J23 B;  1M16 A;  1ILR 1;  1JLX A;  1BFG A;  1PUM B;  2IHO A;  3V0A A;  2VXR A;  1YF8 B;  3BB2 A;  1FWU A;  1EVT A;  1FMZ A;  2BEA A;  4X38 A;  2M49 A;  1BAR A;  2BEB A;  1AVX B;  3BRF A;  1TOO A;  4Q91 A;  1JQZ A;  1DFQ A;  2MIB A;  2NYY A;  4QBV A;  3RTI B;  1JT5 A;  2HZ9 A;  3MPP G;  4YOL A;  4TLP A;  3OJ2 A;  4J2Y A;  3H6R A;  5BQU C;  2VSE A;  2KI4 A;  5EG6 C;  2D23 A;  3B9U A;  3ILA A;  1JT4 A;  4LO3 C;  3RMX A;  3OBT A;  4KEK A;  2X2S A;  2Y9W C;  4KEJ A;  4ZFW B;  1IIL A;  4IY9 A;  5DUY A;  2FO1 A;  1Q03 A;  4EEE B;  3WO3 A;  3N0K A;  4GP0 A;  3N7M A;  4H04 A;  4KBB A;  1KNM A;  3F62 B;  4QBC A;  1HCD A;  3CA3 A;  4I37 A;  3BRG C;  4GOV A;  3CA0 A;  4X3A A;  3BA5 A;  2GZB A;  1Z2V A;  4G6J A;  4AN7 B;  5BOW A;  1TTU A;  3PME A;  2FFV A;  2K4A B;  3I29 B;  1PWA A;  1HCE A;  3FFZ A;  4JPZ A;  2ET2 A;  7I1B A;  1JT3 A;  2DRE A;  4I8M A;  2RST A;  3P53 A;  3MAL A;  1BLA A;  4OWK A;  3WIN A;  4QD2 C;  1WD4 A;  3CQA A;  1P63 A;  3FJK A;  1Z0H A;  4Z9W B;  4I4Y A;  2NM1 A; 
#chains in the Genus database with same CATH topology
 4I4O A;  2K43 A;  2J3P A;  4P6A A;  1WD3 A;  1I1B A;  3WO2 A;  3UDA A;  1BLD A;  1RZO B;  3OJM A;  4ZLB B;  2MLL B;  4QD2 B;  1S0F A;  4LO7 C;  4EFQ A;  4I7I A;  4A7Y A;  3JRR A;  6I1B A;  3BAH A;  3CRG A;  4JQ0 A;  4GP3 A;  4WBC A;  3UD8 A;  4FGF A;  2NVH A;  3O49 A;  2MC2 A;  3O5W B;  1AXM A;  3BTA A;  2ZQN A;  4LO7 B;  2GO2 A;  3AZW A;  2UUS A;  3CAH A;  4JAW A;  3HSM A;  3H6Q A;  3OBR A;  4MZF B;  5BVP I;  1R8O A;  3AH2 A;  4LO0 C;  4X39 A;  5B2H A;  1FQ9 A;  3LLP A;  1HKN A;  3E8L C;  1EPW A;  4LO2 C;  3VEQ A;  4KC3 A;  2VU9 A;  4IZX A;  4D8H A;  3OGF A;  1I1E A;  2F2F C;  1BA7 A;  9ILB A;  2NS2 A;  1V6U A;  5I1B A;  4I4R A;  4I4U A;  2AQZ A;  1TIE A;  2DRY A;  4ZBV B;  1MD6 A;  4JRA A;  1G9A A;  1AVA C;  5BQU A;  5D62 A;  1RG8 A;  3FJH A;  1BAS A;  4II0 A;  1ABR B;  3SNV A;  2ZQO A;  4MZH A;  4USO A;  4LO3 A;  5D63 A;  2KKI A;  3AZV A;  3CRI A;  3UD7 A;  2Q9X A;  3S8K A;  1K5V A;  3O4A A;  2FDB M;  2DRZ A;  1V6V A;  3AKF A;  4QKR A;  1CVS A;  1IRA X;  2E4M C;  3FJC A;  2D7I A;  4QC4 A;  3HN1 A;  4I96 A;  5JMC A;  1S0L A;  4JKQ A;  2FFU A;  3HAL A;  4I4S A;  4I6I A;  5DZU A;  3WO4 A;  1JLY A;  3KMV A;  2F8X C;  4LO1 C;  3CRH A;  2RG9 B;  1XG6 A;  2P39 A;  4XKI A;  3IM6 A;  4P0K A;  3WMV A;  1PZZ A;  2ZR1 B;  1DQG A;  3POK A;  4DCK C;  3BX1 C;  1G82 A;  3FJF A;  2L5X A;  5HPZ A;  1XZZ A;  2HWM A;  3FJE A;  4EFR A;  4J2K A;  3O4O A;  4A7K A;  1SZ6 B;  2ESU A;  2VXT I;  3HMY A;  4X37 A;  1XYF A;  3R4U A;  2LIQ A;  3O4D A;  2VSA A;  4I4V A;  1YTO A;  2D24 A;  4DEP A;  3OJV A;  2QYI B;  2Z49 A;  3RMY A;  3P6J A;  1DFC A;  1DJS B;  4G6M A;  1TWM A;  1XHB A;  4OEE A;  1ISV A;  1HWO B;  2K8R A;  2LIE A;  3VSF A;  1BFF A;  1DLL A;  1CE7 B;  3V0B B;  1IHK A;  5F90 A;  4ZFY B;  41BI A;  3N7K A;  3HBW A;  1EYL A;  2FGF A;  1QXM A;  3TC2 A;  3FJJ A;  1N4K A;  2NP0 A;  2NTD A;  4F34 A;  1FMM S;  3RSJ A;  3AKG A;  1ISW A;  1QQL A;  1Q04 A;  5EC5 A;  3VUO A;  3VT0 A;  1E0O A;  3V0A B;  2D1Z A;  3PUB A;  4OEF A;  3HOM A;  1MC9 A;  3EF2 A;  4G1R A;  1Z4S A;  4LO2 A;  8I1B A;  3IAG C;  2NZ9 A;  3I2A A;  5D61 A;  2YUG A;  2F2F A;  1A8D A;  3O4C A;  2XOA A;  4EFP A;  4IHZ A;  4GOY A;  3R4S A;  3ZC8 A;  4PC4 A;  2Q3N B;  3W9T A;  2RQ9 A;  3VT2 A;  3F1R A;  1JT7 A;  1G9C A;  3H6S E;  4I4X A;  1K5U A;  4LO8 B;  1IT0 A;  5FZZ A;  3NBE A;  4R6U B;  3O44 A;  3VWC A;  1PC8 B;  5F8Y A;  2X2T A;  1S0B A;  3UJ0 A;  4ZKT B;  3Q7Y A;  4OW4 A;  2AFG A;  1II4 A;  2E4M A;  1ITB A;  2VLC A;  4HA2 A;  3AH1 A;  1FWV A;  3N7J A;  3T8S A;  3FUQ A;  4I0Y A;  4ION A;  2BFH A;  2KLL A;  1FV2 A;  1S0D A;  4LO1 A;  3BAU A;  1ISZ A;  4ZGR B;  2D7R A;  3VSZ A;  1T4Q A;  3IM7 A;  4EKX B;  3P6I A;  3BAG A;  1D0H A;  1ISX A;  4DEN A;  5FZY A;  4XFT A;  1DZD A;  5BP5 C;  1BFB A;  3FUO A;  3WMU A;  1L2H A;  2HW9 A;  1AVU A;  4J2X A;  4ISR A;  2D43 A;  3PG0 A;  4QKS A;  1W3F A;  1J0S A;  1PUU B;  1OQL B;  1RY7 A;  31BI A;  2D44 A;  3VT1 A;  3FJI A;  3FJD A;  5BXR A;  1AVW B;  1S0C A;  1T9F A;  3FGM A;  5DSS B;  1TFM B;  4P0J A;  4I2S A;  3BAV A;  1NUN A;  2WRY A;  5GAQ A;  4J2S A;  4Q9P A;  3RTJ B;  4CJM A;  3ZXG A;  1W3G A;  2IWT B;  2QN4 A;  3NJ5 A;  5FZU A;  1FGA A;  4A7Z A;  2Y9F A;  3ZXD A;  1AFC A;  4H75 A;  4L4H A;  2Y9X E;  3I2X A;  1DZC A;  2AAI B;  1HIB A;  2Z48 A;  4I1B A;  21BI A;  3C9Z A;  3AJ6 A;  4XFU A;  5FNX A;  5BXT A;  3PHZ A;  4EB2 B;  3AKH A;  1Q1U A;  1TWE A;  1SR4 C;  3A22 A;  4USP A;  2Y9G A;  3QR5 A;  1WBA A;  3IM5 A;  3FJ8 A;  1IOB A;  3WA1 A;  4ZOT A;  3QYD A;  4Z8S B;  3S8J A;  1S0G A;  5E24 E;  3V79 C;  1FN0 A;  1WBC A;  3FJB A;  4P0L A;  3N7L A;  4JP0 A;  4GAF A;  1YBI A;  4I4P A;  4LO0 A;  4QAL A;  1BFC A;  1NZK A;  1GGP B;  3BAQ A;  1JY0 A;  3CA5 A;  4QO3 A;  4HJJ A;  3CU1 B;  4KEI A;  3AJ5 A;  4OEG A;  3AH4 A;  4Q9G A;  3NBN A;  1UPS A;  4JKX B;  4L4I A;  5EHA A;  3O3Q A;  4ZA3 B;  1FV3 A;  4XFS A;  2D22 A;  1V6X A;  3BAO A;  4IY8 A;  3BRD A;  4ZFU B;  1ISY A;  5G00 A;  5BXS A;  3CA4 A;  5JLV A;  1JTC A;  1QQK A;  1DQO A;  3A07 A;  1DIW A;  3UJ4 A;  2HWA A;  2I1B A;  4GAI A;  3H6R B;  4IYB A;  3CA6 A;  4IZE A;  2VUA A;  4AN6 A;  4H9W A;  3JUT A;  2D20 A;  1HWN B;  1M2T B;  4F83 A;  5BXP A;  5BP5 A;  5DVH A;  1W3A A;  4IQP A;  3A21 A;  3OGG A;  4OWL A;  1EV2 A;  1TP0 A;  1G9D A;  2AXM A;  3A23 A;  4D0T A;  4I4Q A;  3FJ9 A;  4G9M A;  3WIN C;  4I1E A;  4OWJ A;  3UD9 A;  1IRP A;  1HWP B;  3FJA A;  5F8S A;  3ZX7 A;  3Q7X A;  2KH2 A;  3NBD A;  3NBC A;  4D0Z A;  1YYN A;  3D7W B;  1IJT A;  1F31 A;  3BA7 A;  4G9N A;  1S0E A;  1V6W A;  2P23 A;  4I3N A;  2DS0 A;  3BA4 A;  3K1X A;  3ZC9 A;  1ONK B;  3IIR A;  4END A;  5FNW A;  4ISQ A;  4MZG B;  1VCL A;  3V0B A;  5F8W A;  3AKI A;  2WBC A;  3CA1 A;  3O4B A;  4OUJ A;  1G9B A;  4UY4 A;  4HR6 C;  4FVV A;  1R8N A;  1AF9 A;  1RML A;  2ERM A;  3BAD A;  1YXW A;  1SR4 A;  3Q7W A;  1HWM B;  2KI6 B;  3LTQ A;  2R9K B;  4J23 B;  1M16 A;  1ILR 1;  1JLX A;  1BFG A;  1PUM B;  2IHO A;  3V0A A;  2VXR A;  1YF8 B;  3BB2 A;  1FWU A;  1EVT A;  1FMZ A;  2BEA A;  4X38 A;  2M49 A;  1BAR A;  2BEB A;  1AVX B;  3BRF A;  1TOO A;  4Q91 A;  1JQZ A;  1DFQ A;  2MIB A;  2NYY A;  4QBV A;  3RTI B;  1JT5 A;  2HZ9 A;  3MPP G;  4YOL A;  4TLP A;  3OJ2 A;  4J2Y A;  3H6R A;  5BQU C;  2VSE A;  2KI4 A;  5EG6 C;  2D23 A;  3B9U A;  3ILA A;  1JT4 A;  4LO3 C;  3RMX A;  3OBT A;  4KEK A;  2X2S A;  2Y9W C;  4KEJ A;  4ZFW B;  1IIL A;  4IY9 A;  5DUY A;  2FO1 A;  1Q03 A;  4EEE B;  3WO3 A;  3N0K A;  4GP0 A;  3N7M A;  4H04 A;  4KBB A;  1KNM A;  3F62 B;  4QBC A;  1HCD A;  3CA3 A;  4I37 A;  3BRG C;  4GOV A;  3CA0 A;  4X3A A;  3BA5 A;  2GZB A;  1Z2V A;  4G6J A;  4AN7 B;  5BOW A;  1TTU A;  3PME A;  2FFV A;  2K4A B;  3I29 B;  1PWA A;  1HCE A;  3FFZ A;  4JPZ A;  2ET2 A;  7I1B A;  1JT3 A;  2DRE A;  4I8M A;  2RST A;  3P53 A;  3MAL A;  1BLA A;  4OWK A;  3WIN A;  4QD2 C;  1WD4 A;  3CQA A;  1P63 A;  3FJK A;  1Z0H A;  4Z9W B;  4I4Y A;  2NM1 A; 
#chains in the Genus database with same CATH homology
 4I4O A;  2K43 A;  2J3P A;  4P6A A;  1WD3 A;  1I1B A;  3WO2 A;  3UDA A;  1BLD A;  1RZO B;  3OJM A;  4ZLB B;  2MLL B;  4QD2 B;  1S0F A;  4LO7 C;  4EFQ A;  4I7I A;  4A7Y A;  3JRR A;  6I1B A;  3BAH A;  3CRG A;  4JQ0 A;  4GP3 A;  4WBC A;  3UD8 A;  4FGF A;  2NVH A;  3O49 A;  2MC2 A;  3O5W B;  1AXM A;  3BTA A;  2ZQN A;  4LO7 B;  2GO2 A;  3AZW A;  2UUS A;  3CAH A;  4JAW A;  3HSM A;  3H6Q A;  3OBR A;  4MZF B;  5BVP I;  1R8O A;  3AH2 A;  4LO0 C;  4X39 A;  5B2H A;  1FQ9 A;  3LLP A;  1HKN A;  3E8L C;  1EPW A;  4LO2 C;  3VEQ A;  4KC3 A;  2VU9 A;  4IZX A;  4D8H A;  3OGF A;  1I1E A;  2F2F C;  1BA7 A;  9ILB A;  2NS2 A;  1V6U A;  5I1B A;  4I4R A;  4I4U A;  2AQZ A;  1TIE A;  2DRY A;  4ZBV B;  1MD6 A;  4JRA A;  1G9A A;  1AVA C;  5BQU A;  5D62 A;  1RG8 A;  3FJH A;  1BAS A;  4II0 A;  1ABR B;  3SNV A;  2ZQO A;  4MZH A;  4USO A;  4LO3 A;  5D63 A;  2KKI A;  3AZV A;  3CRI A;  3UD7 A;  2Q9X A;  3S8K A;  1K5V A;  3O4A A;  2FDB M;  2DRZ A;  1V6V A;  3AKF A;  4QKR A;  1CVS A;  1IRA X;  2E4M C;  3FJC A;  2D7I A;  4QC4 A;  3HN1 A;  4I96 A;  5JMC A;  1S0L A;  4JKQ A;  2FFU A;  3HAL A;  4I4S A;  4I6I A;  5DZU A;  3WO4 A;  1JLY A;  3KMV A;  2F8X C;  4LO1 C;  3CRH A;  2RG9 B;  1XG6 A;  2P39 A;  4XKI A;  3IM6 A;  4P0K A;  3WMV A;  1PZZ A;  2ZR1 B;  1DQG A;  3POK A;  4DCK C;  3BX1 C;  1G82 A;  3FJF A;  2L5X A;  5HPZ A;  1XZZ A;  2HWM A;  3FJE A;  4EFR A;  4J2K A;  3O4O A;  4A7K A;  1SZ6 B;  2ESU A;  2VXT I;  3HMY A;  4X37 A;  1XYF A;  3R4U A;  2LIQ A;  3O4D A;  2VSA A;  4I4V A;  1YTO A;  2D24 A;  4DEP A;  3OJV A;  2QYI B;  2Z49 A;  3RMY A;  3P6J A;  1DFC A;  1DJS B;  4G6M A;  1TWM A;  1XHB A;  4OEE A;  1ISV A;  1HWO B;  2K8R A;  2LIE A;  3VSF A;  1BFF A;  1DLL A;  1CE7 B;  3V0B B;  1IHK A;  5F90 A;  4ZFY B;  41BI A;  3N7K A;  3HBW A;  1EYL A;  2FGF A;  1QXM A;  3TC2 A;  3FJJ A;  1N4K A;  2NP0 A;  2NTD A;  4F34 A;  1FMM S;  3RSJ A;  3AKG A;  1ISW A;  1QQL A;  1Q04 A;  5EC5 A;  3VUO A;  3VT0 A;  1E0O A;  3V0A B;  2D1Z A;  3PUB A;  4OEF A;  3HOM A;  1MC9 A;  3EF2 A;  4G1R A;  1Z4S A;  4LO2 A;  8I1B A;  3IAG C;  2NZ9 A;  3I2A A;  5D61 A;  2YUG A;  2F2F A;  1A8D A;  3O4C A;  2XOA A;  4EFP A;  4IHZ A;  4GOY A;  3R4S A;  3ZC8 A;  4PC4 A;  2Q3N B;  3W9T A;  2RQ9 A;  3VT2 A;  3F1R A;  1JT7 A;  1G9C A;  3H6S E;  4I4X A;  1K5U A;  4LO8 B;  1IT0 A;  5FZZ A;  3NBE A;  4R6U B;  3O44 A;  3VWC A;  1PC8 B;  5F8Y A;  2X2T A;  1S0B A;  3UJ0 A;  4ZKT B;  3Q7Y A;  4OW4 A;  2AFG A;  1II4 A;  2E4M A;  1ITB A;  2VLC A;  4HA2 A;  3AH1 A;  1FWV A;  3N7J A;  3T8S A;  3FUQ A;  4I0Y A;  4ION A;  2BFH A;  2KLL A;  1FV2 A;  1S0D A;  4LO1 A;  3BAU A;  1ISZ A;  4ZGR B;  2D7R A;  3VSZ A;  1T4Q A;  3IM7 A;  4EKX B;  3P6I A;  3BAG A;  1D0H A;  1ISX A;  4DEN A;  5FZY A;  4XFT A;  1DZD A;  5BP5 C;  1BFB A;  3FUO A;  3WMU A;  1L2H A;  2HW9 A;  1AVU A;  4J2X A;  4ISR A;  2D43 A;  3PG0 A;  4QKS A;  1W3F A;  1J0S A;  1PUU B;  1OQL B;  1RY7 A;  31BI A;  2D44 A;  3VT1 A;  3FJI A;  3FJD A;  5BXR A;  1AVW B;  1S0C A;  1T9F A;  3FGM A;  5DSS B;  1TFM B;  4P0J A;  4I2S A;  3BAV A;  1NUN A;  2WRY A;  5GAQ A;  4J2S A;  4Q9P A;  3RTJ B;  4CJM A;  3ZXG A;  1W3G A;  2IWT B;  2QN4 A;  3NJ5 A;  5FZU A;  1FGA A;  4A7Z A;  2Y9F A;  3ZXD A;  1AFC A;  4H75 A;  4L4H A;  2Y9X E;  3I2X A;  1DZC A;  2AAI B;  1HIB A;  2Z48 A;  4I1B A;  21BI A;  3C9Z A;  3AJ6 A;  4XFU A;  5FNX A;  5BXT A;  3PHZ A;  4EB2 B;  3AKH A;  1Q1U A;  1TWE A;  1SR4 C;  3A22 A;  4USP A;  2Y9G A;  3QR5 A;  1WBA A;  3IM5 A;  3FJ8 A;  1IOB A;  3WA1 A;  4ZOT A;  3QYD A;  4Z8S B;  3S8J A;  1S0G A;  5E24 E;  3V79 C;  1FN0 A;  1WBC A;  3FJB A;  4P0L A;  3N7L A;  4JP0 A;  4GAF A;  1YBI A;  4I4P A;  4LO0 A;  4QAL A;  1BFC A;  1NZK A;  1GGP B;  3BAQ A;  1JY0 A;  3CA5 A;  4QO3 A;  4HJJ A;  3CU1 B;  4KEI A;  3AJ5 A;  4OEG A;  3AH4 A;  4Q9G A;  3NBN A;  1UPS A;  4JKX B;  4L4I A;  5EHA A;  3O3Q A;  4ZA3 B;  1FV3 A;  4XFS A;  2D22 A;  1V6X A;  3BAO A;  4IY8 A;  3BRD A;  4ZFU B;  1ISY A;  5G00 A;  5BXS A;  3CA4 A;  5JLV A;  1JTC A;  1QQK A;  1DQO A;  3A07 A;  1DIW A;  3UJ4 A;  2HWA A;  2I1B A;  4GAI A;  3H6R B;  4IYB A;  3CA6 A;  4IZE A;  2VUA A;  4AN6 A;  4H9W A;  3JUT A;  2D20 A;  1HWN B;  1M2T B;  4F83 A;  5BXP A;  5BP5 A;  5DVH A;  1W3A A;  4IQP A;  3A21 A;  3OGG A;  4OWL A;  1EV2 A;  1TP0 A;  1G9D A;  2AXM A;  3A23 A;  4D0T A;  4I4Q A;  3FJ9 A;  4G9M A;  3WIN C;  4I1E A;  4OWJ A;  3UD9 A;  1IRP A;  1HWP B;  3FJA A;  5F8S A;  3ZX7 A;  3Q7X A;  2KH2 A;  3NBD A;  3NBC A;  4D0Z A;  1YYN A;  3D7W B;  1IJT A;  1F31 A;  3BA7 A;  4G9N A;  1S0E A;  1V6W A;  2P23 A;  4I3N A;  2DS0 A;  3BA4 A;  3K1X A;  3ZC9 A;  1ONK B;  3IIR A;  4END A;  5FNW A;  4ISQ A;  4MZG B;  1VCL A;  3V0B A;  5F8W A;  3AKI A;  2WBC A;  3CA1 A;  3O4B A;  4OUJ A;  1G9B A;  4UY4 A;  4HR6 C;  4FVV A;  1R8N A;  1AF9 A;  1RML A;  2ERM A;  3BAD A;  1YXW A;  1SR4 A;  3Q7W A;  1HWM B;  2KI6 B;  3LTQ A;  2R9K B;  4J23 B;  1M16 A;  1ILR 1;  1JLX A;  1BFG A;  1PUM B;  2IHO A;  3V0A A;  2VXR A;  1YF8 B;  3BB2 A;  1FWU A;  1EVT A;  1FMZ A;  2BEA A;  4X38 A;  2M49 A;  1BAR A;  2BEB A;  1AVX B;  3BRF A;  1TOO A;  4Q91 A;  1JQZ A;  1DFQ A;  2MIB A;  2NYY A;  4QBV A;  3RTI B;  1JT5 A;  2HZ9 A;  3MPP G;  4YOL A;  4TLP A;  3OJ2 A;  4J2Y A;  3H6R A;  5BQU C;  2VSE A;  2KI4 A;  5EG6 C;  2D23 A;  3B9U A;  3ILA A;  1JT4 A;  4LO3 C;  3RMX A;  3OBT A;  4KEK A;  2X2S A;  2Y9W C;  4KEJ A;  4ZFW B;  1IIL A;  4IY9 A;  5DUY A;  2FO1 A;  1Q03 A;  4EEE B;  3WO3 A;  3N0K A;  4GP0 A;  3N7M A;  4H04 A;  4KBB A;  1KNM A;  3F62 B;  4QBC A;  1HCD A;  3CA3 A;  4I37 A;  3BRG C;  4GOV A;  3CA0 A;  4X3A A;  3BA5 A;  2GZB A;  1Z2V A;  4G6J A;  4AN7 B;  5BOW A;  1TTU A;  3PME A;  2FFV A;  2K4A B;  3I29 B;  1PWA A;  1HCE A;  3FFZ A;  4JPZ A;  2ET2 A;  7I1B A;  1JT3 A;  2DRE A;  4I8M A;  2RST A;  3P53 A;  3MAL A;  1BLA A;  4OWK A;  3WIN A;  4QD2 C;  1WD4 A;  3CQA A;  1P63 A;  3FJK A;  1Z0H A;  4Z9W B;  4I4Y A;  2NM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...