2AQZA

Crystal structure of fgf-1, s17t/n18t/g19 deletion mutant
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
140
structure length
140
Chain Sequence
b'HHHHFNLPPGNYKKPKLLYCTTGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Conversion of type I 4:6 to 3:5 beta-turn types in human acidic fibroblast growth factor: Effects upon structure, stability, folding, and mitogenic function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2aqzA00
1NZKA 5BP5C 2VLCA 2FFUA 1JT7A 2RSTA 1TFMB 4I4VA 2ESUA 1NUNA 4DENA 3BAUA 2FDBM 2RG9B 3CAHA 2K43A 3WINA 3PUBA 2MC2A 2IHOA 4D0TA 3ILAA 3MPPG 4I2SA 1IT0A 3KMVA 1CVSA 1JT5A 4I6IA 1QQKA 4KBBA 2KI4A 1V6VA 3OGGA 1XYFA 2F8XC 4QKSA 3H6SE 2BFHA 2L5XA 1A8DA 1Q03A 5BP5A 4QALA 4G6MA 2E4MC 5FNWA 5F8WA 4ZLBB 3OJMA 3O4BA 4P6AA 2F2FC 3CA4A 3N7JA 3BRGC 4XFUA 3CRGA 4LO3C 4ZFYB 2YUGA 1TWEA 3WMUA 2BEAA 1JQZA 4QD2B 2VU9A 3BTAA 1II4A 3HN1A 3O4DA 2FO1A 2MLLB 4XKIA 3NBCA 3JUTA 5DVHA 1TWMA 3N7KA 5G00A 4GAFA 1DQOA 5DZUA 3O4CA 1ISYA 3UD7A 3BAVA 3F1RA 3IM7A 2P23A 4AN6A 1EPWA 3CQAA 4JP0A 3I2AA 1WBAA 1S0CA 5EHAA 4CJMA 1ISXA 3WA1A 3IAGC 2ERMA 3FGMA 3FJCA 3VSFA 3ZXDA 5FZYA 1IRAX 3FUQA 5BOWA 3V0BB 4EKXB 2X2TA 1CE7B 5EC5A 3S8JA 2DRZA 5F90A 4P0LA 3CA1A 3SNVA 3V0BA 2E4MA 1BARA 3HALA 2NTDA 3OBTA 5BXRA 4IZXA 4QO3A 3BAHA 1ILR1 4LO3A 3OJ2A 3QYDA 1PC8B 3K1XA 4R6UB 1G9BA 3AKGA 3UD8A 1XZZA 1IJTA 3FJBA 4HJJA 5BXSA 1M16A 2WRYA 1I1BA 1RY7A 5GAQA 4G6JA 4I4RA 4Z8SB 3HOMA 3NBNA 1K5VA 1MC9A 5BQUC 1Q1UA 5JLVA 4GP3A 1DFCA 4OEFA 1J0SA 2VSAA 1P63A 1BFCA 4ZGRB 1UPSA 4G9MA 1KNMA 4X3AA 5D62A 4II0A 4DCKC 4F34A 4Q91A 1FN0A 1YTOA 1FGAA 2DS0A 3VUOA 4KEKA 2ET2A 3S8KA 1EVTA 3Q7WA 3VT2A 1IRPA 1FMMS 4ISRA 3CRIA 4ZOTA 3H6RB 3VT1A 1V6XA 4X38A 2D20A 3H6RA 3FJEA 4Q9GA 3RTJB 4QKRA 1S0GA 1QXMA 3MALA 1EV2A 1TP0A 1W3FA 4H9WA 3O44A 3N0KA 4JKQA 5BQUA 3BB2A 4EFRA 3O3QA 3N7MA 1AVWB 4QC4A 4QD2C 2Z49A 4H04A 1M2TB 2VXTI 2KLLA 4J23B 4LO0A 4ZFWB 4J2YA 3F62B 3QR5A 3WO4A 4GOVA 1JT4A 1QQLA 3FJKA 3UD9A 1DIWA 1HKNA 3RMXA 3A23A 5JMCA 4D0ZA 1JLYA 1SR4C 2X2SA 2M49A 4IY8A 1DQGA 3C9ZA 1PZZA 1IHKA 3OGFA 2XOAA 2NM1A 5D61A 3BRDA 2NP0A 3IIRA 4DEPA 3P6IA 3EF2A 2QYIB 4LO1C 1N4KA 4JAWA 4I8MA 1R8NA 4I4UA 1JY0A 5DUYA 1FV3A 1HWOB 1FMZA 2BEBA 4USOA 1ITBA 1PUUB 4OWKA 2FGFA 2HW9A 1AF9A 2AAIB 2D7RA 4OWJA 5I1BA 4IY9A 5BVPI 4JKXB 1HIBA 3LTQA 3CU1B 3O4OA 3RMYA 2Y9FA 1S0FA 1VCLA 4HR6C 3BA7A 2HWMA 5E24E 4IQPA 4I4SA 2RQ9A 1SR4A 4YOLA 3NBEA 2R9KB 3BA5A 2KI6B 3P53A 2Z48A 4Q9PA 1WD4A 3CA5A 4A7YA 4I4OA 3CA0A 1BA7A 3PMEA 4JPZA 4L4IA 2Y9GA 1HCEA 4ISQA 1HWMB 1XHBA 4LO1A 3HMYA 3BX1C 1Z0HA 2WBCA 1TOOA 1ISZA 3BAGA 3A21A 3T8SA 1WD3A 4OW4A 2NZ9A 3BADA 3FJAA 4G9NA 4IONA 4KC3A 1IILA 41BIA 1WBCA 1RMLA 4ENDA 4TLPA 3I29B 2D44A 3FJDA 3TC2A 1JT3A 5B2HA 1D0HA 2D23A 3ZC9A 3UJ0A 2KKIA 3Q7XA 1BFBA 2D43A 3Q7YA 3AKHA 1RZOB 1TIEA 3BA4A 2GO2A 4I4YA 3W9TA 2ZQNA 2AQZA 1W3GA 4I1EA 4LO0C 3BAOA 4ZA3B 3WMVA 1G9CA 2Y9WC 4IZEA 2D22A 3AZWA 4QBCA 3UDAA 2FFVA 3B9UA 3AZVA 5HPZA 4Z9WB 1G82A 3HBWA 3PHZA 1S0EA 2K8RA 1V6UA 2MIBA 4OWLA 1F31A 3VSZA 3BAQA 1GGPB 4IYBA 4JRAA 1FWUA 2VXRA 1Z2VA 4HA2A 3BRFA 3AH2A 2AXMA 4WBCA 3V79C 4F83A 4EFPA 4L4HA 3R4SA 3I2XA 4AN7B 2QN4A 4QBVA 4KEJA 1L2HA 6I1BA 3E8LC 1G9AA 1PUMB 4OUJA 3FJHA 4G1RA 4JQ0A 4OEEA 2GZBA 3FJ8A 4I4QA 2Q3NB 4KEIA 1S0DA 1BASA 4USPA 3UJ4A 4I37A 9ILBA 1FV2A 3AJ5A 1EYLA 2KH2A 3WO2A 2ZR1B 2NYYA 5D63A 1K5UA 2HWAA 1S0LA 3AH1A 4FVVA 4X39A 5FZUA 2J3PA 3ZC8A 3OBRA 4I3NA 2AFGA 4LO8B 3FJFA 21BIA 2D7IA 1DZCA 1FWVA 3VEQA 4EFQA 4ZBVB 3ZX7A 4I96A 4EEEB 3D7WB 2K4AB 4XFSA 4LO2C 1DLLA 3AKFA 2D1ZA 4FGFA 1YYNA 3ZXGA 5F8SA 3IM6A 1BLDA 1JLXA 1Z4SA 1ISVA 3R4UA 3V0AB 3AH4A 2D24A 2I1BA 3CA3A 2VSEA 1DFQA 2Q9XA 3V0AA 2DRYA 4GP0A 3NJ5A 1AVXB 4PC4A 3AKIA 3P6JA 3FJIA 1SZ6B 31BIA 4I0YA 4OEGA 1Q04A 3FJ9A 1YBIA 4X37A 4GAIA 1BFGA 1YXWA 2Y9XE 4IHZA 1T4QA 1DJSB 3OJVA 2LIQA 4I4PA 1FQ9A 4LO2A 1DZDA 3H6QA 4LO7C 3JRRA 3N7LA 1HWPB 3WO3A 1HCDA 5EG6C 3CRHA 1BLAA 1I1EA 2P39A 3RSJA 3CA6A 1AXMA 3RTIB 5BXTA 1E0OA 1RG8A 3O4AA 1BFFA 1V6WA 3O5WB 1W3AA 2F2FA 3O49A 5FNXA 5BXPA 2NVHA 1TTUA 3A07A 1MD6A 4I7IA 1S0BA 4J2KA 4D8HA 3VWCA 2VUAA 3A22A 4J2SA 2IWTB 5F8YA 8I1BA 3HSMA 3LLPA 3WINC 3PG0A 1XG6A 1G9DA 1HWNB 3NBDA 4XFTA 4LO7B 4J2XA 1ISWA 4A7KA 4ZFUB 1YF8B 2UUSA 5FZZA 3POKA 2LIEA 5DSSB 4P0JA 3IM5A 1ONKB 3FJJA 7I1BA 1R8OA 4I4XA 4ZKTB 1ABRB 1IOBA 1AVAC 1PWAA 4P0KA 1AVUA 1AFCA 4I1BA 3FUOA 1T9FA 3VT0A 2HZ9A 2DREA 2ZQOA 3AJ6A 3FFZA 4GOYA 4A7ZA 1JTCA 4EB2B 1OQLB
chains in the Genus database with same CATH superfamily
1NZKA 5BP5C 2VLCA 2FFUA 1JT7A 2RSTA 1TFMB 4I4VA 2ESUA 1NUNA 4DENA 3BAUA 2FDBM 2RG9B 3CAHA 2K43A 3WINA 3PUBA 2MC2A 2IHOA 4D0TA 3ILAA 3MPPG 4I2SA 1IT0A 3KMVA 1CVSA 1JT5A 4I6IA 1QQKA 4KBBA 2KI4A 1V6VA 3OGGA 1XYFA 4MZGB 2F8XC 4QKSA 3H6SE 2BFHA 2L5XA 1A8DA 1Q03A 5BP5A 4QALA 4G6MA 2E4MC 5FNWA 5F8WA 4ZLBB 3OJMA 3O4BA 4P6AA 2F2FC 3CA4A 3N7JA 3BRGC 4XFUA 3CRGA 4LO3C 4ZFYB 2YUGA 1TWEA 3WMUA 2BEAA 1JQZA 4QD2B 2VU9A 3BTAA 1II4A 3HN1A 3O4DA 2FO1A 2MLLB 4XKIA 3NBCA 3JUTA 5DVHA 1TWMA 3N7KA 5G00A 4GAFA 1DQOA 5DZUA 3O4CA 1ISYA 3UD7A 3BAVA 3F1RA 3IM7A 2P23A 4AN6A 1EPWA 3CQAA 4JP0A 3I2AA 1WBAA 1S0CA 5EHAA 4CJMA 1ISXA 3WA1A 3IAGC 2ERMA 3FGMA 3FJCA 3VSFA 3ZXDA 5FZYA 1IRAX 3FUQA 5BOWA 3V0BB 4EKXB 2X2TA 1CE7B 5EC5A 3S8JA 2DRZA 5F90A 4P0LA 3CA1A 3SNVA 3V0BA 2E4MA 1BARA 3HALA 2NTDA 3OBTA 5BXRA 4IZXA 4QO3A 3BAHA 1ILR1 4LO3A 3OJ2A 3QYDA 1PC8B 3K1XA 4R6UB 1G9BA 3AKGA 3UD8A 1XZZA 1IJTA 3FJBA 4HJJA 5BXSA 1M16A 2WRYA 1I1BA 1RY7A 5GAQA 4G6JA 4I4RA 4Z8SB 3HOMA 3NBNA 1K5VA 1MC9A 5BQUC 1Q1UA 5JLVA 4GP3A 1DFCA 4OEFA 1J0SA 2VSAA 1P63A 1BFCA 4ZGRB 1UPSA 4G9MA 1KNMA 4X3AA 5D62A 4II0A 4DCKC 4F34A 4Q91A 1FN0A 1YTOA 1FGAA 2DS0A 3VUOA 4KEKA 2ET2A 3S8KA 1EVTA 3Q7WA 3VT2A 1IRPA 1FMMS 4ISRA 3CRIA 4ZOTA 3H6RB 3VT1A 1V6XA 4X38A 2D20A 3H6RA 3FJEA 4Q9GA 3RTJB 4QKRA 1S0GA 1QXMA 3MALA 1EV2A 1TP0A 1W3FA 4H9WA 3O44A 3N0KA 4JKQA 5BQUA 3BB2A 4EFRA 3O3QA 3N7MA 1AVWB 4QC4A 4QD2C 2Z49A 4H04A 1M2TB 2VXTI 2KLLA 4J23B 4LO0A 4ZFWB 4J2YA 3F62B 3QR5A 3WO4A 4GOVA 1JT4A 1QQLA 3FJKA 3UD9A 1DIWA 1HKNA 3RMXA 3A23A 5JMCA 4D0ZA 1JLYA 1SR4C 2X2SA 4H75A 2M49A 4IY8A 1DQGA 3C9ZA 1PZZA 1IHKA 3OGFA 2XOAA 2NM1A 5D61A 3BRDA 2NP0A 3IIRA 4DEPA 3P6IA 3EF2A 2QYIB 4LO1C 1N4KA 4JAWA 4I8MA 1R8NA 4I4UA 1JY0A 5DUYA 1FV3A 1HWOB 4MZHA 1FMZA 2NS2A 2BEBA 4USOA 1ITBA 1PUUB 4OWKA 2FGFA 2HW9A 1AF9A 2AAIB 2D7RA 4OWJA 5I1BA 4IY9A 5BVPI 4JKXB 1HIBA 3LTQA 3CU1B 3O4OA 3RMYA 2Y9FA 1S0FA 1VCLA 4HR6C 3BA7A 2HWMA 5E24E 4IQPA 4I4SA 2RQ9A 1SR4A 4YOLA 3NBEA 2R9KB 3BA5A 2KI6B 3P53A 2Z48A 4Q9PA 1WD4A 3CA5A 4A7YA 4I4OA 3CA0A 1BA7A 3PMEA 4JPZA 4L4IA 2Y9GA 1HCEA 4ISQA 1HWMB 1XHBA 4LO1A 3HMYA 3BX1C 1Z0HA 2WBCA 1TOOA 1ISZA 3BAGA 3A21A 3T8SA 1WD3A 4OW4A 2NZ9A 3BADA 3FJAA 4G9NA 4IONA 4KC3A 1IILA 41BIA 1WBCA 1RMLA 4ENDA 4TLPA 3I29B 2D44A 3FJDA 3TC2A 1JT3A 5B2HA 1D0HA 2D23A 3ZC9A 3UJ0A 2KKIA 3Q7XA 1BFBA 2D43A 3Q7YA 3AKHA 1RZOB 1TIEA 3BA4A 2GO2A 4I4YA 3W9TA 2ZQNA 2AQZA 1W3GA 4I1EA 4LO0C 3BAOA 4ZA3B 3WMVA 1G9CA 2Y9WC 4IZEA 2D22A 3AZWA 4QBCA 3UDAA 2FFVA 3B9UA 3AZVA 5HPZA 4Z9WB 1G82A 3HBWA 3PHZA 1S0EA 2K8RA 1V6UA 2MIBA 4OWLA 1F31A 3VSZA 3BAQA 1GGPB 4IYBA 4JRAA 1FWUA 2VXRA 1Z2VA 4HA2A 3BRFA 3AH2A 2AXMA 4WBCA 3V79C 4F83A 4EFPA 4L4HA 3R4SA 3I2XA 4AN7B 2QN4A 4QBVA 4KEJA 1L2HA 6I1BA 3E8LC 1G9AA 1PUMB 4OUJA 3FJHA 4G1RA 4MZFB 4JQ0A 4OEEA 2GZBA 3FJ8A 4UY4A 4I4QA 2Q3NB 4KEIA 1S0DA 1BASA 4USPA 3UJ4A 4I37A 9ILBA 1FV2A 3AJ5A 1EYLA 2KH2A 3WO2A 2ZR1B 2NYYA 5D63A 1K5UA 2HWAA 1S0LA 3AH1A 4FVVA 4X39A 5FZUA 2J3PA 3ZC8A 3OBRA 4I3NA 2AFGA 4LO8B 3FJFA 21BIA 2D7IA 1DZCA 1FWVA 3VEQA 4EFQA 4ZBVB 3ZX7A 4I96A 4EEEB 3D7WB 2K4AB 4XFSA 4LO2C 1DLLA 3AKFA 2D1ZA 4FGFA 1YYNA 3ZXGA 5F8SA 3IM6A 1BLDA 1JLXA 1Z4SA 1ISVA 3R4UA 3V0AB 3AH4A 2D24A 2I1BA 3CA3A 2VSEA 1DFQA 2Q9XA 3V0AA 2DRYA 4GP0A 3NJ5A 1AVXB 4PC4A 3AKIA 3P6JA 3FJIA 1SZ6B 31BIA 4I0YA 4OEGA 1Q04A 3FJ9A 1YBIA 4X37A 4GAIA 1BFGA 1YXWA 2Y9XE 4IHZA 1T4QA 1DJSB 3OJVA 2LIQA 4I4PA 1FQ9A 4LO2A 1DZDA 3H6QA 4LO7C 3JRRA 3N7LA 1HWPB 3WO3A 1HCDA 5EG6C 3CRHA 1BLAA 1I1EA 2P39A 3RSJA 3CA6A 1AXMA 3RTIB 5BXTA 1E0OA 1RG8A 3O4AA 1BFFA 1V6WA 3O5WB 1W3AA 2F2FA 3O49A 5FNXA 5BXPA 2NVHA 1TTUA 3A07A 1MD6A 4I7IA 1S0BA 4J2KA 4D8HA 3VWCA 2VUAA 3A22A 4J2SA 2IWTB 5F8YA 8I1BA 3HSMA 3LLPA 3WINC 3PG0A 1XG6A 1G9DA 1HWNB 3NBDA 4XFTA 4LO7B 4J2XA 1ISWA 4A7KA 4ZFUB 1YF8B 2UUSA 5FZZA 3POKA 2LIEA 5DSSB 4P0JA 3IM5A 1ONKB 3FJJA 7I1BA 1R8OA 4I4XA 4ZKTB 1ABRB 1IOBA 1AVAC 1PWAA 4P0KA 1AVUA 1AFCA 4I1BA 3FUOA 1T9FA 3VT0A 2HZ9A 2DREA 2ZQOA 3AJ6A 3FFZA 4GOYA 4A7ZA 1JTCA 4EB2B 1OQLB
chains in the Genus database with same CATH topology
1NZKA 5BP5C 2VLCA 2FFUA 1JT7A 2RSTA 1TFMB 4I4VA 2ESUA 1NUNA 4DENA 3BAUA 2FDBM 2RG9B 3CAHA 2K43A 3WINA 3PUBA 2MC2A 2IHOA 4D0TA 3ILAA 3MPPG 4I2SA 1IT0A 3KMVA 1CVSA 1JT5A 4I6IA 1QQKA 4KBBA 2KI4A 1V6VA 3OGGA 1XYFA 4MZGB 2F8XC 4QKSA 3H6SE 2BFHA 2L5XA 1A8DA 1Q03A 5BP5A 4QALA 4G6MA 2E4MC 5FNWA 5F8WA 4ZLBB 3OJMA 3O4BA 4P6AA 2F2FC 3CA4A 3N7JA 3BRGC 4XFUA 3CRGA 4LO3C 4ZFYB 2YUGA 1TWEA 3WMUA 2BEAA 1JQZA 4QD2B 2VU9A 3BTAA 1II4A 3HN1A 3O4DA 2FO1A 2MLLB 4XKIA 3NBCA 3JUTA 5DVHA 1TWMA 3N7KA 5G00A 4GAFA 1DQOA 5DZUA 3O4CA 1ISYA 3UD7A 3BAVA 3F1RA 3IM7A 2P23A 4AN6A 1EPWA 3CQAA 4JP0A 3I2AA 1WBAA 1S0CA 5EHAA 4CJMA 1ISXA 3WA1A 3IAGC 2ERMA 3FGMA 3FJCA 3VSFA 3ZXDA 5FZYA 1IRAX 3FUQA 5BOWA 3V0BB 4EKXB 2X2TA 1CE7B 5EC5A 3S8JA 2DRZA 5F90A 4P0LA 3CA1A 3SNVA 3V0BA 2E4MA 1BARA 3HALA 2NTDA 3OBTA 5BXRA 4IZXA 4QO3A 3BAHA 1ILR1 4LO3A 3OJ2A 3QYDA 1PC8B 3K1XA 4R6UB 1G9BA 3AKGA 3UD8A 1XZZA 1IJTA 3FJBA 4HJJA 5BXSA 1M16A 2WRYA 1I1BA 1RY7A 5GAQA 4G6JA 4I4RA 4Z8SB 3HOMA 3NBNA 1K5VA 1MC9A 5BQUC 1Q1UA 5JLVA 4GP3A 1DFCA 4OEFA 1J0SA 2VSAA 1P63A 1BFCA 4ZGRB 1UPSA 4G9MA 1KNMA 4X3AA 5D62A 4II0A 4DCKC 4F34A 4Q91A 1FN0A 1YTOA 1FGAA 2DS0A 3VUOA 4KEKA 2ET2A 3S8KA 1EVTA 3Q7WA 3VT2A 1IRPA 1FMMS 4ISRA 3CRIA 4ZOTA 3H6RB 3VT1A 1V6XA 4X38A 2D20A 3H6RA 3FJEA 4Q9GA 3RTJB 4QKRA 1S0GA 1QXMA 3MALA 1EV2A 1TP0A 1W3FA 4H9WA 3O44A 3N0KA 4JKQA 5BQUA 3BB2A 4EFRA 3O3QA 3N7MA 1AVWB 4QC4A 4QD2C 2Z49A 4H04A 1M2TB 2VXTI 2KLLA 4J23B 4LO0A 4ZFWB 4J2YA 3F62B 3QR5A 3WO4A 4GOVA 1JT4A 1QQLA 3FJKA 3UD9A 1DIWA 1HKNA 3RMXA 3A23A 5JMCA 4D0ZA 1JLYA 1SR4C 2X2SA 4H75A 2M49A 4IY8A 1DQGA 3C9ZA 1PZZA 1IHKA 3OGFA 2XOAA 2NM1A 5D61A 3BRDA 2NP0A 3IIRA 4DEPA 3P6IA 3EF2A 2QYIB 4LO1C 1N4KA 4JAWA 4I8MA 1R8NA 4I4UA 1JY0A 5DUYA 1FV3A 1HWOB 4MZHA 1FMZA 2NS2A 2BEBA 4USOA 1ITBA 1PUUB 4OWKA 2FGFA 2HW9A 1AF9A 2AAIB 2D7RA 4OWJA 5I1BA 4IY9A 5BVPI 4JKXB 1HIBA 3LTQA 3CU1B 3O4OA 3RMYA 2Y9FA 1S0FA 1VCLA 4HR6C 3BA7A 2HWMA 5E24E 4IQPA 4I4SA 2RQ9A 1SR4A 4YOLA 3NBEA 2R9KB 3BA5A 2KI6B 3P53A 2Z48A 4Q9PA 1WD4A 3CA5A 4A7YA 4I4OA 3CA0A 1BA7A 3PMEA 4JPZA 4L4IA 2Y9GA 1HCEA 4ISQA 1HWMB 1XHBA 4LO1A 3HMYA 3BX1C 1Z0HA 2WBCA 1TOOA 1ISZA 3BAGA 3A21A 3T8SA 1WD3A 4OW4A 2NZ9A 3BADA 3FJAA 4G9NA 4IONA 4KC3A 1IILA 41BIA 1WBCA 1RMLA 4ENDA 4TLPA 3I29B 2D44A 3FJDA 3TC2A 1JT3A 5B2HA 1D0HA 2D23A 3ZC9A 3UJ0A 2KKIA 3Q7XA 1BFBA 2D43A 3Q7YA 3AKHA 1RZOB 1TIEA 3BA4A 2GO2A 4I4YA 3W9TA 2ZQNA 2AQZA 1W3GA 4I1EA 4LO0C 3BAOA 4ZA3B 3WMVA 1G9CA 2Y9WC 4IZEA 2D22A 3AZWA 4QBCA 3UDAA 2FFVA 3B9UA 3AZVA 5HPZA 4Z9WB 1G82A 3HBWA 3PHZA 1S0EA 2K8RA 1V6UA 2MIBA 4OWLA 1F31A 3VSZA 3BAQA 1GGPB 4IYBA 4JRAA 1FWUA 2VXRA 1Z2VA 4HA2A 3BRFA 3AH2A 2AXMA 4WBCA 3V79C 4F83A 4EFPA 4L4HA 3R4SA 3I2XA 4AN7B 2QN4A 4QBVA 4KEJA 1L2HA 6I1BA 3E8LC 1G9AA 1PUMB 4OUJA 3FJHA 4G1RA 4MZFB 4JQ0A 4OEEA 2GZBA 3FJ8A 4UY4A 4I4QA 2Q3NB 4KEIA 1S0DA 1BASA 4USPA 3UJ4A 4I37A 9ILBA 1FV2A 3AJ5A 1EYLA 2KH2A 3WO2A 2ZR1B 2NYYA 5D63A 1K5UA 2HWAA 1S0LA 3AH1A 4FVVA 4X39A 5FZUA 2J3PA 3ZC8A 3OBRA 4I3NA 2AFGA 4LO8B 3FJFA 21BIA 2D7IA 1DZCA 1FWVA 3VEQA 4EFQA 4ZBVB 3ZX7A 4I96A 4EEEB 3D7WB 2K4AB 4XFSA 4LO2C 1DLLA 3AKFA 2D1ZA 4FGFA 1YYNA 3ZXGA 5F8SA 3IM6A 1BLDA 1JLXA 1Z4SA 1ISVA 3R4UA 3V0AB 3AH4A 2D24A 2I1BA 3CA3A 2VSEA 1DFQA 2Q9XA 3V0AA 2DRYA 4GP0A 3NJ5A 1AVXB 4PC4A 3AKIA 3P6JA 3FJIA 1SZ6B 31BIA 4I0YA 4OEGA 1Q04A 3FJ9A 1YBIA 4X37A 4GAIA 1BFGA 1YXWA 2Y9XE 4IHZA 1T4QA 1DJSB 3OJVA 2LIQA 4I4PA 1FQ9A 4LO2A 1DZDA 3H6QA 4LO7C 3JRRA 3N7LA 1HWPB 3WO3A 1HCDA 5EG6C 3CRHA 1BLAA 1I1EA 2P39A 3RSJA 3CA6A 1AXMA 3RTIB 5BXTA 1E0OA 1RG8A 3O4AA 1BFFA 1V6WA 3O5WB 1W3AA 2F2FA 3O49A 5FNXA 5BXPA 2NVHA 1TTUA 3A07A 1MD6A 4I7IA 1S0BA 4J2KA 4D8HA 3VWCA 2VUAA 3A22A 4J2SA 2IWTB 5F8YA 8I1BA 3HSMA 3LLPA 3WINC 3PG0A 1XG6A 1G9DA 1HWNB 3NBDA 4XFTA 4LO7B 4J2XA 1ISWA 4A7KA 4ZFUB 1YF8B 2UUSA 5FZZA 3POKA 2LIEA 5DSSB 4P0JA 3IM5A 1ONKB 3FJJA 7I1BA 1R8OA 4I4XA 4ZKTB 1ABRB 1IOBA 1AVAC 1PWAA 4P0KA 1AVUA 1AFCA 4I1BA 3FUOA 1T9FA 3VT0A 2HZ9A 2DREA 2ZQOA 3AJ6A 3FFZA 4GOYA 4A7ZA 1JTCA 4EB2B 1OQLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZK A;  5BP5 C;  2VLC A;  2FFU A;  1JT7 A;  2RST A;  1TFM B;  4I4V A;  2ESU A;  1NUN A;  4DEN A;  3BAU A;  2FDB M;  2RG9 B;  3CAH A;  2K43 A;  3WIN A;  3PUB A;  2MC2 A;  2IHO A;  4D0T A;  3ILA A;  3MPP G;  4I2S A;  1IT0 A;  3KMV A;  1CVS A;  1JT5 A;  4I6I A;  1QQK A;  4KBB A;  2KI4 A;  1V6V A;  3OGG A;  1XYF A;  2F8X C;  4QKS A;  3H6S E;  2BFH A;  2L5X A;  1A8D A;  1Q03 A;  5BP5 A;  4QAL A;  4G6M A;  2E4M C;  5FNW A;  5F8W A;  4ZLB B;  3OJM A;  3O4B A;  4P6A A;  2F2F C;  3CA4 A;  3N7J A;  3BRG C;  4XFU A;  3CRG A;  4LO3 C;  4ZFY B;  2YUG A;  1TWE A;  3WMU A;  2BEA A;  1JQZ A;  4QD2 B;  2VU9 A;  3BTA A;  1II4 A;  3HN1 A;  3O4D A;  2FO1 A;  2MLL B;  4XKI A;  3NBC A;  3JUT A;  5DVH A;  1TWM A;  3N7K A;  5G00 A;  4GAF A;  1DQO A;  5DZU A;  3O4C A;  1ISY A;  3UD7 A;  3BAV A;  3F1R A;  3IM7 A;  2P23 A;  4AN6 A;  1EPW A;  3CQA A;  4JP0 A;  3I2A A;  1WBA A;  1S0C A;  5EHA A;  4CJM A;  1ISX A;  3WA1 A;  3IAG C;  2ERM A;  3FGM A;  3FJC A;  3VSF A;  3ZXD A;  5FZY A;  1IRA X;  3FUQ A;  5BOW A;  3V0B B;  4EKX B;  2X2T A;  1CE7 B;  5EC5 A;  3S8J A;  2DRZ A;  5F90 A;  4P0L A;  3CA1 A;  3SNV A;  3V0B A;  2E4M A;  1BAR A;  3HAL A;  2NTD A;  3OBT A;  5BXR A;  4IZX A;  4QO3 A;  3BAH A;  1ILR 1;  4LO3 A;  3OJ2 A;  3QYD A;  1PC8 B;  3K1X A;  4R6U B;  1G9B A;  3AKG A;  3UD8 A;  1XZZ A;  1IJT A;  3FJB A;  4HJJ A;  5BXS A;  1M16 A;  2WRY A;  1I1B A;  1RY7 A;  5GAQ A;  4G6J A;  4I4R A;  4Z8S B;  3HOM A;  3NBN A;  1K5V A;  1MC9 A;  5BQU C;  1Q1U A;  5JLV A;  4GP3 A;  1DFC A;  4OEF A;  1J0S A;  2VSA A;  1P63 A;  1BFC A;  4ZGR B;  1UPS A;  4G9M A;  1KNM A;  4X3A A;  5D62 A;  4II0 A;  4DCK C;  4F34 A;  4Q91 A;  1FN0 A;  1YTO A;  1FGA A;  2DS0 A;  3VUO A;  4KEK A;  2ET2 A;  3S8K A;  1EVT A;  3Q7W A;  3VT2 A;  1IRP A;  1FMM S;  4ISR A;  3CRI A;  4ZOT A;  3H6R B;  3VT1 A;  1V6X A;  4X38 A;  2D20 A;  3H6R A;  3FJE A;  4Q9G A;  3RTJ B;  4QKR A;  1S0G A;  1QXM A;  3MAL A;  1EV2 A;  1TP0 A;  1W3F A;  4H9W A;  3O44 A;  3N0K A;  4JKQ A;  5BQU A;  3BB2 A;  4EFR A;  3O3Q A;  3N7M A;  1AVW B;  4QC4 A;  4QD2 C;  2Z49 A;  4H04 A;  1M2T B;  2VXT I;  2KLL A;  4J23 B;  4LO0 A;  4ZFW B;  4J2Y A;  3F62 B;  3QR5 A;  3WO4 A;  4GOV A;  1JT4 A;  1QQL A;  3FJK A;  3UD9 A;  1DIW A;  1HKN A;  3RMX A;  3A23 A;  5JMC A;  4D0Z A;  1JLY A;  1SR4 C;  2X2S A;  2M49 A;  4IY8 A;  1DQG A;  3C9Z A;  1PZZ A;  1IHK A;  3OGF A;  2XOA A;  2NM1 A;  5D61 A;  3BRD A;  2NP0 A;  3IIR A;  4DEP A;  3P6I A;  3EF2 A;  2QYI B;  4LO1 C;  1N4K A;  4JAW A;  4I8M A;  1R8N A;  4I4U A;  1JY0 A;  5DUY A;  1FV3 A;  1HWO B;  1FMZ A;  2BEB A;  4USO A;  1ITB A;  1PUU B;  4OWK A;  2FGF A;  2HW9 A;  1AF9 A;  2AAI B;  2D7R A;  4OWJ A;  5I1B A;  4IY9 A;  5BVP I;  4JKX B;  1HIB A;  3LTQ A;  3CU1 B;  3O4O A;  3RMY A;  2Y9F A;  1S0F A;  1VCL A;  4HR6 C;  3BA7 A;  2HWM A;  5E24 E;  4IQP A;  4I4S A;  2RQ9 A;  1SR4 A;  4YOL A;  3NBE A;  2R9K B;  3BA5 A;  2KI6 B;  3P53 A;  2Z48 A;  4Q9P A;  1WD4 A;  3CA5 A;  4A7Y A;  4I4O A;  3CA0 A;  1BA7 A;  3PME A;  4JPZ A;  4L4I A;  2Y9G A;  1HCE A;  4ISQ A;  1HWM B;  1XHB A;  4LO1 A;  3HMY A;  3BX1 C;  1Z0H A;  2WBC A;  1TOO A;  1ISZ A;  3BAG A;  3A21 A;  3T8S A;  1WD3 A;  4OW4 A;  2NZ9 A;  3BAD A;  3FJA A;  4G9N A;  4ION A;  4KC3 A;  1IIL A;  41BI A;  1WBC A;  1RML A;  4END A;  4TLP A;  3I29 B;  2D44 A;  3FJD A;  3TC2 A;  1JT3 A;  5B2H A;  1D0H A;  2D23 A;  3ZC9 A;  3UJ0 A;  2KKI A;  3Q7X A;  1BFB A;  2D43 A;  3Q7Y A;  3AKH A;  1RZO B;  1TIE A;  3BA4 A;  2GO2 A;  4I4Y A;  3W9T A;  2ZQN A;  2AQZ A;  1W3G A;  4I1E A;  4LO0 C;  3BAO A;  4ZA3 B;  3WMV A;  1G9C A;  2Y9W C;  4IZE A;  2D22 A;  3AZW A;  4QBC A;  3UDA A;  2FFV A;  3B9U A;  3AZV A;  5HPZ A;  4Z9W B;  1G82 A;  3HBW A;  3PHZ A;  1S0E A;  2K8R A;  1V6U A;  2MIB A;  4OWL A;  1F31 A;  3VSZ A;  3BAQ A;  1GGP B;  4IYB A;  4JRA A;  1FWU A;  2VXR A;  1Z2V A;  4HA2 A;  3BRF A;  3AH2 A;  2AXM A;  4WBC A;  3V79 C;  4F83 A;  4EFP A;  4L4H A;  3R4S A;  3I2X A;  4AN7 B;  2QN4 A;  4QBV A;  4KEJ A;  1L2H A;  6I1B A;  3E8L C;  1G9A A;  1PUM B;  4OUJ A;  3FJH A;  4G1R A;  4JQ0 A;  4OEE A;  2GZB A;  3FJ8 A;  4I4Q A;  2Q3N B;  4KEI A;  1S0D A;  1BAS A;  4USP A;  3UJ4 A;  4I37 A;  9ILB A;  1FV2 A;  3AJ5 A;  1EYL A;  2KH2 A;  3WO2 A;  2ZR1 B;  2NYY A;  5D63 A;  1K5U A;  2HWA A;  1S0L A;  3AH1 A;  4FVV A;  4X39 A;  5FZU A;  2J3P A;  3ZC8 A;  3OBR A;  4I3N A;  2AFG A;  4LO8 B;  3FJF A;  21BI A;  2D7I A;  1DZC A;  1FWV A;  3VEQ A;  4EFQ A;  4ZBV B;  3ZX7 A;  4I96 A;  4EEE B;  3D7W B;  2K4A B;  4XFS A;  4LO2 C;  1DLL A;  3AKF A;  2D1Z A;  4FGF A;  1YYN A;  3ZXG A;  5F8S A;  3IM6 A;  1BLD A;  1JLX A;  1Z4S A;  1ISV A;  3R4U A;  3V0A B;  3AH4 A;  2D24 A;  2I1B A;  3CA3 A;  2VSE A;  1DFQ A;  2Q9X A;  3V0A A;  2DRY A;  4GP0 A;  3NJ5 A;  1AVX B;  4PC4 A;  3AKI A;  3P6J A;  3FJI A;  1SZ6 B;  31BI A;  4I0Y A;  4OEG A;  1Q04 A;  3FJ9 A;  1YBI A;  4X37 A;  4GAI A;  1BFG A;  1YXW A;  2Y9X E;  4IHZ A;  1T4Q A;  1DJS B;  3OJV A;  2LIQ A;  4I4P A;  1FQ9 A;  4LO2 A;  1DZD A;  3H6Q A;  4LO7 C;  3JRR A;  3N7L A;  1HWP B;  3WO3 A;  1HCD A;  5EG6 C;  3CRH A;  1BLA A;  1I1E A;  2P39 A;  3RSJ A;  3CA6 A;  1AXM A;  3RTI B;  5BXT A;  1E0O A;  1RG8 A;  3O4A A;  1BFF A;  1V6W A;  3O5W B;  1W3A A;  2F2F A;  3O49 A;  5FNX A;  5BXP A;  2NVH A;  1TTU A;  3A07 A;  1MD6 A;  4I7I A;  1S0B A;  4J2K A;  4D8H A;  3VWC A;  2VUA A;  3A22 A;  4J2S A;  2IWT B;  5F8Y A;  8I1B A;  3HSM A;  3LLP A;  3WIN C;  3PG0 A;  1XG6 A;  1G9D A;  1HWN B;  3NBD A;  4XFT A;  4LO7 B;  4J2X A;  1ISW A;  4A7K A;  4ZFU B;  1YF8 B;  2UUS A;  5FZZ A;  3POK A;  2LIE A;  5DSS B;  4P0J A;  3IM5 A;  1ONK B;  3FJJ A;  7I1B A;  1R8O A;  4I4X A;  4ZKT B;  1ABR B;  1IOB A;  1AVA C;  1PWA A;  4P0K A;  1AVU A;  1AFC A;  4I1B A;  3FUO A;  1T9F A;  3VT0 A;  2HZ9 A;  2DRE A;  2ZQO A;  3AJ6 A;  3FFZ A;  4GOY A;  4A7Z A;  1JTC A;  4EB2 B;  1OQL B; 
#chains in the Genus database with same CATH topology
 1NZK A;  5BP5 C;  2VLC A;  2FFU A;  1JT7 A;  2RST A;  1TFM B;  4I4V A;  2ESU A;  1NUN A;  4DEN A;  3BAU A;  2FDB M;  2RG9 B;  3CAH A;  2K43 A;  3WIN A;  3PUB A;  2MC2 A;  2IHO A;  4D0T A;  3ILA A;  3MPP G;  4I2S A;  1IT0 A;  3KMV A;  1CVS A;  1JT5 A;  4I6I A;  1QQK A;  4KBB A;  2KI4 A;  1V6V A;  3OGG A;  1XYF A;  4MZG B;  2F8X C;  4QKS A;  3H6S E;  2BFH A;  2L5X A;  1A8D A;  1Q03 A;  5BP5 A;  4QAL A;  4G6M A;  2E4M C;  5FNW A;  5F8W A;  4ZLB B;  3OJM A;  3O4B A;  4P6A A;  2F2F C;  3CA4 A;  3N7J A;  3BRG C;  4XFU A;  3CRG A;  4LO3 C;  4ZFY B;  2YUG A;  1TWE A;  3WMU A;  2BEA A;  1JQZ A;  4QD2 B;  2VU9 A;  3BTA A;  1II4 A;  3HN1 A;  3O4D A;  2FO1 A;  2MLL B;  4XKI A;  3NBC A;  3JUT A;  5DVH A;  1TWM A;  3N7K A;  5G00 A;  4GAF A;  1DQO A;  5DZU A;  3O4C A;  1ISY A;  3UD7 A;  3BAV A;  3F1R A;  3IM7 A;  2P23 A;  4AN6 A;  1EPW A;  3CQA A;  4JP0 A;  3I2A A;  1WBA A;  1S0C A;  5EHA A;  4CJM A;  1ISX A;  3WA1 A;  3IAG C;  2ERM A;  3FGM A;  3FJC A;  3VSF A;  3ZXD A;  5FZY A;  1IRA X;  3FUQ A;  5BOW A;  3V0B B;  4EKX B;  2X2T A;  1CE7 B;  5EC5 A;  3S8J A;  2DRZ A;  5F90 A;  4P0L A;  3CA1 A;  3SNV A;  3V0B A;  2E4M A;  1BAR A;  3HAL A;  2NTD A;  3OBT A;  5BXR A;  4IZX A;  4QO3 A;  3BAH A;  1ILR 1;  4LO3 A;  3OJ2 A;  3QYD A;  1PC8 B;  3K1X A;  4R6U B;  1G9B A;  3AKG A;  3UD8 A;  1XZZ A;  1IJT A;  3FJB A;  4HJJ A;  5BXS A;  1M16 A;  2WRY A;  1I1B A;  1RY7 A;  5GAQ A;  4G6J A;  4I4R A;  4Z8S B;  3HOM A;  3NBN A;  1K5V A;  1MC9 A;  5BQU C;  1Q1U A;  5JLV A;  4GP3 A;  1DFC A;  4OEF A;  1J0S A;  2VSA A;  1P63 A;  1BFC A;  4ZGR B;  1UPS A;  4G9M A;  1KNM A;  4X3A A;  5D62 A;  4II0 A;  4DCK C;  4F34 A;  4Q91 A;  1FN0 A;  1YTO A;  1FGA A;  2DS0 A;  3VUO A;  4KEK A;  2ET2 A;  3S8K A;  1EVT A;  3Q7W A;  3VT2 A;  1IRP A;  1FMM S;  4ISR A;  3CRI A;  4ZOT A;  3H6R B;  3VT1 A;  1V6X A;  4X38 A;  2D20 A;  3H6R A;  3FJE A;  4Q9G A;  3RTJ B;  4QKR A;  1S0G A;  1QXM A;  3MAL A;  1EV2 A;  1TP0 A;  1W3F A;  4H9W A;  3O44 A;  3N0K A;  4JKQ A;  5BQU A;  3BB2 A;  4EFR A;  3O3Q A;  3N7M A;  1AVW B;  4QC4 A;  4QD2 C;  2Z49 A;  4H04 A;  1M2T B;  2VXT I;  2KLL A;  4J23 B;  4LO0 A;  4ZFW B;  4J2Y A;  3F62 B;  3QR5 A;  3WO4 A;  4GOV A;  1JT4 A;  1QQL A;  3FJK A;  3UD9 A;  1DIW A;  1HKN A;  3RMX A;  3A23 A;  5JMC A;  4D0Z A;  1JLY A;  1SR4 C;  2X2S A;  4H75 A;  2M49 A;  4IY8 A;  1DQG A;  3C9Z A;  1PZZ A;  1IHK A;  3OGF A;  2XOA A;  2NM1 A;  5D61 A;  3BRD A;  2NP0 A;  3IIR A;  4DEP A;  3P6I A;  3EF2 A;  2QYI B;  4LO1 C;  1N4K A;  4JAW A;  4I8M A;  1R8N A;  4I4U A;  1JY0 A;  5DUY A;  1FV3 A;  1HWO B;  4MZH A;  1FMZ A;  2NS2 A;  2BEB A;  4USO A;  1ITB A;  1PUU B;  4OWK A;  2FGF A;  2HW9 A;  1AF9 A;  2AAI B;  2D7R A;  4OWJ A;  5I1B A;  4IY9 A;  5BVP I;  4JKX B;  1HIB A;  3LTQ A;  3CU1 B;  3O4O A;  3RMY A;  2Y9F A;  1S0F A;  1VCL A;  4HR6 C;  3BA7 A;  2HWM A;  5E24 E;  4IQP A;  4I4S A;  2RQ9 A;  1SR4 A;  4YOL A;  3NBE A;  2R9K B;  3BA5 A;  2KI6 B;  3P53 A;  2Z48 A;  4Q9P A;  1WD4 A;  3CA5 A;  4A7Y A;  4I4O A;  3CA0 A;  1BA7 A;  3PME A;  4JPZ A;  4L4I A;  2Y9G A;  1HCE A;  4ISQ A;  1HWM B;  1XHB A;  4LO1 A;  3HMY A;  3BX1 C;  1Z0H A;  2WBC A;  1TOO A;  1ISZ A;  3BAG A;  3A21 A;  3T8S A;  1WD3 A;  4OW4 A;  2NZ9 A;  3BAD A;  3FJA A;  4G9N A;  4ION A;  4KC3 A;  1IIL A;  41BI A;  1WBC A;  1RML A;  4END A;  4TLP A;  3I29 B;  2D44 A;  3FJD A;  3TC2 A;  1JT3 A;  5B2H A;  1D0H A;  2D23 A;  3ZC9 A;  3UJ0 A;  2KKI A;  3Q7X A;  1BFB A;  2D43 A;  3Q7Y A;  3AKH A;  1RZO B;  1TIE A;  3BA4 A;  2GO2 A;  4I4Y A;  3W9T A;  2ZQN A;  2AQZ A;  1W3G A;  4I1E A;  4LO0 C;  3BAO A;  4ZA3 B;  3WMV A;  1G9C A;  2Y9W C;  4IZE A;  2D22 A;  3AZW A;  4QBC A;  3UDA A;  2FFV A;  3B9U A;  3AZV A;  5HPZ A;  4Z9W B;  1G82 A;  3HBW A;  3PHZ A;  1S0E A;  2K8R A;  1V6U A;  2MIB A;  4OWL A;  1F31 A;  3VSZ A;  3BAQ A;  1GGP B;  4IYB A;  4JRA A;  1FWU A;  2VXR A;  1Z2V A;  4HA2 A;  3BRF A;  3AH2 A;  2AXM A;  4WBC A;  3V79 C;  4F83 A;  4EFP A;  4L4H A;  3R4S A;  3I2X A;  4AN7 B;  2QN4 A;  4QBV A;  4KEJ A;  1L2H A;  6I1B A;  3E8L C;  1G9A A;  1PUM B;  4OUJ A;  3FJH A;  4G1R A;  4MZF B;  4JQ0 A;  4OEE A;  2GZB A;  3FJ8 A;  4UY4 A;  4I4Q A;  2Q3N B;  4KEI A;  1S0D A;  1BAS A;  4USP A;  3UJ4 A;  4I37 A;  9ILB A;  1FV2 A;  3AJ5 A;  1EYL A;  2KH2 A;  3WO2 A;  2ZR1 B;  2NYY A;  5D63 A;  1K5U A;  2HWA A;  1S0L A;  3AH1 A;  4FVV A;  4X39 A;  5FZU A;  2J3P A;  3ZC8 A;  3OBR A;  4I3N A;  2AFG A;  4LO8 B;  3FJF A;  21BI A;  2D7I A;  1DZC A;  1FWV A;  3VEQ A;  4EFQ A;  4ZBV B;  3ZX7 A;  4I96 A;  4EEE B;  3D7W B;  2K4A B;  4XFS A;  4LO2 C;  1DLL A;  3AKF A;  2D1Z A;  4FGF A;  1YYN A;  3ZXG A;  5F8S A;  3IM6 A;  1BLD A;  1JLX A;  1Z4S A;  1ISV A;  3R4U A;  3V0A B;  3AH4 A;  2D24 A;  2I1B A;  3CA3 A;  2VSE A;  1DFQ A;  2Q9X A;  3V0A A;  2DRY A;  4GP0 A;  3NJ5 A;  1AVX B;  4PC4 A;  3AKI A;  3P6J A;  3FJI A;  1SZ6 B;  31BI A;  4I0Y A;  4OEG A;  1Q04 A;  3FJ9 A;  1YBI A;  4X37 A;  4GAI A;  1BFG A;  1YXW A;  2Y9X E;  4IHZ A;  1T4Q A;  1DJS B;  3OJV A;  2LIQ A;  4I4P A;  1FQ9 A;  4LO2 A;  1DZD A;  3H6Q A;  4LO7 C;  3JRR A;  3N7L A;  1HWP B;  3WO3 A;  1HCD A;  5EG6 C;  3CRH A;  1BLA A;  1I1E A;  2P39 A;  3RSJ A;  3CA6 A;  1AXM A;  3RTI B;  5BXT A;  1E0O A;  1RG8 A;  3O4A A;  1BFF A;  1V6W A;  3O5W B;  1W3A A;  2F2F A;  3O49 A;  5FNX A;  5BXP A;  2NVH A;  1TTU A;  3A07 A;  1MD6 A;  4I7I A;  1S0B A;  4J2K A;  4D8H A;  3VWC A;  2VUA A;  3A22 A;  4J2S A;  2IWT B;  5F8Y A;  8I1B A;  3HSM A;  3LLP A;  3WIN C;  3PG0 A;  1XG6 A;  1G9D A;  1HWN B;  3NBD A;  4XFT A;  4LO7 B;  4J2X A;  1ISW A;  4A7K A;  4ZFU B;  1YF8 B;  2UUS A;  5FZZ A;  3POK A;  2LIE A;  5DSS B;  4P0J A;  3IM5 A;  1ONK B;  3FJJ A;  7I1B A;  1R8O A;  4I4X A;  4ZKT B;  1ABR B;  1IOB A;  1AVA C;  1PWA A;  4P0K A;  1AVU A;  1AFC A;  4I1B A;  3FUO A;  1T9F A;  3VT0 A;  2HZ9 A;  2DRE A;  2ZQO A;  3AJ6 A;  3FFZ A;  4GOY A;  4A7Z A;  1JTC A;  4EB2 B;  1OQL B; 
#chains in the Genus database with same CATH homology
 1NZK A;  5BP5 C;  2VLC A;  2FFU A;  1JT7 A;  2RST A;  1TFM B;  4I4V A;  2ESU A;  1NUN A;  4DEN A;  3BAU A;  2FDB M;  2RG9 B;  3CAH A;  2K43 A;  3WIN A;  3PUB A;  2MC2 A;  2IHO A;  4D0T A;  3ILA A;  3MPP G;  4I2S A;  1IT0 A;  3KMV A;  1CVS A;  1JT5 A;  4I6I A;  1QQK A;  4KBB A;  2KI4 A;  1V6V A;  3OGG A;  1XYF A;  4MZG B;  2F8X C;  4QKS A;  3H6S E;  2BFH A;  2L5X A;  1A8D A;  1Q03 A;  5BP5 A;  4QAL A;  4G6M A;  2E4M C;  5FNW A;  5F8W A;  4ZLB B;  3OJM A;  3O4B A;  4P6A A;  2F2F C;  3CA4 A;  3N7J A;  3BRG C;  4XFU A;  3CRG A;  4LO3 C;  4ZFY B;  2YUG A;  1TWE A;  3WMU A;  2BEA A;  1JQZ A;  4QD2 B;  2VU9 A;  3BTA A;  1II4 A;  3HN1 A;  3O4D A;  2FO1 A;  2MLL B;  4XKI A;  3NBC A;  3JUT A;  5DVH A;  1TWM A;  3N7K A;  5G00 A;  4GAF A;  1DQO A;  5DZU A;  3O4C A;  1ISY A;  3UD7 A;  3BAV A;  3F1R A;  3IM7 A;  2P23 A;  4AN6 A;  1EPW A;  3CQA A;  4JP0 A;  3I2A A;  1WBA A;  1S0C A;  5EHA A;  4CJM A;  1ISX A;  3WA1 A;  3IAG C;  2ERM A;  3FGM A;  3FJC A;  3VSF A;  3ZXD A;  5FZY A;  1IRA X;  3FUQ A;  5BOW A;  3V0B B;  4EKX B;  2X2T A;  1CE7 B;  5EC5 A;  3S8J A;  2DRZ A;  5F90 A;  4P0L A;  3CA1 A;  3SNV A;  3V0B A;  2E4M A;  1BAR A;  3HAL A;  2NTD A;  3OBT A;  5BXR A;  4IZX A;  4QO3 A;  3BAH A;  1ILR 1;  4LO3 A;  3OJ2 A;  3QYD A;  1PC8 B;  3K1X A;  4R6U B;  1G9B A;  3AKG A;  3UD8 A;  1XZZ A;  1IJT A;  3FJB A;  4HJJ A;  5BXS A;  1M16 A;  2WRY A;  1I1B A;  1RY7 A;  5GAQ A;  4G6J A;  4I4R A;  4Z8S B;  3HOM A;  3NBN A;  1K5V A;  1MC9 A;  5BQU C;  1Q1U A;  5JLV A;  4GP3 A;  1DFC A;  4OEF A;  1J0S A;  2VSA A;  1P63 A;  1BFC A;  4ZGR B;  1UPS A;  4G9M A;  1KNM A;  4X3A A;  5D62 A;  4II0 A;  4DCK C;  4F34 A;  4Q91 A;  1FN0 A;  1YTO A;  1FGA A;  2DS0 A;  3VUO A;  4KEK A;  2ET2 A;  3S8K A;  1EVT A;  3Q7W A;  3VT2 A;  1IRP A;  1FMM S;  4ISR A;  3CRI A;  4ZOT A;  3H6R B;  3VT1 A;  1V6X A;  4X38 A;  2D20 A;  3H6R A;  3FJE A;  4Q9G A;  3RTJ B;  4QKR A;  1S0G A;  1QXM A;  3MAL A;  1EV2 A;  1TP0 A;  1W3F A;  4H9W A;  3O44 A;  3N0K A;  4JKQ A;  5BQU A;  3BB2 A;  4EFR A;  3O3Q A;  3N7M A;  1AVW B;  4QC4 A;  4QD2 C;  2Z49 A;  4H04 A;  1M2T B;  2VXT I;  2KLL A;  4J23 B;  4LO0 A;  4ZFW B;  4J2Y A;  3F62 B;  3QR5 A;  3WO4 A;  4GOV A;  1JT4 A;  1QQL A;  3FJK A;  3UD9 A;  1DIW A;  1HKN A;  3RMX A;  3A23 A;  5JMC A;  4D0Z A;  1JLY A;  1SR4 C;  2X2S A;  4H75 A;  2M49 A;  4IY8 A;  1DQG A;  3C9Z A;  1PZZ A;  1IHK A;  3OGF A;  2XOA A;  2NM1 A;  5D61 A;  3BRD A;  2NP0 A;  3IIR A;  4DEP A;  3P6I A;  3EF2 A;  2QYI B;  4LO1 C;  1N4K A;  4JAW A;  4I8M A;  1R8N A;  4I4U A;  1JY0 A;  5DUY A;  1FV3 A;  1HWO B;  4MZH A;  1FMZ A;  2NS2 A;  2BEB A;  4USO A;  1ITB A;  1PUU B;  4OWK A;  2FGF A;  2HW9 A;  1AF9 A;  2AAI B;  2D7R A;  4OWJ A;  5I1B A;  4IY9 A;  5BVP I;  4JKX B;  1HIB A;  3LTQ A;  3CU1 B;  3O4O A;  3RMY A;  2Y9F A;  1S0F A;  1VCL A;  4HR6 C;  3BA7 A;  2HWM A;  5E24 E;  4IQP A;  4I4S A;  2RQ9 A;  1SR4 A;  4YOL A;  3NBE A;  2R9K B;  3BA5 A;  2KI6 B;  3P53 A;  2Z48 A;  4Q9P A;  1WD4 A;  3CA5 A;  4A7Y A;  4I4O A;  3CA0 A;  1BA7 A;  3PME A;  4JPZ A;  4L4I A;  2Y9G A;  1HCE A;  4ISQ A;  1HWM B;  1XHB A;  4LO1 A;  3HMY A;  3BX1 C;  1Z0H A;  2WBC A;  1TOO A;  1ISZ A;  3BAG A;  3A21 A;  3T8S A;  1WD3 A;  4OW4 A;  2NZ9 A;  3BAD A;  3FJA A;  4G9N A;  4ION A;  4KC3 A;  1IIL A;  41BI A;  1WBC A;  1RML A;  4END A;  4TLP A;  3I29 B;  2D44 A;  3FJD A;  3TC2 A;  1JT3 A;  5B2H A;  1D0H A;  2D23 A;  3ZC9 A;  3UJ0 A;  2KKI A;  3Q7X A;  1BFB A;  2D43 A;  3Q7Y A;  3AKH A;  1RZO B;  1TIE A;  3BA4 A;  2GO2 A;  4I4Y A;  3W9T A;  2ZQN A;  2AQZ A;  1W3G A;  4I1E A;  4LO0 C;  3BAO A;  4ZA3 B;  3WMV A;  1G9C A;  2Y9W C;  4IZE A;  2D22 A;  3AZW A;  4QBC A;  3UDA A;  2FFV A;  3B9U A;  3AZV A;  5HPZ A;  4Z9W B;  1G82 A;  3HBW A;  3PHZ A;  1S0E A;  2K8R A;  1V6U A;  2MIB A;  4OWL A;  1F31 A;  3VSZ A;  3BAQ A;  1GGP B;  4IYB A;  4JRA A;  1FWU A;  2VXR A;  1Z2V A;  4HA2 A;  3BRF A;  3AH2 A;  2AXM A;  4WBC A;  3V79 C;  4F83 A;  4EFP A;  4L4H A;  3R4S A;  3I2X A;  4AN7 B;  2QN4 A;  4QBV A;  4KEJ A;  1L2H A;  6I1B A;  3E8L C;  1G9A A;  1PUM B;  4OUJ A;  3FJH A;  4G1R A;  4MZF B;  4JQ0 A;  4OEE A;  2GZB A;  3FJ8 A;  4UY4 A;  4I4Q A;  2Q3N B;  4KEI A;  1S0D A;  1BAS A;  4USP A;  3UJ4 A;  4I37 A;  9ILB A;  1FV2 A;  3AJ5 A;  1EYL A;  2KH2 A;  3WO2 A;  2ZR1 B;  2NYY A;  5D63 A;  1K5U A;  2HWA A;  1S0L A;  3AH1 A;  4FVV A;  4X39 A;  5FZU A;  2J3P A;  3ZC8 A;  3OBR A;  4I3N A;  2AFG A;  4LO8 B;  3FJF A;  21BI A;  2D7I A;  1DZC A;  1FWV A;  3VEQ A;  4EFQ A;  4ZBV B;  3ZX7 A;  4I96 A;  4EEE B;  3D7W B;  2K4A B;  4XFS A;  4LO2 C;  1DLL A;  3AKF A;  2D1Z A;  4FGF A;  1YYN A;  3ZXG A;  5F8S A;  3IM6 A;  1BLD A;  1JLX A;  1Z4S A;  1ISV A;  3R4U A;  3V0A B;  3AH4 A;  2D24 A;  2I1B A;  3CA3 A;  2VSE A;  1DFQ A;  2Q9X A;  3V0A A;  2DRY A;  4GP0 A;  3NJ5 A;  1AVX B;  4PC4 A;  3AKI A;  3P6J A;  3FJI A;  1SZ6 B;  31BI A;  4I0Y A;  4OEG A;  1Q04 A;  3FJ9 A;  1YBI A;  4X37 A;  4GAI A;  1BFG A;  1YXW A;  2Y9X E;  4IHZ A;  1T4Q A;  1DJS B;  3OJV A;  2LIQ A;  4I4P A;  1FQ9 A;  4LO2 A;  1DZD A;  3H6Q A;  4LO7 C;  3JRR A;  3N7L A;  1HWP B;  3WO3 A;  1HCD A;  5EG6 C;  3CRH A;  1BLA A;  1I1E A;  2P39 A;  3RSJ A;  3CA6 A;  1AXM A;  3RTI B;  5BXT A;  1E0O A;  1RG8 A;  3O4A A;  1BFF A;  1V6W A;  3O5W B;  1W3A A;  2F2F A;  3O49 A;  5FNX A;  5BXP A;  2NVH A;  1TTU A;  3A07 A;  1MD6 A;  4I7I A;  1S0B A;  4J2K A;  4D8H A;  3VWC A;  2VUA A;  3A22 A;  4J2S A;  2IWT B;  5F8Y A;  8I1B A;  3HSM A;  3LLP A;  3WIN C;  3PG0 A;  1XG6 A;  1G9D A;  1HWN B;  3NBD A;  4XFT A;  4LO7 B;  4J2X A;  1ISW A;  4A7K A;  4ZFU B;  1YF8 B;  2UUS A;  5FZZ A;  3POK A;  2LIE A;  5DSS B;  4P0J A;  3IM5 A;  1ONK B;  3FJJ A;  7I1B A;  1R8O A;  4I4X A;  4ZKT B;  1ABR B;  1IOB A;  1AVA C;  1PWA A;  4P0K A;  1AVU A;  1AFC A;  4I1B A;  3FUO A;  1T9F A;  3VT0 A;  2HZ9 A;  2DRE A;  2ZQO A;  3AJ6 A;  3FFZ A;  4GOY A;  4A7Z A;  1JTC A;  4EB2 B;  1OQL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...