2AQZA

Crystal structure of fgf-1, s17t/n18t/g19 deletion mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
HHHHFNLPPGNYKKPKLLYCTTGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Conversion of type I 4:6 to 3:5 beta-turn types in human acidic fibroblast growth factor: Effects upon structure, stability, folding, and mitogenic function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2aqzA00
3I29B 1QQKA 1XHBA 4KEIA 3O44A 2Y9XE 4I8MA 2I1BA 3RTIB 1W3GA 2FFVA 3RMXA 1S0DA 4LO3A 1ISWA 4EFQA 3FJJA 1QXMA 3AH2A 2ET2A 3SNVA 4LO1C 2ERMA 1G9BA 3AZVA 1HIBA 3FJ8A 4XFTA 3Q7WA 3A23A 4OWJA 2Z49A 2HWAA 2ESUA 4X38A 1VCLA 2Q9XA 1JT3A 1MD6A 4OW4A 3FJEA 2D7RA 4GOYA 4D0TA 3I2AA 5DZUA 1ILR1 1G82A 1S0FA 1WD3A 1FMMS 2D44A 1ISZA 3CRGA 4R6UB 1V6WA 3RTJB 2FFUA 5FZYA 1AXMA 4G1RA 1L2HA 3HOMA 3BRDA 1II4A 4I1BA 1FV2A 2RQ9A 1ISVA 6I1BA 4JKQA 1M16A 3Q7YA 1HWNB 4Z9WB 4A7KA 1FWUA 1FGAA 4QKRA 4LO0C 3VUOA 2Y9FA 3WA1A 3A22A 3FUQA 4GAFA 4I4SA 1TFMB 1R8NA 4D0ZA 3RSJA 4TLPA 3WINA 2NM1A 4I7IA 4YOLA 1YBIA 2KH2A 4X3AA 1BLAA 1ISYA 4EFRA 2ZQOA 2HZ9A 2VSEA 1WD4A 4P0KA 1WBAA 4IY9A 4ENDA 3O5WB 1JT5A 3ZXGA 1EVTA 3CA0A 4I4RA 4I4PA 4IYBA 1PC8B 3UJ0A 3VT1A 1V6VA 1JT4A 4LO2A 3BRFA 3I2XA 2Z48A 3FJKA 2BEAA 4IONA 3IM6A 2D24A 2FDBM 2R9KB 3CU1B 3MALA 1OQLB 4OEFA 2BEBA 3H6RB 5JMCA 3H6SE 5D62A 4I3NA 5EG6C 3NBDA 2YUGA 4I0YA 4H9WA 4QBCA 2HW9A 3OJMA 4GP3A 4DEPA 2NP0A 5F8SA 1Q1UA 2GO2A 2VSAA 1DIWA 2RG9B 4ISRA 5FZZA 3O4BA 4G9MA 1DLLA 1DFCA 5G00A 3OGGA 1GGPB 4F34A 2L5XA 1Q03A 1Z0HA 1M2TB 3CRIA 1J0SA 3O4AA 1F31A 1S0EA 4OEGA 1FV3A 3A21A 3IM7A 4JAWA 4LO0A 3FJHA 3N7JA 3NJ5A 3O4CA 5EHAA 1K5VA 4A7YA 1JLYA 3BX1C 3V79C 4QKSA 1AF9A 3PG0A 2VU9A 3ZX7A 4KC3A 1T9FA 4XFUA 3N7KA 1AVUA 3RMYA 1JLXA 3AKHA 3BAUA 3HALA 4D8HA 3ZXDA 4QD2C 3FJDA 3JRRA 3N0KA 2DREA 5F8WA 2F2FC 5B2HA 1SR4A 2K43A 4JP0A 5E24E 2KLLA 2VXRA 1WBCA 2X2SA 4IZXA 4WBCA 3CQAA 1S0LA 1QQLA 3K1XA 4JPZA 3NBNA 3BADA 2IWTB 3FJFA 2M49A 2Y9WC 4KEJA 4DENA 4ZKTB 1G9CA 1JTCA 3BAOA 3BRGC 1TTUA 3CA1A 1YXWA 1XYFA 4F83A 3WMUA 4OUJA 3P6JA 3IAGC 4I4XA 1EYLA 1S0BA 4EEEB 3QR5A 4I4YA 2D7IA 1K5UA 2DRYA 5BXPA 1Z2VA 3O49A 2ZQNA 5BXRA 3R4SA 1RY7A 2MC2A 2D20A 2VXTI 2HWMA 5BQUC 5BXTA 4HJJA 4ZGRB 4JRAA 2K4AB 3IM5A 3AKGA 5FNXA 4HR6C 5FNWA 3OBTA 1W3FA 3B9UA 3BAVA 2GZBA 5BP5C 4I37A 4J23B 1XZZA 2X2TA 3VEQA 1W3AA 1IOBA 4ZFUB 2Q3NB 4G9NA 4G6JA 3PMEA 2QN4A 4J2KA 2D23A 4ZFYB 4L4HA 3ILAA 5EC5A 2D1ZA 5GAQA 2AAIB 3TC2A 2MIBA 4X37A 1TWMA 1TOOA 3VT2A 4LO1A 4USPA 3BTAA 1DZCA 5BOWA 4L4IA 2P23A 4GAIA 5I1BA 3AH4A 31BIA 1MC9A 2D22A 1N4KA 1IRPA 2K8RA 3WMVA 4Q91A 4GP0A 2KKIA 3P6IA 2NVHA 1ONKB 1FWVA 4J2SA 1S0CA 4P0LA 1S0GA 3KMVA 4LO3C 3UD8A 1EPWA 1Q04A 1R8OA 1UPSA 1RZOB 4FVVA 4J2YA 4LO8B 2MLLB 3PHZA 3CRHA 4KBBA 1TP0A 1BFGA 3N7MA 5HPZA 1HWMB 3R4UA 1TIEA 1AVWB 5DSSB 9ILBA 1DQOA 2QYIB 3H6RA 1IHKA 4EFPA 5BQUA 4KEKA 1NZKA 1YTOA 2BFHA 3EF2A 1I1EA 2J3PA 3AZWA 4I4OA 3UD9A 2VUAA 4I4VA 3NBCA 2WBCA 1I1BA 2FO1A 5BP5A 1IILA 1G9DA 1FQ9A 5FZUA 3FJBA 4ZBVB 4H04A 3OJ2A 4FGFA 1BASA 4QO3A 1DFQA 3VSZA 3Q7XA 2E4MC 5DUYA 1RMLA 1DJSB 4G6MA 4P6AA 1IT0A 4QALA 1BFCA 3UDAA 1IJTA 3AH1A 1DQGA 3O4OA 3N7LA 3F62B 2AQZA 2NZ9A 3FJIA 3HBWA 1ISXA 3OGFA 3FUOA 3BAHA 1Z4SA 4ZA3B 3WO4A 1A8DA 1D0HA 1HCDA 4I96A 2UUSA 3NBEA 3O4DA 1NUNA 4LO2C 1SZ6B 3F1RA 1RG8A 4AN6A 1HKNA 1FMZA 5D61A 3HSMA 5F8YA 3A07A 2DS0A 1PZZA 4USOA 5JLVA 3LLPA 4QC4A 4IQPA 4I6IA 4QBVA 4DCKC 2KI6B 3PUBA 5F90A 3V0AB 1XG6A 3MPPG 4QD2B 3FFZA 3T8SA 5D63A 4JKXB 4I2SA 1AVXB 3BA7A 1V6UA 3D7WB 1YYNA 4Z8SB 3V0BB 1T4QA 2XOAA 4ZLBB 1BLDA 3BB2A 3POKA 1BFBA 3W9TA 4Q9GA 2FGFA 4A7ZA 2E4MA 4IY8A 3V0AA 4I4QA 5DVHA 2DRZA 3S8KA 3FJCA 5BXSA 2F2FA 2F8XC 3CAHA 4J2XA 3C9ZA 3VT0A 1ABRB 4HA2A 2ZR1B 1HCEA 3CA5A 3V0BA 1P63A 3WO3A 2P39A 1CVSA 1DZDA 4II0A 4AN7B 2NYYA 4EKXB 4JQ0A 4XFSA 4P0JA 1ITBA 1BFFA 4XKIA 3IIRA 3ZC9A 4Q9PA 3AKIA 4CJMA 3ZC8A 1EV2A 1HWPB 4PC4A 4LO7C 5BVPI 2D43A 3BA4A 1V6XA 3CA4A 1SR4C 3H6QA 1HWOB 3S8JA 2AFGA 2RSTA 4ISQA 3OJVA 4IHZA 1AVAC 4I1EA 4ZFWB 1CE7B 4ZOTA 3HMYA 4EB2B 1PWAA 1YF8B 3CA6A 3WO2A 3OBRA 3FGMA 8I1BA 3AJ5A 1IRAX 3UD7A 3QYDA 3UJ4A 3CA3A 4IZEA 4X39A 3HN1A 41BIA 1TWEA 1JT7A 3BAQA 3VSFA 3AJ6A 4OWLA 1JY0A 2IHOA 1BARA 3E8LC 3FJAA 3P53A 4OWKA 2AXMA 7I1BA 1FN0A 1JQZA 2LIEA 3AKFA 3BAGA 1BA7A 1PUMB 4GOVA 3FJ9A 3O3QA 21BIA 2WRYA 2NTDA 1G9AA 4OEEA 2LIQA 1E0OA 2KI4A 3JUTA 4LO7B 1PUUB 2Y9GA 1AFCA 3BA5A 3VWCA 4I4UA 3LTQA 3WINC 1KNMA 2VLCA
chains in the Genus database with same CATH superfamily
3I29B 1QQKA 1XHBA 4KEIA 3O44A 2Y9XE 4I8MA 2I1BA 3RTIB 1W3GA 2FFVA 3RMXA 1S0DA 4LO3A 1ISWA 4EFQA 3FJJA 1QXMA 3AH2A 2ET2A 3SNVA 4LO1C 2ERMA 1G9BA 3AZVA 1HIBA 3FJ8A 4XFTA 3Q7WA 3A23A 4OWJA 2Z49A 2HWAA 2ESUA 4X38A 1VCLA 2Q9XA 1JT3A 1MD6A 4OW4A 3FJEA 2D7RA 4GOYA 4D0TA 3I2AA 5DZUA 1ILR1 1G82A 1S0FA 1WD3A 1FMMS 2D44A 1ISZA 4H75A 3CRGA 4R6UB 1V6WA 3RTJB 2FFUA 5FZYA 1AXMA 4G1RA 1L2HA 3HOMA 3BRDA 1II4A 4I1BA 1FV2A 2RQ9A 1ISVA 6I1BA 4JKQA 1M16A 3Q7YA 1HWNB 4Z9WB 4A7KA 1FWUA 1FGAA 4QKRA 4LO0C 3VUOA 2Y9FA 3WA1A 3A22A 3FUQA 4GAFA 4I4SA 1TFMB 1R8NA 4D0ZA 3RSJA 4TLPA 3WINA 2NM1A 4I7IA 4YOLA 1YBIA 2KH2A 4X3AA 1BLAA 1ISYA 4EFRA 2ZQOA 2HZ9A 2VSEA 1WD4A 4P0KA 1WBAA 4IY9A 4ENDA 3O5WB 1JT5A 3ZXGA 1EVTA 3CA0A 4I4RA 4I4PA 4IYBA 1PC8B 3UJ0A 3VT1A 1V6VA 1JT4A 4LO2A 3BRFA 3I2XA 2Z48A 3FJKA 2BEAA 4IONA 3IM6A 2D24A 2FDBM 2R9KB 3CU1B 4MZGB 3MALA 1OQLB 4OEFA 2BEBA 3H6RB 5JMCA 3H6SE 5D62A 4I3NA 5EG6C 3NBDA 2YUGA 4I0YA 4H9WA 4QBCA 2HW9A 3OJMA 4GP3A 4DEPA 2NP0A 5F8SA 1Q1UA 2GO2A 2VSAA 1DIWA 2RG9B 4ISRA 5FZZA 3O4BA 4G9MA 1DLLA 1DFCA 5G00A 3OGGA 1GGPB 4F34A 2L5XA 1Q03A 1Z0HA 1M2TB 3CRIA 1J0SA 3O4AA 1F31A 1S0EA 4OEGA 1FV3A 3A21A 3IM7A 4JAWA 4LO0A 3FJHA 3N7JA 3NJ5A 3O4CA 5EHAA 1K5VA 4A7YA 1JLYA 3BX1C 3V79C 4QKSA 1AF9A 3PG0A 2VU9A 3ZX7A 4KC3A 1T9FA 4XFUA 3N7KA 1AVUA 3RMYA 1JLXA 3AKHA 3BAUA 3HALA 4MZHA 4D8HA 3ZXDA 4QD2C 3FJDA 3JRRA 3N0KA 2DREA 5F8WA 2F2FC 5B2HA 1SR4A 2K43A 4JP0A 5E24E 2KLLA 2VXRA 1WBCA 2X2SA 4IZXA 4WBCA 3CQAA 1S0LA 1QQLA 3K1XA 4JPZA 3NBNA 3BADA 2IWTB 3FJFA 2M49A 2Y9WC 4KEJA 4DENA 4ZKTB 1G9CA 1JTCA 3BAOA 3BRGC 1TTUA 3CA1A 1YXWA 1XYFA 4F83A 3WMUA 4OUJA 3P6JA 3IAGC 4I4XA 1EYLA 1S0BA 4EEEB 3QR5A 4I4YA 2D7IA 1K5UA 2DRYA 5BXPA 1Z2VA 3O49A 2ZQNA 5BXRA 3R4SA 1RY7A 2MC2A 2D20A 2VXTI 2HWMA 5BQUC 5BXTA 4HJJA 4ZGRB 4JRAA 2K4AB 3IM5A 3AKGA 5FNXA 4HR6C 5FNWA 3OBTA 1W3FA 3B9UA 3BAVA 2GZBA 5BP5C 4I37A 4J23B 1XZZA 2X2TA 4UY4A 3VEQA 1W3AA 1IOBA 4ZFUB 2Q3NB 4G9NA 4G6JA 3PMEA 2QN4A 4J2KA 2D23A 4ZFYB 4L4HA 3ILAA 5EC5A 2D1ZA 5GAQA 2AAIB 3TC2A 2MIBA 4X37A 1TWMA 1TOOA 3VT2A 4LO1A 4USPA 3BTAA 1DZCA 5BOWA 4L4IA 2P23A 4GAIA 5I1BA 3AH4A 31BIA 1MC9A 2D22A 1N4KA 1IRPA 2K8RA 3WMVA 4Q91A 4GP0A 2KKIA 3P6IA 2NVHA 1ONKB 1FWVA 4J2SA 1S0CA 4P0LA 1S0GA 3KMVA 4LO3C 3UD8A 1EPWA 1Q04A 1R8OA 1UPSA 1RZOB 4FVVA 4J2YA 4LO8B 2MLLB 3PHZA 3CRHA 4KBBA 1TP0A 1BFGA 3N7MA 5HPZA 1HWMB 3R4UA 1TIEA 1AVWB 5DSSB 9ILBA 1DQOA 2QYIB 3H6RA 1IHKA 4EFPA 5BQUA 4KEKA 1NZKA 1YTOA 2BFHA 3EF2A 1I1EA 2J3PA 3AZWA 4I4OA 3UD9A 2VUAA 4I4VA 3NBCA 2WBCA 1I1BA 2FO1A 5BP5A 1IILA 1G9DA 1FQ9A 5FZUA 3FJBA 4ZBVB 4H04A 3OJ2A 4FGFA 1BASA 4QO3A 1DFQA 3VSZA 3Q7XA 2E4MC 5DUYA 1RMLA 1DJSB 4G6MA 4P6AA 1IT0A 4QALA 1BFCA 3UDAA 1IJTA 3AH1A 1DQGA 3O4OA 3N7LA 3F62B 2AQZA 2NZ9A 3FJIA 3HBWA 1ISXA 3OGFA 3FUOA 3BAHA 1Z4SA 4ZA3B 3WO4A 1A8DA 1D0HA 1HCDA 4I96A 2UUSA 3NBEA 3O4DA 1NUNA 4LO2C 1SZ6B 3F1RA 1RG8A 4AN6A 1HKNA 1FMZA 5D61A 3HSMA 5F8YA 3A07A 2DS0A 1PZZA 4USOA 5JLVA 3LLPA 4QC4A 4IQPA 4I6IA 4QBVA 4DCKC 2KI6B 3PUBA 5F90A 3V0AB 1XG6A 3MPPG 4QD2B 3FFZA 3T8SA 5D63A 4JKXB 4I2SA 1AVXB 3BA7A 1V6UA 3D7WB 1YYNA 4Z8SB 3V0BB 1T4QA 2XOAA 4ZLBB 1BLDA 3BB2A 3POKA 1BFBA 3W9TA 4Q9GA 2FGFA 4A7ZA 2E4MA 4IY8A 3V0AA 4I4QA 5DVHA 2DRZA 3S8KA 3FJCA 5BXSA 2F2FA 2F8XC 3CAHA 4J2XA 3C9ZA 3VT0A 1ABRB 4HA2A 2ZR1B 1HCEA 3CA5A 3V0BA 1P63A 3WO3A 2P39A 1CVSA 1DZDA 4II0A 4AN7B 2NYYA 4EKXB 4JQ0A 4XFSA 4P0JA 1ITBA 1BFFA 4XKIA 3IIRA 3ZC9A 4Q9PA 3AKIA 4CJMA 3ZC8A 1EV2A 4MZFB 1HWPB 4PC4A 4LO7C 5BVPI 2D43A 3BA4A 1V6XA 3CA4A 1SR4C 3H6QA 1HWOB 3S8JA 2AFGA 2RSTA 4ISQA 3OJVA 4IHZA 1AVAC 4I1EA 4ZFWB 1CE7B 4ZOTA 3HMYA 4EB2B 1PWAA 1YF8B 3CA6A 3WO2A 3OBRA 3FGMA 8I1BA 3AJ5A 1IRAX 3UD7A 3QYDA 3UJ4A 3CA3A 4IZEA 4X39A 3HN1A 41BIA 1TWEA 1JT7A 3BAQA 3VSFA 3AJ6A 4OWLA 1JY0A 2IHOA 1BARA 3E8LC 3FJAA 3P53A 4OWKA 2AXMA 7I1BA 1FN0A 1JQZA 2LIEA 3AKFA 3BAGA 1BA7A 1PUMB 4GOVA 2NS2A 3FJ9A 3O3QA 21BIA 2WRYA 2NTDA 1G9AA 4OEEA 2LIQA 1E0OA 2KI4A 3JUTA 4LO7B 1PUUB 2Y9GA 1AFCA 3BA5A 3VWCA 4I4UA 3LTQA 3WINC 1KNMA 2VLCA
chains in the Genus database with same CATH topology
3I29B 1QQKA 1XHBA 4KEIA 3O44A 2Y9XE 4I8MA 2I1BA 3RTIB 1W3GA 2FFVA 3RMXA 1S0DA 4LO3A 1ISWA 4EFQA 3FJJA 1QXMA 3AH2A 2ET2A 3SNVA 4LO1C 2ERMA 1G9BA 3AZVA 1HIBA 3FJ8A 4XFTA 3Q7WA 3A23A 4OWJA 2Z49A 2HWAA 2ESUA 4X38A 1VCLA 2Q9XA 1JT3A 1MD6A 4OW4A 3FJEA 2D7RA 4GOYA 4D0TA 3I2AA 5DZUA 1ILR1 1G82A 1S0FA 1WD3A 1FMMS 2D44A 1ISZA 4H75A 3CRGA 4R6UB 1V6WA 3RTJB 2FFUA 5FZYA 1AXMA 4G1RA 1L2HA 3HOMA 3BRDA 1II4A 4I1BA 1FV2A 2RQ9A 1ISVA 6I1BA 4JKQA 1M16A 3Q7YA 1HWNB 4Z9WB 4A7KA 1FWUA 1FGAA 4QKRA 4LO0C 3VUOA 2Y9FA 3WA1A 3A22A 3FUQA 4GAFA 4I4SA 1TFMB 1R8NA 4D0ZA 3RSJA 4TLPA 3WINA 2NM1A 4I7IA 4YOLA 1YBIA 2KH2A 4X3AA 1BLAA 1ISYA 4EFRA 2ZQOA 2HZ9A 2VSEA 1WD4A 4P0KA 1WBAA 4IY9A 4ENDA 3O5WB 1JT5A 3ZXGA 1EVTA 3CA0A 4I4RA 4I4PA 4IYBA 1PC8B 3UJ0A 3VT1A 1V6VA 1JT4A 4LO2A 3BRFA 3I2XA 2Z48A 3FJKA 2BEAA 4IONA 3IM6A 2D24A 2FDBM 2R9KB 3CU1B 4MZGB 3MALA 1OQLB 4OEFA 2BEBA 3H6RB 5JMCA 3H6SE 5D62A 4I3NA 5EG6C 3NBDA 2YUGA 4I0YA 4H9WA 4QBCA 2HW9A 3OJMA 4GP3A 4DEPA 2NP0A 5F8SA 1Q1UA 2GO2A 2VSAA 1DIWA 2RG9B 4ISRA 5FZZA 3O4BA 4G9MA 1DLLA 1DFCA 5G00A 3OGGA 1GGPB 4F34A 2L5XA 1Q03A 1Z0HA 1M2TB 3CRIA 1J0SA 3O4AA 1F31A 1S0EA 4OEGA 1FV3A 3A21A 3IM7A 4JAWA 4LO0A 3FJHA 3N7JA 3NJ5A 3O4CA 5EHAA 1K5VA 4A7YA 1JLYA 3BX1C 3V79C 4QKSA 1AF9A 3PG0A 2VU9A 3ZX7A 4KC3A 1T9FA 4XFUA 3N7KA 1AVUA 3RMYA 1JLXA 3AKHA 3BAUA 3HALA 4MZHA 4D8HA 3ZXDA 4QD2C 3FJDA 3JRRA 3N0KA 2DREA 5F8WA 2F2FC 5B2HA 1SR4A 2K43A 4JP0A 5E24E 2KLLA 2VXRA 1WBCA 2X2SA 4IZXA 4WBCA 3CQAA 1S0LA 1QQLA 3K1XA 4JPZA 3NBNA 3BADA 2IWTB 3FJFA 2M49A 2Y9WC 4KEJA 4DENA 4ZKTB 1G9CA 1JTCA 3BAOA 3BRGC 1TTUA 3CA1A 1YXWA 1XYFA 4F83A 3WMUA 4OUJA 3P6JA 3IAGC 4I4XA 1EYLA 1S0BA 4EEEB 3QR5A 4I4YA 2D7IA 1K5UA 2DRYA 5BXPA 1Z2VA 3O49A 2ZQNA 5BXRA 3R4SA 1RY7A 2MC2A 2D20A 2VXTI 2HWMA 5BQUC 5BXTA 4HJJA 4ZGRB 4JRAA 2K4AB 3IM5A 3AKGA 5FNXA 4HR6C 5FNWA 3OBTA 1W3FA 3B9UA 3BAVA 2GZBA 5BP5C 4I37A 4J23B 1XZZA 2X2TA 4UY4A 3VEQA 1W3AA 1IOBA 4ZFUB 2Q3NB 4G9NA 4G6JA 3PMEA 2QN4A 4J2KA 2D23A 4ZFYB 4L4HA 3ILAA 5EC5A 2D1ZA 5GAQA 2AAIB 3TC2A 2MIBA 4X37A 1TWMA 1TOOA 3VT2A 4LO1A 4USPA 3BTAA 1DZCA 5BOWA 4L4IA 2P23A 4GAIA 5I1BA 3AH4A 31BIA 1MC9A 2D22A 1N4KA 1IRPA 2K8RA 3WMVA 4Q91A 4GP0A 2KKIA 3P6IA 2NVHA 1ONKB 1FWVA 4J2SA 1S0CA 4P0LA 1S0GA 3KMVA 4LO3C 3UD8A 1EPWA 1Q04A 1R8OA 1UPSA 1RZOB 4FVVA 4J2YA 4LO8B 2MLLB 3PHZA 3CRHA 4KBBA 1TP0A 1BFGA 3N7MA 5HPZA 1HWMB 3R4UA 1TIEA 1AVWB 5DSSB 9ILBA 1DQOA 2QYIB 3H6RA 1IHKA 4EFPA 5BQUA 4KEKA 1NZKA 1YTOA 2BFHA 3EF2A 1I1EA 2J3PA 3AZWA 4I4OA 3UD9A 2VUAA 4I4VA 3NBCA 2WBCA 1I1BA 2FO1A 5BP5A 1IILA 1G9DA 1FQ9A 5FZUA 3FJBA 4ZBVB 4H04A 3OJ2A 4FGFA 1BASA 4QO3A 1DFQA 3VSZA 3Q7XA 2E4MC 5DUYA 1RMLA 1DJSB 4G6MA 4P6AA 1IT0A 4QALA 1BFCA 3UDAA 1IJTA 3AH1A 1DQGA 3O4OA 3N7LA 3F62B 2AQZA 2NZ9A 3FJIA 3HBWA 1ISXA 3OGFA 3FUOA 3BAHA 1Z4SA 4ZA3B 3WO4A 1A8DA 1D0HA 1HCDA 4I96A 2UUSA 3NBEA 3O4DA 1NUNA 4LO2C 1SZ6B 3F1RA 1RG8A 4AN6A 1HKNA 1FMZA 5D61A 3HSMA 5F8YA 3A07A 2DS0A 1PZZA 4USOA 5JLVA 3LLPA 4QC4A 4IQPA 4I6IA 4QBVA 4DCKC 2KI6B 3PUBA 5F90A 3V0AB 1XG6A 3MPPG 4QD2B 3FFZA 3T8SA 5D63A 4JKXB 4I2SA 1AVXB 3BA7A 1V6UA 3D7WB 1YYNA 4Z8SB 3V0BB 1T4QA 2XOAA 4ZLBB 1BLDA 3BB2A 3POKA 1BFBA 3W9TA 4Q9GA 2FGFA 4A7ZA 2E4MA 4IY8A 3V0AA 4I4QA 5DVHA 2DRZA 3S8KA 3FJCA 5BXSA 2F2FA 2F8XC 3CAHA 4J2XA 3C9ZA 3VT0A 1ABRB 4HA2A 2ZR1B 1HCEA 3CA5A 3V0BA 1P63A 3WO3A 2P39A 1CVSA 1DZDA 4II0A 4AN7B 2NYYA 4EKXB 4JQ0A 4XFSA 4P0JA 1ITBA 1BFFA 4XKIA 3IIRA 3ZC9A 4Q9PA 3AKIA 4CJMA 3ZC8A 1EV2A 4MZFB 1HWPB 4PC4A 4LO7C 5BVPI 2D43A 3BA4A 1V6XA 3CA4A 1SR4C 3H6QA 1HWOB 3S8JA 2AFGA 2RSTA 4ISQA 3OJVA 4IHZA 1AVAC 4I1EA 4ZFWB 1CE7B 4ZOTA 3HMYA 4EB2B 1PWAA 1YF8B 3CA6A 3WO2A 3OBRA 3FGMA 8I1BA 3AJ5A 1IRAX 3UD7A 3QYDA 3UJ4A 3CA3A 4IZEA 4X39A 3HN1A 41BIA 1TWEA 1JT7A 3BAQA 3VSFA 3AJ6A 4OWLA 1JY0A 2IHOA 1BARA 3E8LC 3FJAA 3P53A 4OWKA 2AXMA 7I1BA 1FN0A 1JQZA 2LIEA 3AKFA 3BAGA 1BA7A 1PUMB 4GOVA 2NS2A 3FJ9A 3O3QA 21BIA 2WRYA 2NTDA 1G9AA 4OEEA 2LIQA 1E0OA 2KI4A 3JUTA 4LO7B 1PUUB 2Y9GA 1AFCA 3BA5A 3VWCA 4I4UA 3LTQA 3WINC 1KNMA 2VLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I29 B;  1QQK A;  1XHB A;  4KEI A;  3O44 A;  2Y9X E;  4I8M A;  2I1B A;  3RTI B;  1W3G A;  2FFV A;  3RMX A;  1S0D A;  4LO3 A;  1ISW A;  4EFQ A;  3FJJ A;  1QXM A;  3AH2 A;  2ET2 A;  3SNV A;  4LO1 C;  2ERM A;  1G9B A;  3AZV A;  1HIB A;  3FJ8 A;  4XFT A;  3Q7W A;  3A23 A;  4OWJ A;  2Z49 A;  2HWA A;  2ESU A;  4X38 A;  1VCL A;  2Q9X A;  1JT3 A;  1MD6 A;  4OW4 A;  3FJE A;  2D7R A;  4GOY A;  4D0T A;  3I2A A;  5DZU A;  1ILR 1;  1G82 A;  1S0F A;  1WD3 A;  1FMM S;  2D44 A;  1ISZ A;  3CRG A;  4R6U B;  1V6W A;  3RTJ B;  2FFU A;  5FZY A;  1AXM A;  4G1R A;  1L2H A;  3HOM A;  3BRD A;  1II4 A;  4I1B A;  1FV2 A;  2RQ9 A;  1ISV A;  6I1B A;  4JKQ A;  1M16 A;  3Q7Y A;  1HWN B;  4Z9W B;  4A7K A;  1FWU A;  1FGA A;  4QKR A;  4LO0 C;  3VUO A;  2Y9F A;  3WA1 A;  3A22 A;  3FUQ A;  4GAF A;  4I4S A;  1TFM B;  1R8N A;  4D0Z A;  3RSJ A;  4TLP A;  3WIN A;  2NM1 A;  4I7I A;  4YOL A;  1YBI A;  2KH2 A;  4X3A A;  1BLA A;  1ISY A;  4EFR A;  2ZQO A;  2HZ9 A;  2VSE A;  1WD4 A;  4P0K A;  1WBA A;  4IY9 A;  4END A;  3O5W B;  1JT5 A;  3ZXG A;  1EVT A;  3CA0 A;  4I4R A;  4I4P A;  4IYB A;  1PC8 B;  3UJ0 A;  3VT1 A;  1V6V A;  1JT4 A;  4LO2 A;  3BRF A;  3I2X A;  2Z48 A;  3FJK A;  2BEA A;  4ION A;  3IM6 A;  2D24 A;  2FDB M;  2R9K B;  3CU1 B;  3MAL A;  1OQL B;  4OEF A;  2BEB A;  3H6R B;  5JMC A;  3H6S E;  5D62 A;  4I3N A;  5EG6 C;  3NBD A;  2YUG A;  4I0Y A;  4H9W A;  4QBC A;  2HW9 A;  3OJM A;  4GP3 A;  4DEP A;  2NP0 A;  5F8S A;  1Q1U A;  2GO2 A;  2VSA A;  1DIW A;  2RG9 B;  4ISR A;  5FZZ A;  3O4B A;  4G9M A;  1DLL A;  1DFC A;  5G00 A;  3OGG A;  1GGP B;  4F34 A;  2L5X A;  1Q03 A;  1Z0H A;  1M2T B;  3CRI A;  1J0S A;  3O4A A;  1F31 A;  1S0E A;  4OEG A;  1FV3 A;  3A21 A;  3IM7 A;  4JAW A;  4LO0 A;  3FJH A;  3N7J A;  3NJ5 A;  3O4C A;  5EHA A;  1K5V A;  4A7Y A;  1JLY A;  3BX1 C;  3V79 C;  4QKS A;  1AF9 A;  3PG0 A;  2VU9 A;  3ZX7 A;  4KC3 A;  1T9F A;  4XFU A;  3N7K A;  1AVU A;  3RMY A;  1JLX A;  3AKH A;  3BAU A;  3HAL A;  4D8H A;  3ZXD A;  4QD2 C;  3FJD A;  3JRR A;  3N0K A;  2DRE A;  5F8W A;  2F2F C;  5B2H A;  1SR4 A;  2K43 A;  4JP0 A;  5E24 E;  2KLL A;  2VXR A;  1WBC A;  2X2S A;  4IZX A;  4WBC A;  3CQA A;  1S0L A;  1QQL A;  3K1X A;  4JPZ A;  3NBN A;  3BAD A;  2IWT B;  3FJF A;  2M49 A;  2Y9W C;  4KEJ A;  4DEN A;  4ZKT B;  1G9C A;  1JTC A;  3BAO A;  3BRG C;  1TTU A;  3CA1 A;  1YXW A;  1XYF A;  4F83 A;  3WMU A;  4OUJ A;  3P6J A;  3IAG C;  4I4X A;  1EYL A;  1S0B A;  4EEE B;  3QR5 A;  4I4Y A;  2D7I A;  1K5U A;  2DRY A;  5BXP A;  1Z2V A;  3O49 A;  2ZQN A;  5BXR A;  3R4S A;  1RY7 A;  2MC2 A;  2D20 A;  2VXT I;  2HWM A;  5BQU C;  5BXT A;  4HJJ A;  4ZGR B;  4JRA A;  2K4A B;  3IM5 A;  3AKG A;  5FNX A;  4HR6 C;  5FNW A;  3OBT A;  1W3F A;  3B9U A;  3BAV A;  2GZB A;  5BP5 C;  4I37 A;  4J23 B;  1XZZ A;  2X2T A;  3VEQ A;  1W3A A;  1IOB A;  4ZFU B;  2Q3N B;  4G9N A;  4G6J A;  3PME A;  2QN4 A;  4J2K A;  2D23 A;  4ZFY B;  4L4H A;  3ILA A;  5EC5 A;  2D1Z A;  5GAQ A;  2AAI B;  3TC2 A;  2MIB A;  4X37 A;  1TWM A;  1TOO A;  3VT2 A;  4LO1 A;  4USP A;  3BTA A;  1DZC A;  5BOW A;  4L4I A;  2P23 A;  4GAI A;  5I1B A;  3AH4 A;  31BI A;  1MC9 A;  2D22 A;  1N4K A;  1IRP A;  2K8R A;  3WMV A;  4Q91 A;  4GP0 A;  2KKI A;  3P6I A;  2NVH A;  1ONK B;  1FWV A;  4J2S A;  1S0C A;  4P0L A;  1S0G A;  3KMV A;  4LO3 C;  3UD8 A;  1EPW A;  1Q04 A;  1R8O A;  1UPS A;  1RZO B;  4FVV A;  4J2Y A;  4LO8 B;  2MLL B;  3PHZ A;  3CRH A;  4KBB A;  1TP0 A;  1BFG A;  3N7M A;  5HPZ A;  1HWM B;  3R4U A;  1TIE A;  1AVW B;  5DSS B;  9ILB A;  1DQO A;  2QYI B;  3H6R A;  1IHK A;  4EFP A;  5BQU A;  4KEK A;  1NZK A;  1YTO A;  2BFH A;  3EF2 A;  1I1E A;  2J3P A;  3AZW A;  4I4O A;  3UD9 A;  2VUA A;  4I4V A;  3NBC A;  2WBC A;  1I1B A;  2FO1 A;  5BP5 A;  1IIL A;  1G9D A;  1FQ9 A;  5FZU A;  3FJB A;  4ZBV B;  4H04 A;  3OJ2 A;  4FGF A;  1BAS A;  4QO3 A;  1DFQ A;  3VSZ A;  3Q7X A;  2E4M C;  5DUY A;  1RML A;  1DJS B;  4G6M A;  4P6A A;  1IT0 A;  4QAL A;  1BFC A;  3UDA A;  1IJT A;  3AH1 A;  1DQG A;  3O4O A;  3N7L A;  3F62 B;  2AQZ A;  2NZ9 A;  3FJI A;  3HBW A;  1ISX A;  3OGF A;  3FUO A;  3BAH A;  1Z4S A;  4ZA3 B;  3WO4 A;  1A8D A;  1D0H A;  1HCD A;  4I96 A;  2UUS A;  3NBE A;  3O4D A;  1NUN A;  4LO2 C;  1SZ6 B;  3F1R A;  1RG8 A;  4AN6 A;  1HKN A;  1FMZ A;  5D61 A;  3HSM A;  5F8Y A;  3A07 A;  2DS0 A;  1PZZ A;  4USO A;  5JLV A;  3LLP A;  4QC4 A;  4IQP A;  4I6I A;  4QBV A;  4DCK C;  2KI6 B;  3PUB A;  5F90 A;  3V0A B;  1XG6 A;  3MPP G;  4QD2 B;  3FFZ A;  3T8S A;  5D63 A;  4JKX B;  4I2S A;  1AVX B;  3BA7 A;  1V6U A;  3D7W B;  1YYN A;  4Z8S B;  3V0B B;  1T4Q A;  2XOA A;  4ZLB B;  1BLD A;  3BB2 A;  3POK A;  1BFB A;  3W9T A;  4Q9G A;  2FGF A;  4A7Z A;  2E4M A;  4IY8 A;  3V0A A;  4I4Q A;  5DVH A;  2DRZ A;  3S8K A;  3FJC A;  5BXS A;  2F2F A;  2F8X C;  3CAH A;  4J2X A;  3C9Z A;  3VT0 A;  1ABR B;  4HA2 A;  2ZR1 B;  1HCE A;  3CA5 A;  3V0B A;  1P63 A;  3WO3 A;  2P39 A;  1CVS A;  1DZD A;  4II0 A;  4AN7 B;  2NYY A;  4EKX B;  4JQ0 A;  4XFS A;  4P0J A;  1ITB A;  1BFF A;  4XKI A;  3IIR A;  3ZC9 A;  4Q9P A;  3AKI A;  4CJM A;  3ZC8 A;  1EV2 A;  1HWP B;  4PC4 A;  4LO7 C;  5BVP I;  2D43 A;  3BA4 A;  1V6X A;  3CA4 A;  1SR4 C;  3H6Q A;  1HWO B;  3S8J A;  2AFG A;  2RST A;  4ISQ A;  3OJV A;  4IHZ A;  1AVA C;  4I1E A;  4ZFW B;  1CE7 B;  4ZOT A;  3HMY A;  4EB2 B;  1PWA A;  1YF8 B;  3CA6 A;  3WO2 A;  3OBR A;  3FGM A;  8I1B A;  3AJ5 A;  1IRA X;  3UD7 A;  3QYD A;  3UJ4 A;  3CA3 A;  4IZE A;  4X39 A;  3HN1 A;  41BI A;  1TWE A;  1JT7 A;  3BAQ A;  3VSF A;  3AJ6 A;  4OWL A;  1JY0 A;  2IHO A;  1BAR A;  3E8L C;  3FJA A;  3P53 A;  4OWK A;  2AXM A;  7I1B A;  1FN0 A;  1JQZ A;  2LIE A;  3AKF A;  3BAG A;  1BA7 A;  1PUM B;  4GOV A;  3FJ9 A;  3O3Q A;  21BI A;  2WRY A;  2NTD A;  1G9A A;  4OEE A;  2LIQ A;  1E0O A;  2KI4 A;  3JUT A;  4LO7 B;  1PUU B;  2Y9G A;  1AFC A;  3BA5 A;  3VWC A;  4I4U A;  3LTQ A;  3WIN C;  1KNM A;  2VLC A; 
#chains in the Genus database with same CATH topology
 3I29 B;  1QQK A;  1XHB A;  4KEI A;  3O44 A;  2Y9X E;  4I8M A;  2I1B A;  3RTI B;  1W3G A;  2FFV A;  3RMX A;  1S0D A;  4LO3 A;  1ISW A;  4EFQ A;  3FJJ A;  1QXM A;  3AH2 A;  2ET2 A;  3SNV A;  4LO1 C;  2ERM A;  1G9B A;  3AZV A;  1HIB A;  3FJ8 A;  4XFT A;  3Q7W A;  3A23 A;  4OWJ A;  2Z49 A;  2HWA A;  2ESU A;  4X38 A;  1VCL A;  2Q9X A;  1JT3 A;  1MD6 A;  4OW4 A;  3FJE A;  2D7R A;  4GOY A;  4D0T A;  3I2A A;  5DZU A;  1ILR 1;  1G82 A;  1S0F A;  1WD3 A;  1FMM S;  2D44 A;  1ISZ A;  4H75 A;  3CRG A;  4R6U B;  1V6W A;  3RTJ B;  2FFU A;  5FZY A;  1AXM A;  4G1R A;  1L2H A;  3HOM A;  3BRD A;  1II4 A;  4I1B A;  1FV2 A;  2RQ9 A;  1ISV A;  6I1B A;  4JKQ A;  1M16 A;  3Q7Y A;  1HWN B;  4Z9W B;  4A7K A;  1FWU A;  1FGA A;  4QKR A;  4LO0 C;  3VUO A;  2Y9F A;  3WA1 A;  3A22 A;  3FUQ A;  4GAF A;  4I4S A;  1TFM B;  1R8N A;  4D0Z A;  3RSJ A;  4TLP A;  3WIN A;  2NM1 A;  4I7I A;  4YOL A;  1YBI A;  2KH2 A;  4X3A A;  1BLA A;  1ISY A;  4EFR A;  2ZQO A;  2HZ9 A;  2VSE A;  1WD4 A;  4P0K A;  1WBA A;  4IY9 A;  4END A;  3O5W B;  1JT5 A;  3ZXG A;  1EVT A;  3CA0 A;  4I4R A;  4I4P A;  4IYB A;  1PC8 B;  3UJ0 A;  3VT1 A;  1V6V A;  1JT4 A;  4LO2 A;  3BRF A;  3I2X A;  2Z48 A;  3FJK A;  2BEA A;  4ION A;  3IM6 A;  2D24 A;  2FDB M;  2R9K B;  3CU1 B;  4MZG B;  3MAL A;  1OQL B;  4OEF A;  2BEB A;  3H6R B;  5JMC A;  3H6S E;  5D62 A;  4I3N A;  5EG6 C;  3NBD A;  2YUG A;  4I0Y A;  4H9W A;  4QBC A;  2HW9 A;  3OJM A;  4GP3 A;  4DEP A;  2NP0 A;  5F8S A;  1Q1U A;  2GO2 A;  2VSA A;  1DIW A;  2RG9 B;  4ISR A;  5FZZ A;  3O4B A;  4G9M A;  1DLL A;  1DFC A;  5G00 A;  3OGG A;  1GGP B;  4F34 A;  2L5X A;  1Q03 A;  1Z0H A;  1M2T B;  3CRI A;  1J0S A;  3O4A A;  1F31 A;  1S0E A;  4OEG A;  1FV3 A;  3A21 A;  3IM7 A;  4JAW A;  4LO0 A;  3FJH A;  3N7J A;  3NJ5 A;  3O4C A;  5EHA A;  1K5V A;  4A7Y A;  1JLY A;  3BX1 C;  3V79 C;  4QKS A;  1AF9 A;  3PG0 A;  2VU9 A;  3ZX7 A;  4KC3 A;  1T9F A;  4XFU A;  3N7K A;  1AVU A;  3RMY A;  1JLX A;  3AKH A;  3BAU A;  3HAL A;  4MZH A;  4D8H A;  3ZXD A;  4QD2 C;  3FJD A;  3JRR A;  3N0K A;  2DRE A;  5F8W A;  2F2F C;  5B2H A;  1SR4 A;  2K43 A;  4JP0 A;  5E24 E;  2KLL A;  2VXR A;  1WBC A;  2X2S A;  4IZX A;  4WBC A;  3CQA A;  1S0L A;  1QQL A;  3K1X A;  4JPZ A;  3NBN A;  3BAD A;  2IWT B;  3FJF A;  2M49 A;  2Y9W C;  4KEJ A;  4DEN A;  4ZKT B;  1G9C A;  1JTC A;  3BAO A;  3BRG C;  1TTU A;  3CA1 A;  1YXW A;  1XYF A;  4F83 A;  3WMU A;  4OUJ A;  3P6J A;  3IAG C;  4I4X A;  1EYL A;  1S0B A;  4EEE B;  3QR5 A;  4I4Y A;  2D7I A;  1K5U A;  2DRY A;  5BXP A;  1Z2V A;  3O49 A;  2ZQN A;  5BXR A;  3R4S A;  1RY7 A;  2MC2 A;  2D20 A;  2VXT I;  2HWM A;  5BQU C;  5BXT A;  4HJJ A;  4ZGR B;  4JRA A;  2K4A B;  3IM5 A;  3AKG A;  5FNX A;  4HR6 C;  5FNW A;  3OBT A;  1W3F A;  3B9U A;  3BAV A;  2GZB A;  5BP5 C;  4I37 A;  4J23 B;  1XZZ A;  2X2T A;  4UY4 A;  3VEQ A;  1W3A A;  1IOB A;  4ZFU B;  2Q3N B;  4G9N A;  4G6J A;  3PME A;  2QN4 A;  4J2K A;  2D23 A;  4ZFY B;  4L4H A;  3ILA A;  5EC5 A;  2D1Z A;  5GAQ A;  2AAI B;  3TC2 A;  2MIB A;  4X37 A;  1TWM A;  1TOO A;  3VT2 A;  4LO1 A;  4USP A;  3BTA A;  1DZC A;  5BOW A;  4L4I A;  2P23 A;  4GAI A;  5I1B A;  3AH4 A;  31BI A;  1MC9 A;  2D22 A;  1N4K A;  1IRP A;  2K8R A;  3WMV A;  4Q91 A;  4GP0 A;  2KKI A;  3P6I A;  2NVH A;  1ONK B;  1FWV A;  4J2S A;  1S0C A;  4P0L A;  1S0G A;  3KMV A;  4LO3 C;  3UD8 A;  1EPW A;  1Q04 A;  1R8O A;  1UPS A;  1RZO B;  4FVV A;  4J2Y A;  4LO8 B;  2MLL B;  3PHZ A;  3CRH A;  4KBB A;  1TP0 A;  1BFG A;  3N7M A;  5HPZ A;  1HWM B;  3R4U A;  1TIE A;  1AVW B;  5DSS B;  9ILB A;  1DQO A;  2QYI B;  3H6R A;  1IHK A;  4EFP A;  5BQU A;  4KEK A;  1NZK A;  1YTO A;  2BFH A;  3EF2 A;  1I1E A;  2J3P A;  3AZW A;  4I4O A;  3UD9 A;  2VUA A;  4I4V A;  3NBC A;  2WBC A;  1I1B A;  2FO1 A;  5BP5 A;  1IIL A;  1G9D A;  1FQ9 A;  5FZU A;  3FJB A;  4ZBV B;  4H04 A;  3OJ2 A;  4FGF A;  1BAS A;  4QO3 A;  1DFQ A;  3VSZ A;  3Q7X A;  2E4M C;  5DUY A;  1RML A;  1DJS B;  4G6M A;  4P6A A;  1IT0 A;  4QAL A;  1BFC A;  3UDA A;  1IJT A;  3AH1 A;  1DQG A;  3O4O A;  3N7L A;  3F62 B;  2AQZ A;  2NZ9 A;  3FJI A;  3HBW A;  1ISX A;  3OGF A;  3FUO A;  3BAH A;  1Z4S A;  4ZA3 B;  3WO4 A;  1A8D A;  1D0H A;  1HCD A;  4I96 A;  2UUS A;  3NBE A;  3O4D A;  1NUN A;  4LO2 C;  1SZ6 B;  3F1R A;  1RG8 A;  4AN6 A;  1HKN A;  1FMZ A;  5D61 A;  3HSM A;  5F8Y A;  3A07 A;  2DS0 A;  1PZZ A;  4USO A;  5JLV A;  3LLP A;  4QC4 A;  4IQP A;  4I6I A;  4QBV A;  4DCK C;  2KI6 B;  3PUB A;  5F90 A;  3V0A B;  1XG6 A;  3MPP G;  4QD2 B;  3FFZ A;  3T8S A;  5D63 A;  4JKX B;  4I2S A;  1AVX B;  3BA7 A;  1V6U A;  3D7W B;  1YYN A;  4Z8S B;  3V0B B;  1T4Q A;  2XOA A;  4ZLB B;  1BLD A;  3BB2 A;  3POK A;  1BFB A;  3W9T A;  4Q9G A;  2FGF A;  4A7Z A;  2E4M A;  4IY8 A;  3V0A A;  4I4Q A;  5DVH A;  2DRZ A;  3S8K A;  3FJC A;  5BXS A;  2F2F A;  2F8X C;  3CAH A;  4J2X A;  3C9Z A;  3VT0 A;  1ABR B;  4HA2 A;  2ZR1 B;  1HCE A;  3CA5 A;  3V0B A;  1P63 A;  3WO3 A;  2P39 A;  1CVS A;  1DZD A;  4II0 A;  4AN7 B;  2NYY A;  4EKX B;  4JQ0 A;  4XFS A;  4P0J A;  1ITB A;  1BFF A;  4XKI A;  3IIR A;  3ZC9 A;  4Q9P A;  3AKI A;  4CJM A;  3ZC8 A;  1EV2 A;  4MZF B;  1HWP B;  4PC4 A;  4LO7 C;  5BVP I;  2D43 A;  3BA4 A;  1V6X A;  3CA4 A;  1SR4 C;  3H6Q A;  1HWO B;  3S8J A;  2AFG A;  2RST A;  4ISQ A;  3OJV A;  4IHZ A;  1AVA C;  4I1E A;  4ZFW B;  1CE7 B;  4ZOT A;  3HMY A;  4EB2 B;  1PWA A;  1YF8 B;  3CA6 A;  3WO2 A;  3OBR A;  3FGM A;  8I1B A;  3AJ5 A;  1IRA X;  3UD7 A;  3QYD A;  3UJ4 A;  3CA3 A;  4IZE A;  4X39 A;  3HN1 A;  41BI A;  1TWE A;  1JT7 A;  3BAQ A;  3VSF A;  3AJ6 A;  4OWL A;  1JY0 A;  2IHO A;  1BAR A;  3E8L C;  3FJA A;  3P53 A;  4OWK A;  2AXM A;  7I1B A;  1FN0 A;  1JQZ A;  2LIE A;  3AKF A;  3BAG A;  1BA7 A;  1PUM B;  4GOV A;  2NS2 A;  3FJ9 A;  3O3Q A;  21BI A;  2WRY A;  2NTD A;  1G9A A;  4OEE A;  2LIQ A;  1E0O A;  2KI4 A;  3JUT A;  4LO7 B;  1PUU B;  2Y9G A;  1AFC A;  3BA5 A;  3VWC A;  4I4U A;  3LTQ A;  3WIN C;  1KNM A;  2VLC A; 
#chains in the Genus database with same CATH homology
 3I29 B;  1QQK A;  1XHB A;  4KEI A;  3O44 A;  2Y9X E;  4I8M A;  2I1B A;  3RTI B;  1W3G A;  2FFV A;  3RMX A;  1S0D A;  4LO3 A;  1ISW A;  4EFQ A;  3FJJ A;  1QXM A;  3AH2 A;  2ET2 A;  3SNV A;  4LO1 C;  2ERM A;  1G9B A;  3AZV A;  1HIB A;  3FJ8 A;  4XFT A;  3Q7W A;  3A23 A;  4OWJ A;  2Z49 A;  2HWA A;  2ESU A;  4X38 A;  1VCL A;  2Q9X A;  1JT3 A;  1MD6 A;  4OW4 A;  3FJE A;  2D7R A;  4GOY A;  4D0T A;  3I2A A;  5DZU A;  1ILR 1;  1G82 A;  1S0F A;  1WD3 A;  1FMM S;  2D44 A;  1ISZ A;  4H75 A;  3CRG A;  4R6U B;  1V6W A;  3RTJ B;  2FFU A;  5FZY A;  1AXM A;  4G1R A;  1L2H A;  3HOM A;  3BRD A;  1II4 A;  4I1B A;  1FV2 A;  2RQ9 A;  1ISV A;  6I1B A;  4JKQ A;  1M16 A;  3Q7Y A;  1HWN B;  4Z9W B;  4A7K A;  1FWU A;  1FGA A;  4QKR A;  4LO0 C;  3VUO A;  2Y9F A;  3WA1 A;  3A22 A;  3FUQ A;  4GAF A;  4I4S A;  1TFM B;  1R8N A;  4D0Z A;  3RSJ A;  4TLP A;  3WIN A;  2NM1 A;  4I7I A;  4YOL A;  1YBI A;  2KH2 A;  4X3A A;  1BLA A;  1ISY A;  4EFR A;  2ZQO A;  2HZ9 A;  2VSE A;  1WD4 A;  4P0K A;  1WBA A;  4IY9 A;  4END A;  3O5W B;  1JT5 A;  3ZXG A;  1EVT A;  3CA0 A;  4I4R A;  4I4P A;  4IYB A;  1PC8 B;  3UJ0 A;  3VT1 A;  1V6V A;  1JT4 A;  4LO2 A;  3BRF A;  3I2X A;  2Z48 A;  3FJK A;  2BEA A;  4ION A;  3IM6 A;  2D24 A;  2FDB M;  2R9K B;  3CU1 B;  4MZG B;  3MAL A;  1OQL B;  4OEF A;  2BEB A;  3H6R B;  5JMC A;  3H6S E;  5D62 A;  4I3N A;  5EG6 C;  3NBD A;  2YUG A;  4I0Y A;  4H9W A;  4QBC A;  2HW9 A;  3OJM A;  4GP3 A;  4DEP A;  2NP0 A;  5F8S A;  1Q1U A;  2GO2 A;  2VSA A;  1DIW A;  2RG9 B;  4ISR A;  5FZZ A;  3O4B A;  4G9M A;  1DLL A;  1DFC A;  5G00 A;  3OGG A;  1GGP B;  4F34 A;  2L5X A;  1Q03 A;  1Z0H A;  1M2T B;  3CRI A;  1J0S A;  3O4A A;  1F31 A;  1S0E A;  4OEG A;  1FV3 A;  3A21 A;  3IM7 A;  4JAW A;  4LO0 A;  3FJH A;  3N7J A;  3NJ5 A;  3O4C A;  5EHA A;  1K5V A;  4A7Y A;  1JLY A;  3BX1 C;  3V79 C;  4QKS A;  1AF9 A;  3PG0 A;  2VU9 A;  3ZX7 A;  4KC3 A;  1T9F A;  4XFU A;  3N7K A;  1AVU A;  3RMY A;  1JLX A;  3AKH A;  3BAU A;  3HAL A;  4MZH A;  4D8H A;  3ZXD A;  4QD2 C;  3FJD A;  3JRR A;  3N0K A;  2DRE A;  5F8W A;  2F2F C;  5B2H A;  1SR4 A;  2K43 A;  4JP0 A;  5E24 E;  2KLL A;  2VXR A;  1WBC A;  2X2S A;  4IZX A;  4WBC A;  3CQA A;  1S0L A;  1QQL A;  3K1X A;  4JPZ A;  3NBN A;  3BAD A;  2IWT B;  3FJF A;  2M49 A;  2Y9W C;  4KEJ A;  4DEN A;  4ZKT B;  1G9C A;  1JTC A;  3BAO A;  3BRG C;  1TTU A;  3CA1 A;  1YXW A;  1XYF A;  4F83 A;  3WMU A;  4OUJ A;  3P6J A;  3IAG C;  4I4X A;  1EYL A;  1S0B A;  4EEE B;  3QR5 A;  4I4Y A;  2D7I A;  1K5U A;  2DRY A;  5BXP A;  1Z2V A;  3O49 A;  2ZQN A;  5BXR A;  3R4S A;  1RY7 A;  2MC2 A;  2D20 A;  2VXT I;  2HWM A;  5BQU C;  5BXT A;  4HJJ A;  4ZGR B;  4JRA A;  2K4A B;  3IM5 A;  3AKG A;  5FNX A;  4HR6 C;  5FNW A;  3OBT A;  1W3F A;  3B9U A;  3BAV A;  2GZB A;  5BP5 C;  4I37 A;  4J23 B;  1XZZ A;  2X2T A;  4UY4 A;  3VEQ A;  1W3A A;  1IOB A;  4ZFU B;  2Q3N B;  4G9N A;  4G6J A;  3PME A;  2QN4 A;  4J2K A;  2D23 A;  4ZFY B;  4L4H A;  3ILA A;  5EC5 A;  2D1Z A;  5GAQ A;  2AAI B;  3TC2 A;  2MIB A;  4X37 A;  1TWM A;  1TOO A;  3VT2 A;  4LO1 A;  4USP A;  3BTA A;  1DZC A;  5BOW A;  4L4I A;  2P23 A;  4GAI A;  5I1B A;  3AH4 A;  31BI A;  1MC9 A;  2D22 A;  1N4K A;  1IRP A;  2K8R A;  3WMV A;  4Q91 A;  4GP0 A;  2KKI A;  3P6I A;  2NVH A;  1ONK B;  1FWV A;  4J2S A;  1S0C A;  4P0L A;  1S0G A;  3KMV A;  4LO3 C;  3UD8 A;  1EPW A;  1Q04 A;  1R8O A;  1UPS A;  1RZO B;  4FVV A;  4J2Y A;  4LO8 B;  2MLL B;  3PHZ A;  3CRH A;  4KBB A;  1TP0 A;  1BFG A;  3N7M A;  5HPZ A;  1HWM B;  3R4U A;  1TIE A;  1AVW B;  5DSS B;  9ILB A;  1DQO A;  2QYI B;  3H6R A;  1IHK A;  4EFP A;  5BQU A;  4KEK A;  1NZK A;  1YTO A;  2BFH A;  3EF2 A;  1I1E A;  2J3P A;  3AZW A;  4I4O A;  3UD9 A;  2VUA A;  4I4V A;  3NBC A;  2WBC A;  1I1B A;  2FO1 A;  5BP5 A;  1IIL A;  1G9D A;  1FQ9 A;  5FZU A;  3FJB A;  4ZBV B;  4H04 A;  3OJ2 A;  4FGF A;  1BAS A;  4QO3 A;  1DFQ A;  3VSZ A;  3Q7X A;  2E4M C;  5DUY A;  1RML A;  1DJS B;  4G6M A;  4P6A A;  1IT0 A;  4QAL A;  1BFC A;  3UDA A;  1IJT A;  3AH1 A;  1DQG A;  3O4O A;  3N7L A;  3F62 B;  2AQZ A;  2NZ9 A;  3FJI A;  3HBW A;  1ISX A;  3OGF A;  3FUO A;  3BAH A;  1Z4S A;  4ZA3 B;  3WO4 A;  1A8D A;  1D0H A;  1HCD A;  4I96 A;  2UUS A;  3NBE A;  3O4D A;  1NUN A;  4LO2 C;  1SZ6 B;  3F1R A;  1RG8 A;  4AN6 A;  1HKN A;  1FMZ A;  5D61 A;  3HSM A;  5F8Y A;  3A07 A;  2DS0 A;  1PZZ A;  4USO A;  5JLV A;  3LLP A;  4QC4 A;  4IQP A;  4I6I A;  4QBV A;  4DCK C;  2KI6 B;  3PUB A;  5F90 A;  3V0A B;  1XG6 A;  3MPP G;  4QD2 B;  3FFZ A;  3T8S A;  5D63 A;  4JKX B;  4I2S A;  1AVX B;  3BA7 A;  1V6U A;  3D7W B;  1YYN A;  4Z8S B;  3V0B B;  1T4Q A;  2XOA A;  4ZLB B;  1BLD A;  3BB2 A;  3POK A;  1BFB A;  3W9T A;  4Q9G A;  2FGF A;  4A7Z A;  2E4M A;  4IY8 A;  3V0A A;  4I4Q A;  5DVH A;  2DRZ A;  3S8K A;  3FJC A;  5BXS A;  2F2F A;  2F8X C;  3CAH A;  4J2X A;  3C9Z A;  3VT0 A;  1ABR B;  4HA2 A;  2ZR1 B;  1HCE A;  3CA5 A;  3V0B A;  1P63 A;  3WO3 A;  2P39 A;  1CVS A;  1DZD A;  4II0 A;  4AN7 B;  2NYY A;  4EKX B;  4JQ0 A;  4XFS A;  4P0J A;  1ITB A;  1BFF A;  4XKI A;  3IIR A;  3ZC9 A;  4Q9P A;  3AKI A;  4CJM A;  3ZC8 A;  1EV2 A;  4MZF B;  1HWP B;  4PC4 A;  4LO7 C;  5BVP I;  2D43 A;  3BA4 A;  1V6X A;  3CA4 A;  1SR4 C;  3H6Q A;  1HWO B;  3S8J A;  2AFG A;  2RST A;  4ISQ A;  3OJV A;  4IHZ A;  1AVA C;  4I1E A;  4ZFW B;  1CE7 B;  4ZOT A;  3HMY A;  4EB2 B;  1PWA A;  1YF8 B;  3CA6 A;  3WO2 A;  3OBR A;  3FGM A;  8I1B A;  3AJ5 A;  1IRA X;  3UD7 A;  3QYD A;  3UJ4 A;  3CA3 A;  4IZE A;  4X39 A;  3HN1 A;  41BI A;  1TWE A;  1JT7 A;  3BAQ A;  3VSF A;  3AJ6 A;  4OWL A;  1JY0 A;  2IHO A;  1BAR A;  3E8L C;  3FJA A;  3P53 A;  4OWK A;  2AXM A;  7I1B A;  1FN0 A;  1JQZ A;  2LIE A;  3AKF A;  3BAG A;  1BA7 A;  1PUM B;  4GOV A;  2NS2 A;  3FJ9 A;  3O3Q A;  21BI A;  2WRY A;  2NTD A;  1G9A A;  4OEE A;  2LIQ A;  1E0O A;  2KI4 A;  3JUT A;  4LO7 B;  1PUU B;  2Y9G A;  1AFC A;  3BA5 A;  3VWC A;  4I4U A;  3LTQ A;  3WIN C;  1KNM A;  2VLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...