1FWVA

Crystal structure of the cysteine-rich domain of mannose receptor complexed with 3-so4-lewis(a)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
134
structure length
134
Chain Sequence
DARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYSTEINE-RICH DOMAIN OF MANNOSE RECEPTOR
publication title The molecular mechanism of sulfated carbohydrate recognition by the cysteine-rich domain of mannose receptor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein
total genus 33
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2000-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1fwvA00
41BIA 4J2XA 3BA7A 3AZWA 1HWOB 4FVVA 4JKXB 1I1BA 3FJEA 3O4OA 3IIRA 3RTJB 2D20A 2VU9A 4QC4A 4LO8B 3WO2A 1TTUA 3HMYA 4ZBVB 2MLLB 3MPPG 1AVWB 2HW9A 3S8JA 4I4VA 1HWNB 3N0KA 3BAHA 4L4IA 3I2XA 1G9CA 3LTQA 4D8HA 4USPA 3I2AA 4QKRA 4H9WA 1JLXA 3WO4A 3P6IA 4P0KA 5D63A 1BFGA 1IRPA 1EYLA 1HIBA 1MD6A 1G9DA 2F8XC 1CVSA 8I1BA 2P23A 2NTDA 1HKNA 2FO1A 1NZKA 3FJBA 4J2KA 2MC2A 2KI6B 1KNMA 4G9MA 2IWTB 1YF8B 1DZCA 1AF9A 2K43A 4G6MA 3D7WB 4I8MA 4KEKA 1L2HA 3FFZA 4G6JA 3N7JA 5EHAA 5FNWA 4CJMA 1A8DA 1JTCA 1Q03A 1F31A 1M16A 1W3AA 4OEEA 1XYFA 3A21A 3CAHA 1XHBA 5BXRA 2D23A 2NZ9A 3VEQA 4LO3A 1J0SA 3FJKA 4ZLBB 5DVHA 3O3QA 21BIA 2XOAA 3A07A 3AKGA 3BRDA 2X2SA 2KH2A 3AH1A 4L4HA 1DJSB 3C9ZA 3NBEA 4LO2C 4J23B 3W9TA 1JT4A 1BFFA 1XG6A 3BA5A 4I1EA 4P0JA 3QR5A 1JQZA 3H6SE 5BQUA 1R8OA 2ZR1B 1YTOA 2LIQA 5BQUC 3BB2A 3BAGA 4LO0C 4Z8SB 4DCKC 2VXTI 4XFTA 3FJCA 1FN0A 1Q04A 1K5VA 2Y9XE 2ET2A 1BLDA 4LO7B 3CA0A 2Y9FA 4I4YA 4LO7C 1TOOA 2F2FA 2F2FC 2ZQNA 4OWJA 4AN6A 3O4CA 1HWMB 4X3AA 4ENDA 1RY7A 1BA7A 3O44A 5F8SA 1V6XA 1W3GA 3V0AB 1RG8A 2HWAA 3V0AA 5F8WA 3FJ8A 1AVUA 3CA5A 3CA1A 4D0ZA 5BOWA 1DFQA 2R9KB 2VUAA 5D61A 4IQPA 2D7IA 3HN1A 3OJVA 3HOMA 3N7LA 1WD3A 4Q91A 3TC2A 2NP0A 3RSJA 2IHOA 2VXRA 1AXMA 9ILBA 5GAQA 2KKIA 2Q3NB 2WBCA 3WINC 1IRAX 1Q1UA 3QYDA 3IAGC 1EV2A 1EPWA 4EB2B 2GO2A 4P6AA 1BLAA 4HA2A 1SR4A 1SR4C 1ONKB 2BFHA 1Z4SA 1Z2VA 1PZZA 3I29B 1V6VA 3ZX7A 3FJIA 2D22A 3LLPA 3AH4A 3UD9A 3PHZA 1PWAA 4ZFWB 4X38A 2D1ZA 1ISWA 4Q9PA 5BVPI 2K8RA 3Q7XA 3RTIB 4IZXA 3JUTA 3CU1B 1QQLA 1FWUA 4I0YA 3FJJA 5EC5A 3FJ9A 5DUYA 2RSTA 2L5XA 4QBVA 5BXSA 3FJFA 4IHZA 3H6RB 4AN7B 4ISQA 4ZA3B 3WA1A 4GOYA 3R4SA 4PC4A 1GGPB 1BASA 1ABRB 3JRRA 3P53A 4QO3A 4KEIA 4IYBA 1K5UA 4JAWA 3CQAA 1G9BA 1P63A 1PC8B 5BP5A 5BP5C 2NM1A 2D44A 1DLLA 2FFUA 2AQZA 2QYIB 1QQKA 1IOBA 3FGMA 2VSEA 4II0A 4QD2C 3NBCA 1OQLB 5I1BA 4OWKA 3B9UA 4A7YA 1S0BA 2VSAA 3K1XA 1AFCA 3AKIA 1AVXB 5FNXA 4I1BA 2ESUA 3BADA 3O4AA 1XZZA 4J2YA 3CRIA 3O4DA 4ZKTB 1DQGA 1I1EA 2P39A 4GP0A 3AZVA 4JRAA 1II4A 4LO2A 3NBNA 4I37A 2AFGA 4ZOTA 2YUGA 4EEEB 2DREA 1MC9A 1T4QA 1FQ9A 4G1RA 3IM6A 4G9NA 2Y9WC 2D7RA 4JQ0A 7I1BA 1S0LA 4HR6C 1VCLA 1RZOB 3AJ5A 1FGAA 4LO0A 5HPZA 3H6QA 31BIA 3IM7A 5BXPA 3RMYA 2Z49A 1E0OA 4OEFA 1FMZA 3FJAA 2Q9XA 1DZDA 2X2TA 3VT2A 1IHKA 1YBIA 2QN4A 3BAVA 4JKQA 4I3NA 1S0EA 4KC3A 3S8KA 4QBCA 4D0TA 3OJMA 2NYYA 3UDAA 1S0CA 1DIWA 4I6IA 4USOA 4X39A 3WMUA 1FMMS 3CA6A 3Q7YA 1ILR1 3Q7WA 4I4QA 4EFQA 1JT5A 3UD7A 3N7KA 4F83A 4Z9WB 1TWMA 2ERMA 3WINA 1IJTA 1ITBA 5F90A 3WMVA 4ZFYB 2BEBA 2D24A 4GAIA 1ISZA 2LIEA 4WBCA 4EFPA 1CE7B 3BAQA 2Z48A 1WD4A 3IM5A 3FJDA 4TLPA 3V0BB 1ISVA 3E8LC 3O4BA 3V0BA 3ZXGA 2M49A 2Y9GA 3BTAA 2KLLA 3OGFA 4QKSA 1TWEA 1NUNA 5DSSB 1JT7A 3VSFA 4LO1A 1V6WA 4LO1C 4DENA 1R8NA 1HCEA 3NJ5A 4XFUA 4I4RA 3BRFA 3CA3A 1HWPB 3UJ0A 2FGFA 3F1RA 1DQOA 2I1BA 4XKIA 3AJ6A 3KMVA 2KI4A 2E4MA 2E4MC 3PMEA 3WO3A 1ISYA 1BFCA 1TIEA 3H6RA 3ZC9A 5B2HA 3EF2A 5DZUA 2D43A 2RQ9A 3NBDA 4OW4A 1IILA 2HWMA 4IY8A 4I96A 5E24E 4OWLA 1V6UA 2BEAA 5FZUA 1IT0A 4XFSA 2MIBA 1D0HA 1M2TB 4HJJA 3N7MA 5BXTA 4A7KA 2FDBM 2WRYA 3FJHA 4GAFA 5FZYA 3UD8A 3R4UA 4F34A 4QD2B 3PG0A 4EFRA 3CRGA 3VT1A 1RMLA 4JP0A 1T9FA 3BAOA 1G82A 1W3FA 3RMXA 1S0FA 1TP0A 3ZC8A 3MALA 3AH2A 3VUOA 3AKFA 3BRGC 1PUMB 2RG9B 2FFVA 1WBCA 3ILAA 3V79C 4I4PA 4GP3A 3OBRA 4EKXB 5JMCA 4R6UB 3T8SA 4I7IA 1JY0A 2J3PA 4YOLA 4ZFUB 1YXWA 3HSMA 4LO3C 2AAIB 2ZQOA 3FUQA 1YYNA 5EG6C 4KBBA 1SZ6B 4GOVA 3A23A 1WBAA 3OGGA 3POKA 5JLVA 4H04A 2DS0A 4IZEA 1FV3A 5G00A 2NVHA 1DFCA 1S0DA 3O49A 3PUBA 1JLYA 1FV2A 3UJ4A 4QALA 4KEJA 1G9AA 1AVAC 2AXMA 2UUSA 4OEGA 3VWCA 4P0LA 1BARA 1UPSA 6I1BA 2DRYA 3CRHA 1EVTA 3AKHA 4I4XA 3ZXDA 1TFMB 4I4SA 1HCDA 2GZBA 1N4KA 4OUJA 3BAUA 3A22A 2HZ9A 1S0GA 3F62B 4FGFA 3OBTA 1QXMA 3VSZA 4I2SA 4I4UA 3BX1C 1BFBA 1ISXA 4X37A 3CA4A 3SNVA 4A7ZA 4I4OA 1PUUB 4JPZA 3P6JA 1FWVA 3OJ2A 3BA4A 3FUOA 4IY9A 3HBWA 4IONA 5FZZA 2K4AB 4Q9GA 5F8YA 3HALA 1Z0HA 4J2SA 2DRZA 3VT0A 2VLCA 4ZGRB 3O5WB 5D62A 1JT3A 4DEPA 4ISRA
chains in the Genus database with same CATH superfamily
41BIA 4J2XA 3BA7A 3AZWA 1HWOB 4FVVA 4JKXB 1I1BA 3FJEA 3O4OA 3IIRA 3RTJB 2D20A 2VU9A 4QC4A 4LO8B 3WO2A 1TTUA 3HMYA 4ZBVB 2MLLB 3MPPG 1AVWB 2HW9A 3S8JA 4I4VA 1HWNB 3N0KA 3BAHA 4L4IA 3I2XA 1G9CA 3LTQA 4D8HA 4USPA 3I2AA 4QKRA 4H9WA 1JLXA 3WO4A 3P6IA 4P0KA 5D63A 1BFGA 1IRPA 1EYLA 1HIBA 1MD6A 1G9DA 2F8XC 1CVSA 8I1BA 2P23A 2NTDA 1HKNA 2FO1A 1NZKA 3FJBA 4J2KA 2MC2A 2KI6B 1KNMA 4G9MA 2IWTB 1YF8B 1DZCA 1AF9A 2K43A 4G6MA 3D7WB 4I8MA 4KEKA 1L2HA 3FFZA 4G6JA 3N7JA 5EHAA 5FNWA 4CJMA 1A8DA 1JTCA 1Q03A 1F31A 1M16A 1W3AA 4OEEA 1XYFA 4UY4A 3A21A 3CAHA 1XHBA 5BXRA 2D23A 2NZ9A 4H75A 3VEQA 4LO3A 1J0SA 3FJKA 4ZLBB 5DVHA 3O3QA 21BIA 2XOAA 3A07A 3AKGA 3BRDA 2X2SA 2KH2A 3AH1A 4L4HA 1DJSB 3C9ZA 3NBEA 4LO2C 4J23B 3W9TA 1JT4A 1BFFA 1XG6A 3BA5A 4I1EA 4MZHA 4P0JA 3QR5A 1JQZA 3H6SE 5BQUA 1R8OA 2ZR1B 1YTOA 2LIQA 5BQUC 3BB2A 3BAGA 4LO0C 4Z8SB 4DCKC 2VXTI 4XFTA 3FJCA 1FN0A 1Q04A 1K5VA 2Y9XE 2ET2A 1BLDA 4LO7B 3CA0A 2Y9FA 4I4YA 4LO7C 1TOOA 2F2FA 2F2FC 2ZQNA 4OWJA 4AN6A 3O4CA 1HWMB 4X3AA 4ENDA 1RY7A 1BA7A 3O44A 5F8SA 1V6XA 1W3GA 3V0AB 1RG8A 2HWAA 3V0AA 5F8WA 3FJ8A 1AVUA 3CA5A 3CA1A 4D0ZA 5BOWA 1DFQA 2R9KB 2VUAA 5D61A 4IQPA 2D7IA 3HN1A 3OJVA 3HOMA 3N7LA 1WD3A 4Q91A 3TC2A 2NP0A 3RSJA 2IHOA 2VXRA 1AXMA 9ILBA 5GAQA 2KKIA 2Q3NB 2WBCA 3WINC 1IRAX 1Q1UA 3QYDA 3IAGC 1EV2A 1EPWA 4EB2B 2GO2A 4P6AA 1BLAA 4HA2A 1SR4A 1SR4C 1ONKB 2BFHA 1Z4SA 1Z2VA 1PZZA 3I29B 1V6VA 3ZX7A 3FJIA 2D22A 3LLPA 3AH4A 3UD9A 3PHZA 1PWAA 4ZFWB 4X38A 2D1ZA 1ISWA 4Q9PA 5BVPI 2K8RA 3Q7XA 3RTIB 4IZXA 3JUTA 3CU1B 1QQLA 1FWUA 4I0YA 3FJJA 5EC5A 3FJ9A 5DUYA 2RSTA 2L5XA 4QBVA 5BXSA 3FJFA 4IHZA 3H6RB 4AN7B 4ISQA 4ZA3B 3WA1A 4GOYA 3R4SA 4PC4A 1GGPB 1BASA 1ABRB 3JRRA 3P53A 4QO3A 4KEIA 4IYBA 1K5UA 4JAWA 3CQAA 1G9BA 1P63A 1PC8B 5BP5A 5BP5C 2NM1A 2D44A 1DLLA 2FFUA 2AQZA 2QYIB 1QQKA 1IOBA 3FGMA 2VSEA 4II0A 4QD2C 3NBCA 1OQLB 5I1BA 4OWKA 3B9UA 4A7YA 1S0BA 2VSAA 3K1XA 1AFCA 3AKIA 1AVXB 5FNXA 4I1BA 2ESUA 3BADA 3O4AA 1XZZA 4J2YA 3CRIA 3O4DA 4ZKTB 1DQGA 1I1EA 2P39A 4GP0A 3AZVA 4JRAA 1II4A 4LO2A 3NBNA 4I37A 2AFGA 4ZOTA 2YUGA 4EEEB 2DREA 1MC9A 1T4QA 1FQ9A 4G1RA 3IM6A 4G9NA 2Y9WC 2D7RA 4JQ0A 7I1BA 1S0LA 4HR6C 1VCLA 1RZOB 3AJ5A 1FGAA 4LO0A 5HPZA 3H6QA 31BIA 3IM7A 5BXPA 3RMYA 2Z49A 1E0OA 4OEFA 1FMZA 3FJAA 2Q9XA 1DZDA 2X2TA 3VT2A 1IHKA 1YBIA 2QN4A 3BAVA 4JKQA 4I3NA 1S0EA 4KC3A 3S8KA 4QBCA 4D0TA 3OJMA 2NYYA 3UDAA 1S0CA 1DIWA 4I6IA 4USOA 4X39A 3WMUA 1FMMS 3CA6A 3Q7YA 1ILR1 3Q7WA 4I4QA 4EFQA 1JT5A 3UD7A 4MZGB 3N7KA 4F83A 4Z9WB 1TWMA 2ERMA 3WINA 4MZFB 1IJTA 1ITBA 5F90A 3WMVA 4ZFYB 2BEBA 2D24A 4GAIA 1ISZA 2LIEA 4WBCA 4EFPA 1CE7B 3BAQA 2Z48A 1WD4A 3IM5A 3FJDA 4TLPA 3V0BB 1ISVA 3E8LC 3O4BA 3V0BA 2NS2A 3ZXGA 2M49A 2Y9GA 3BTAA 2KLLA 3OGFA 4QKSA 1TWEA 1NUNA 5DSSB 1JT7A 3VSFA 4LO1A 1V6WA 4LO1C 4DENA 1R8NA 1HCEA 3NJ5A 4XFUA 4I4RA 3BRFA 3CA3A 1HWPB 3UJ0A 2FGFA 3F1RA 1DQOA 2I1BA 4XKIA 3AJ6A 3KMVA 2KI4A 2E4MA 2E4MC 3PMEA 3WO3A 1ISYA 1BFCA 1TIEA 3H6RA 3ZC9A 5B2HA 3EF2A 5DZUA 2D43A 2RQ9A 3NBDA 4OW4A 1IILA 2HWMA 4IY8A 4I96A 5E24E 4OWLA 1V6UA 2BEAA 5FZUA 1IT0A 4XFSA 2MIBA 1D0HA 1M2TB 4HJJA 3N7MA 5BXTA 4A7KA 2FDBM 2WRYA 3FJHA 4GAFA 5FZYA 3UD8A 3R4UA 4F34A 4QD2B 3PG0A 4EFRA 3CRGA 3VT1A 1RMLA 4JP0A 1T9FA 3BAOA 1G82A 1W3FA 3RMXA 1S0FA 1TP0A 3ZC8A 3MALA 3AH2A 3VUOA 3AKFA 3BRGC 1PUMB 2RG9B 2FFVA 1WBCA 3ILAA 3V79C 4I4PA 4GP3A 3OBRA 4EKXB 5JMCA 4R6UB 3T8SA 4I7IA 1JY0A 2J3PA 4YOLA 4ZFUB 1YXWA 3HSMA 4LO3C 2AAIB 2ZQOA 3FUQA 1YYNA 5EG6C 4KBBA 1SZ6B 4GOVA 3A23A 1WBAA 3OGGA 3POKA 5JLVA 4H04A 2DS0A 4IZEA 1FV3A 5G00A 2NVHA 1DFCA 1S0DA 3O49A 3PUBA 1JLYA 1FV2A 3UJ4A 4QALA 4KEJA 1G9AA 1AVAC 2AXMA 2UUSA 4OEGA 3VWCA 4P0LA 1BARA 1UPSA 6I1BA 2DRYA 3CRHA 1EVTA 3AKHA 4I4XA 3ZXDA 1TFMB 4I4SA 1HCDA 2GZBA 1N4KA 4OUJA 3BAUA 3A22A 2HZ9A 1S0GA 3F62B 4FGFA 3OBTA 1QXMA 3VSZA 4I2SA 4I4UA 3BX1C 1BFBA 1ISXA 4X37A 3CA4A 3SNVA 4A7ZA 4I4OA 1PUUB 4JPZA 3P6JA 1FWVA 3OJ2A 3BA4A 3FUOA 4IY9A 3HBWA 4IONA 5FZZA 2K4AB 4Q9GA 5F8YA 3HALA 1Z0HA 4J2SA 2DRZA 3VT0A 2VLCA 4ZGRB 3O5WB 5D62A 1JT3A 4DEPA 4ISRA
chains in the Genus database with same CATH topology
41BIA 4J2XA 3BA7A 3AZWA 1HWOB 4FVVA 4JKXB 1I1BA 3FJEA 3O4OA 3IIRA 3RTJB 2D20A 2VU9A 4QC4A 4LO8B 3WO2A 1TTUA 3HMYA 4ZBVB 2MLLB 3MPPG 1AVWB 2HW9A 3S8JA 4I4VA 1HWNB 3N0KA 3BAHA 4L4IA 3I2XA 1G9CA 3LTQA 4D8HA 4USPA 3I2AA 4QKRA 4H9WA 1JLXA 3WO4A 3P6IA 4P0KA 5D63A 1BFGA 1IRPA 1EYLA 1HIBA 1MD6A 1G9DA 2F8XC 1CVSA 8I1BA 2P23A 2NTDA 1HKNA 2FO1A 1NZKA 3FJBA 4J2KA 2MC2A 2KI6B 1KNMA 4G9MA 2IWTB 1YF8B 1DZCA 1AF9A 2K43A 4G6MA 3D7WB 4I8MA 4KEKA 1L2HA 3FFZA 4G6JA 3N7JA 5EHAA 5FNWA 4CJMA 1A8DA 1JTCA 1Q03A 1F31A 1M16A 1W3AA 4OEEA 1XYFA 4UY4A 3A21A 3CAHA 1XHBA 5BXRA 2D23A 2NZ9A 4H75A 3VEQA 4LO3A 1J0SA 3FJKA 4ZLBB 5DVHA 3O3QA 21BIA 2XOAA 3A07A 3AKGA 3BRDA 2X2SA 2KH2A 3AH1A 4L4HA 1DJSB 3C9ZA 3NBEA 4LO2C 4J23B 3W9TA 1JT4A 1BFFA 1XG6A 3BA5A 4I1EA 4MZHA 4P0JA 3QR5A 1JQZA 3H6SE 5BQUA 1R8OA 2ZR1B 1YTOA 2LIQA 5BQUC 3BB2A 3BAGA 4LO0C 4Z8SB 4DCKC 2VXTI 4XFTA 3FJCA 1FN0A 1Q04A 1K5VA 2Y9XE 2ET2A 1BLDA 4LO7B 3CA0A 2Y9FA 4I4YA 4LO7C 1TOOA 2F2FA 2F2FC 2ZQNA 4OWJA 4AN6A 3O4CA 1HWMB 4X3AA 4ENDA 1RY7A 1BA7A 3O44A 5F8SA 1V6XA 1W3GA 3V0AB 1RG8A 2HWAA 3V0AA 5F8WA 3FJ8A 1AVUA 3CA5A 3CA1A 4D0ZA 5BOWA 1DFQA 2R9KB 2VUAA 5D61A 4IQPA 2D7IA 3HN1A 3OJVA 3HOMA 3N7LA 1WD3A 4Q91A 3TC2A 2NP0A 3RSJA 2IHOA 2VXRA 1AXMA 9ILBA 5GAQA 2KKIA 2Q3NB 2WBCA 3WINC 1IRAX 1Q1UA 3QYDA 3IAGC 1EV2A 1EPWA 4EB2B 2GO2A 4P6AA 1BLAA 4HA2A 1SR4A 1SR4C 1ONKB 2BFHA 1Z4SA 1Z2VA 1PZZA 3I29B 1V6VA 3ZX7A 3FJIA 2D22A 3LLPA 3AH4A 3UD9A 3PHZA 1PWAA 4ZFWB 4X38A 2D1ZA 1ISWA 4Q9PA 5BVPI 2K8RA 3Q7XA 3RTIB 4IZXA 3JUTA 3CU1B 1QQLA 1FWUA 4I0YA 3FJJA 5EC5A 3FJ9A 5DUYA 2RSTA 2L5XA 4QBVA 5BXSA 3FJFA 4IHZA 3H6RB 4AN7B 4ISQA 4ZA3B 3WA1A 4GOYA 3R4SA 4PC4A 1GGPB 1BASA 1ABRB 3JRRA 3P53A 4QO3A 4KEIA 4IYBA 1K5UA 4JAWA 3CQAA 1G9BA 1P63A 1PC8B 5BP5A 5BP5C 2NM1A 2D44A 1DLLA 2FFUA 2AQZA 2QYIB 1QQKA 1IOBA 3FGMA 2VSEA 4II0A 4QD2C 3NBCA 1OQLB 5I1BA 4OWKA 3B9UA 4A7YA 1S0BA 2VSAA 3K1XA 1AFCA 3AKIA 1AVXB 5FNXA 4I1BA 2ESUA 3BADA 3O4AA 1XZZA 4J2YA 3CRIA 3O4DA 4ZKTB 1DQGA 1I1EA 2P39A 4GP0A 3AZVA 4JRAA 1II4A 4LO2A 3NBNA 4I37A 2AFGA 4ZOTA 2YUGA 4EEEB 2DREA 1MC9A 1T4QA 1FQ9A 4G1RA 3IM6A 4G9NA 2Y9WC 2D7RA 4JQ0A 7I1BA 1S0LA 4HR6C 1VCLA 1RZOB 3AJ5A 1FGAA 4LO0A 5HPZA 3H6QA 31BIA 3IM7A 5BXPA 3RMYA 2Z49A 1E0OA 4OEFA 1FMZA 3FJAA 2Q9XA 1DZDA 2X2TA 3VT2A 1IHKA 1YBIA 2QN4A 3BAVA 4JKQA 4I3NA 1S0EA 4KC3A 3S8KA 4QBCA 4D0TA 3OJMA 2NYYA 3UDAA 1S0CA 1DIWA 4I6IA 4USOA 4X39A 3WMUA 1FMMS 3CA6A 3Q7YA 1ILR1 3Q7WA 4I4QA 4EFQA 1JT5A 3UD7A 4MZGB 3N7KA 4F83A 4Z9WB 1TWMA 2ERMA 3WINA 4MZFB 1IJTA 1ITBA 5F90A 3WMVA 4ZFYB 2BEBA 2D24A 4GAIA 1ISZA 2LIEA 4WBCA 4EFPA 1CE7B 3BAQA 2Z48A 1WD4A 3IM5A 3FJDA 4TLPA 3V0BB 1ISVA 3E8LC 3O4BA 3V0BA 2NS2A 3ZXGA 2M49A 2Y9GA 3BTAA 2KLLA 3OGFA 4QKSA 1TWEA 1NUNA 5DSSB 1JT7A 3VSFA 4LO1A 1V6WA 4LO1C 4DENA 1R8NA 1HCEA 3NJ5A 4XFUA 4I4RA 3BRFA 3CA3A 1HWPB 3UJ0A 2FGFA 3F1RA 1DQOA 2I1BA 4XKIA 3AJ6A 3KMVA 2KI4A 2E4MA 2E4MC 3PMEA 3WO3A 1ISYA 1BFCA 1TIEA 3H6RA 3ZC9A 5B2HA 3EF2A 5DZUA 2D43A 2RQ9A 3NBDA 4OW4A 1IILA 2HWMA 4IY8A 4I96A 5E24E 4OWLA 1V6UA 2BEAA 5FZUA 1IT0A 4XFSA 2MIBA 1D0HA 1M2TB 4HJJA 3N7MA 5BXTA 4A7KA 2FDBM 2WRYA 3FJHA 4GAFA 5FZYA 3UD8A 3R4UA 4F34A 4QD2B 3PG0A 4EFRA 3CRGA 3VT1A 1RMLA 4JP0A 1T9FA 3BAOA 1G82A 1W3FA 3RMXA 1S0FA 1TP0A 3ZC8A 3MALA 3AH2A 3VUOA 3AKFA 3BRGC 1PUMB 2RG9B 2FFVA 1WBCA 3ILAA 3V79C 4I4PA 4GP3A 3OBRA 4EKXB 5JMCA 4R6UB 3T8SA 4I7IA 1JY0A 2J3PA 4YOLA 4ZFUB 1YXWA 3HSMA 4LO3C 2AAIB 2ZQOA 3FUQA 1YYNA 5EG6C 4KBBA 1SZ6B 4GOVA 3A23A 1WBAA 3OGGA 3POKA 5JLVA 4H04A 2DS0A 4IZEA 1FV3A 5G00A 2NVHA 1DFCA 1S0DA 3O49A 3PUBA 1JLYA 1FV2A 3UJ4A 4QALA 4KEJA 1G9AA 1AVAC 2AXMA 2UUSA 4OEGA 3VWCA 4P0LA 1BARA 1UPSA 6I1BA 2DRYA 3CRHA 1EVTA 3AKHA 4I4XA 3ZXDA 1TFMB 4I4SA 1HCDA 2GZBA 1N4KA 4OUJA 3BAUA 3A22A 2HZ9A 1S0GA 3F62B 4FGFA 3OBTA 1QXMA 3VSZA 4I2SA 4I4UA 3BX1C 1BFBA 1ISXA 4X37A 3CA4A 3SNVA 4A7ZA 4I4OA 1PUUB 4JPZA 3P6JA 1FWVA 3OJ2A 3BA4A 3FUOA 4IY9A 3HBWA 4IONA 5FZZA 2K4AB 4Q9GA 5F8YA 3HALA 1Z0HA 4J2SA 2DRZA 3VT0A 2VLCA 4ZGRB 3O5WB 5D62A 1JT3A 4DEPA 4ISRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 41BI A;  4J2X A;  3BA7 A;  3AZW A;  1HWO B;  4FVV A;  4JKX B;  1I1B A;  3FJE A;  3O4O A;  3IIR A;  3RTJ B;  2D20 A;  2VU9 A;  4QC4 A;  4LO8 B;  3WO2 A;  1TTU A;  3HMY A;  4ZBV B;  2MLL B;  3MPP G;  1AVW B;  2HW9 A;  3S8J A;  4I4V A;  1HWN B;  3N0K A;  3BAH A;  4L4I A;  3I2X A;  1G9C A;  3LTQ A;  4D8H A;  4USP A;  3I2A A;  4QKR A;  4H9W A;  1JLX A;  3WO4 A;  3P6I A;  4P0K A;  5D63 A;  1BFG A;  1IRP A;  1EYL A;  1HIB A;  1MD6 A;  1G9D A;  2F8X C;  1CVS A;  8I1B A;  2P23 A;  2NTD A;  1HKN A;  2FO1 A;  1NZK A;  3FJB A;  4J2K A;  2MC2 A;  2KI6 B;  1KNM A;  4G9M A;  2IWT B;  1YF8 B;  1DZC A;  1AF9 A;  2K43 A;  4G6M A;  3D7W B;  4I8M A;  4KEK A;  1L2H A;  3FFZ A;  4G6J A;  3N7J A;  5EHA A;  5FNW A;  4CJM A;  1A8D A;  1JTC A;  1Q03 A;  1F31 A;  1M16 A;  1W3A A;  4OEE A;  1XYF A;  3A21 A;  3CAH A;  1XHB A;  5BXR A;  2D23 A;  2NZ9 A;  3VEQ A;  4LO3 A;  1J0S A;  3FJK A;  4ZLB B;  5DVH A;  3O3Q A;  21BI A;  2XOA A;  3A07 A;  3AKG A;  3BRD A;  2X2S A;  2KH2 A;  3AH1 A;  4L4H A;  1DJS B;  3C9Z A;  3NBE A;  4LO2 C;  4J23 B;  3W9T A;  1JT4 A;  1BFF A;  1XG6 A;  3BA5 A;  4I1E A;  4P0J A;  3QR5 A;  1JQZ A;  3H6S E;  5BQU A;  1R8O A;  2ZR1 B;  1YTO A;  2LIQ A;  5BQU C;  3BB2 A;  3BAG A;  4LO0 C;  4Z8S B;  4DCK C;  2VXT I;  4XFT A;  3FJC A;  1FN0 A;  1Q04 A;  1K5V A;  2Y9X E;  2ET2 A;  1BLD A;  4LO7 B;  3CA0 A;  2Y9F A;  4I4Y A;  4LO7 C;  1TOO A;  2F2F A;  2F2F C;  2ZQN A;  4OWJ A;  4AN6 A;  3O4C A;  1HWM B;  4X3A A;  4END A;  1RY7 A;  1BA7 A;  3O44 A;  5F8S A;  1V6X A;  1W3G A;  3V0A B;  1RG8 A;  2HWA A;  3V0A A;  5F8W A;  3FJ8 A;  1AVU A;  3CA5 A;  3CA1 A;  4D0Z A;  5BOW A;  1DFQ A;  2R9K B;  2VUA A;  5D61 A;  4IQP A;  2D7I A;  3HN1 A;  3OJV A;  3HOM A;  3N7L A;  1WD3 A;  4Q91 A;  3TC2 A;  2NP0 A;  3RSJ A;  2IHO A;  2VXR A;  1AXM A;  9ILB A;  5GAQ A;  2KKI A;  2Q3N B;  2WBC A;  3WIN C;  1IRA X;  1Q1U A;  3QYD A;  3IAG C;  1EV2 A;  1EPW A;  4EB2 B;  2GO2 A;  4P6A A;  1BLA A;  4HA2 A;  1SR4 A;  1SR4 C;  1ONK B;  2BFH A;  1Z4S A;  1Z2V A;  1PZZ A;  3I29 B;  1V6V A;  3ZX7 A;  3FJI A;  2D22 A;  3LLP A;  3AH4 A;  3UD9 A;  3PHZ A;  1PWA A;  4ZFW B;  4X38 A;  2D1Z A;  1ISW A;  4Q9P A;  5BVP I;  2K8R A;  3Q7X A;  3RTI B;  4IZX A;  3JUT A;  3CU1 B;  1QQL A;  1FWU A;  4I0Y A;  3FJJ A;  5EC5 A;  3FJ9 A;  5DUY A;  2RST A;  2L5X A;  4QBV A;  5BXS A;  3FJF A;  4IHZ A;  3H6R B;  4AN7 B;  4ISQ A;  4ZA3 B;  3WA1 A;  4GOY A;  3R4S A;  4PC4 A;  1GGP B;  1BAS A;  1ABR B;  3JRR A;  3P53 A;  4QO3 A;  4KEI A;  4IYB A;  1K5U A;  4JAW A;  3CQA A;  1G9B A;  1P63 A;  1PC8 B;  5BP5 A;  5BP5 C;  2NM1 A;  2D44 A;  1DLL A;  2FFU A;  2AQZ A;  2QYI B;  1QQK A;  1IOB A;  3FGM A;  2VSE A;  4II0 A;  4QD2 C;  3NBC A;  1OQL B;  5I1B A;  4OWK A;  3B9U A;  4A7Y A;  1S0B A;  2VSA A;  3K1X A;  1AFC A;  3AKI A;  1AVX B;  5FNX A;  4I1B A;  2ESU A;  3BAD A;  3O4A A;  1XZZ A;  4J2Y A;  3CRI A;  3O4D A;  4ZKT B;  1DQG A;  1I1E A;  2P39 A;  4GP0 A;  3AZV A;  4JRA A;  1II4 A;  4LO2 A;  3NBN A;  4I37 A;  2AFG A;  4ZOT A;  2YUG A;  4EEE B;  2DRE A;  1MC9 A;  1T4Q A;  1FQ9 A;  4G1R A;  3IM6 A;  4G9N A;  2Y9W C;  2D7R A;  4JQ0 A;  7I1B A;  1S0L A;  4HR6 C;  1VCL A;  1RZO B;  3AJ5 A;  1FGA A;  4LO0 A;  5HPZ A;  3H6Q A;  31BI A;  3IM7 A;  5BXP A;  3RMY A;  2Z49 A;  1E0O A;  4OEF A;  1FMZ A;  3FJA A;  2Q9X A;  1DZD A;  2X2T A;  3VT2 A;  1IHK A;  1YBI A;  2QN4 A;  3BAV A;  4JKQ A;  4I3N A;  1S0E A;  4KC3 A;  3S8K A;  4QBC A;  4D0T A;  3OJM A;  2NYY A;  3UDA A;  1S0C A;  1DIW A;  4I6I A;  4USO A;  4X39 A;  3WMU A;  1FMM S;  3CA6 A;  3Q7Y A;  1ILR 1;  3Q7W A;  4I4Q A;  4EFQ A;  1JT5 A;  3UD7 A;  3N7K A;  4F83 A;  4Z9W B;  1TWM A;  2ERM A;  3WIN A;  1IJT A;  1ITB A;  5F90 A;  3WMV A;  4ZFY B;  2BEB A;  2D24 A;  4GAI A;  1ISZ A;  2LIE A;  4WBC A;  4EFP A;  1CE7 B;  3BAQ A;  2Z48 A;  1WD4 A;  3IM5 A;  3FJD A;  4TLP A;  3V0B B;  1ISV A;  3E8L C;  3O4B A;  3V0B A;  3ZXG A;  2M49 A;  2Y9G A;  3BTA A;  2KLL A;  3OGF A;  4QKS A;  1TWE A;  1NUN A;  5DSS B;  1JT7 A;  3VSF A;  4LO1 A;  1V6W A;  4LO1 C;  4DEN A;  1R8N A;  1HCE A;  3NJ5 A;  4XFU A;  4I4R A;  3BRF A;  3CA3 A;  1HWP B;  3UJ0 A;  2FGF A;  3F1R A;  1DQO A;  2I1B A;  4XKI A;  3AJ6 A;  3KMV A;  2KI4 A;  2E4M A;  2E4M C;  3PME A;  3WO3 A;  1ISY A;  1BFC A;  1TIE A;  3H6R A;  3ZC9 A;  5B2H A;  3EF2 A;  5DZU A;  2D43 A;  2RQ9 A;  3NBD A;  4OW4 A;  1IIL A;  2HWM A;  4IY8 A;  4I96 A;  5E24 E;  4OWL A;  1V6U A;  2BEA A;  5FZU A;  1IT0 A;  4XFS A;  2MIB A;  1D0H A;  1M2T B;  4HJJ A;  3N7M A;  5BXT A;  4A7K A;  2FDB M;  2WRY A;  3FJH A;  4GAF A;  5FZY A;  3UD8 A;  3R4U A;  4F34 A;  4QD2 B;  3PG0 A;  4EFR A;  3CRG A;  3VT1 A;  1RML A;  4JP0 A;  1T9F A;  3BAO A;  1G82 A;  1W3F A;  3RMX A;  1S0F A;  1TP0 A;  3ZC8 A;  3MAL A;  3AH2 A;  3VUO A;  3AKF A;  3BRG C;  1PUM B;  2RG9 B;  2FFV A;  1WBC A;  3ILA A;  3V79 C;  4I4P A;  4GP3 A;  3OBR A;  4EKX B;  5JMC A;  4R6U B;  3T8S A;  4I7I A;  1JY0 A;  2J3P A;  4YOL A;  4ZFU B;  1YXW A;  3HSM A;  4LO3 C;  2AAI B;  2ZQO A;  3FUQ A;  1YYN A;  5EG6 C;  4KBB A;  1SZ6 B;  4GOV A;  3A23 A;  1WBA A;  3OGG A;  3POK A;  5JLV A;  4H04 A;  2DS0 A;  4IZE A;  1FV3 A;  5G00 A;  2NVH A;  1DFC A;  1S0D A;  3O49 A;  3PUB A;  1JLY A;  1FV2 A;  3UJ4 A;  4QAL A;  4KEJ A;  1G9A A;  1AVA C;  2AXM A;  2UUS A;  4OEG A;  3VWC A;  4P0L A;  1BAR A;  1UPS A;  6I1B A;  2DRY A;  3CRH A;  1EVT A;  3AKH A;  4I4X A;  3ZXD A;  1TFM B;  4I4S A;  1HCD A;  2GZB A;  1N4K A;  4OUJ A;  3BAU A;  3A22 A;  2HZ9 A;  1S0G A;  3F62 B;  4FGF A;  3OBT A;  1QXM A;  3VSZ A;  4I2S A;  4I4U A;  3BX1 C;  1BFB A;  1ISX A;  4X37 A;  3CA4 A;  3SNV A;  4A7Z A;  4I4O A;  1PUU B;  4JPZ A;  3P6J A;  1FWV A;  3OJ2 A;  3BA4 A;  3FUO A;  4IY9 A;  3HBW A;  4ION A;  5FZZ A;  2K4A B;  4Q9G A;  5F8Y A;  3HAL A;  1Z0H A;  4J2S A;  2DRZ A;  3VT0 A;  2VLC A;  4ZGR B;  3O5W B;  5D62 A;  1JT3 A;  4DEP A;  4ISR A; 
#chains in the Genus database with same CATH topology
 41BI A;  4J2X A;  3BA7 A;  3AZW A;  1HWO B;  4FVV A;  4JKX B;  1I1B A;  3FJE A;  3O4O A;  3IIR A;  3RTJ B;  2D20 A;  2VU9 A;  4QC4 A;  4LO8 B;  3WO2 A;  1TTU A;  3HMY A;  4ZBV B;  2MLL B;  3MPP G;  1AVW B;  2HW9 A;  3S8J A;  4I4V A;  1HWN B;  3N0K A;  3BAH A;  4L4I A;  3I2X A;  1G9C A;  3LTQ A;  4D8H A;  4USP A;  3I2A A;  4QKR A;  4H9W A;  1JLX A;  3WO4 A;  3P6I A;  4P0K A;  5D63 A;  1BFG A;  1IRP A;  1EYL A;  1HIB A;  1MD6 A;  1G9D A;  2F8X C;  1CVS A;  8I1B A;  2P23 A;  2NTD A;  1HKN A;  2FO1 A;  1NZK A;  3FJB A;  4J2K A;  2MC2 A;  2KI6 B;  1KNM A;  4G9M A;  2IWT B;  1YF8 B;  1DZC A;  1AF9 A;  2K43 A;  4G6M A;  3D7W B;  4I8M A;  4KEK A;  1L2H A;  3FFZ A;  4G6J A;  3N7J A;  5EHA A;  5FNW A;  4CJM A;  1A8D A;  1JTC A;  1Q03 A;  1F31 A;  1M16 A;  1W3A A;  4OEE A;  1XYF A;  4UY4 A;  3A21 A;  3CAH A;  1XHB A;  5BXR A;  2D23 A;  2NZ9 A;  4H75 A;  3VEQ A;  4LO3 A;  1J0S A;  3FJK A;  4ZLB B;  5DVH A;  3O3Q A;  21BI A;  2XOA A;  3A07 A;  3AKG A;  3BRD A;  2X2S A;  2KH2 A;  3AH1 A;  4L4H A;  1DJS B;  3C9Z A;  3NBE A;  4LO2 C;  4J23 B;  3W9T A;  1JT4 A;  1BFF A;  1XG6 A;  3BA5 A;  4I1E A;  4MZH A;  4P0J A;  3QR5 A;  1JQZ A;  3H6S E;  5BQU A;  1R8O A;  2ZR1 B;  1YTO A;  2LIQ A;  5BQU C;  3BB2 A;  3BAG A;  4LO0 C;  4Z8S B;  4DCK C;  2VXT I;  4XFT A;  3FJC A;  1FN0 A;  1Q04 A;  1K5V A;  2Y9X E;  2ET2 A;  1BLD A;  4LO7 B;  3CA0 A;  2Y9F A;  4I4Y A;  4LO7 C;  1TOO A;  2F2F A;  2F2F C;  2ZQN A;  4OWJ A;  4AN6 A;  3O4C A;  1HWM B;  4X3A A;  4END A;  1RY7 A;  1BA7 A;  3O44 A;  5F8S A;  1V6X A;  1W3G A;  3V0A B;  1RG8 A;  2HWA A;  3V0A A;  5F8W A;  3FJ8 A;  1AVU A;  3CA5 A;  3CA1 A;  4D0Z A;  5BOW A;  1DFQ A;  2R9K B;  2VUA A;  5D61 A;  4IQP A;  2D7I A;  3HN1 A;  3OJV A;  3HOM A;  3N7L A;  1WD3 A;  4Q91 A;  3TC2 A;  2NP0 A;  3RSJ A;  2IHO A;  2VXR A;  1AXM A;  9ILB A;  5GAQ A;  2KKI A;  2Q3N B;  2WBC A;  3WIN C;  1IRA X;  1Q1U A;  3QYD A;  3IAG C;  1EV2 A;  1EPW A;  4EB2 B;  2GO2 A;  4P6A A;  1BLA A;  4HA2 A;  1SR4 A;  1SR4 C;  1ONK B;  2BFH A;  1Z4S A;  1Z2V A;  1PZZ A;  3I29 B;  1V6V A;  3ZX7 A;  3FJI A;  2D22 A;  3LLP A;  3AH4 A;  3UD9 A;  3PHZ A;  1PWA A;  4ZFW B;  4X38 A;  2D1Z A;  1ISW A;  4Q9P A;  5BVP I;  2K8R A;  3Q7X A;  3RTI B;  4IZX A;  3JUT A;  3CU1 B;  1QQL A;  1FWU A;  4I0Y A;  3FJJ A;  5EC5 A;  3FJ9 A;  5DUY A;  2RST A;  2L5X A;  4QBV A;  5BXS A;  3FJF A;  4IHZ A;  3H6R B;  4AN7 B;  4ISQ A;  4ZA3 B;  3WA1 A;  4GOY A;  3R4S A;  4PC4 A;  1GGP B;  1BAS A;  1ABR B;  3JRR A;  3P53 A;  4QO3 A;  4KEI A;  4IYB A;  1K5U A;  4JAW A;  3CQA A;  1G9B A;  1P63 A;  1PC8 B;  5BP5 A;  5BP5 C;  2NM1 A;  2D44 A;  1DLL A;  2FFU A;  2AQZ A;  2QYI B;  1QQK A;  1IOB A;  3FGM A;  2VSE A;  4II0 A;  4QD2 C;  3NBC A;  1OQL B;  5I1B A;  4OWK A;  3B9U A;  4A7Y A;  1S0B A;  2VSA A;  3K1X A;  1AFC A;  3AKI A;  1AVX B;  5FNX A;  4I1B A;  2ESU A;  3BAD A;  3O4A A;  1XZZ A;  4J2Y A;  3CRI A;  3O4D A;  4ZKT B;  1DQG A;  1I1E A;  2P39 A;  4GP0 A;  3AZV A;  4JRA A;  1II4 A;  4LO2 A;  3NBN A;  4I37 A;  2AFG A;  4ZOT A;  2YUG A;  4EEE B;  2DRE A;  1MC9 A;  1T4Q A;  1FQ9 A;  4G1R A;  3IM6 A;  4G9N A;  2Y9W C;  2D7R A;  4JQ0 A;  7I1B A;  1S0L A;  4HR6 C;  1VCL A;  1RZO B;  3AJ5 A;  1FGA A;  4LO0 A;  5HPZ A;  3H6Q A;  31BI A;  3IM7 A;  5BXP A;  3RMY A;  2Z49 A;  1E0O A;  4OEF A;  1FMZ A;  3FJA A;  2Q9X A;  1DZD A;  2X2T A;  3VT2 A;  1IHK A;  1YBI A;  2QN4 A;  3BAV A;  4JKQ A;  4I3N A;  1S0E A;  4KC3 A;  3S8K A;  4QBC A;  4D0T A;  3OJM A;  2NYY A;  3UDA A;  1S0C A;  1DIW A;  4I6I A;  4USO A;  4X39 A;  3WMU A;  1FMM S;  3CA6 A;  3Q7Y A;  1ILR 1;  3Q7W A;  4I4Q A;  4EFQ A;  1JT5 A;  3UD7 A;  4MZG B;  3N7K A;  4F83 A;  4Z9W B;  1TWM A;  2ERM A;  3WIN A;  4MZF B;  1IJT A;  1ITB A;  5F90 A;  3WMV A;  4ZFY B;  2BEB A;  2D24 A;  4GAI A;  1ISZ A;  2LIE A;  4WBC A;  4EFP A;  1CE7 B;  3BAQ A;  2Z48 A;  1WD4 A;  3IM5 A;  3FJD A;  4TLP A;  3V0B B;  1ISV A;  3E8L C;  3O4B A;  3V0B A;  2NS2 A;  3ZXG A;  2M49 A;  2Y9G A;  3BTA A;  2KLL A;  3OGF A;  4QKS A;  1TWE A;  1NUN A;  5DSS B;  1JT7 A;  3VSF A;  4LO1 A;  1V6W A;  4LO1 C;  4DEN A;  1R8N A;  1HCE A;  3NJ5 A;  4XFU A;  4I4R A;  3BRF A;  3CA3 A;  1HWP B;  3UJ0 A;  2FGF A;  3F1R A;  1DQO A;  2I1B A;  4XKI A;  3AJ6 A;  3KMV A;  2KI4 A;  2E4M A;  2E4M C;  3PME A;  3WO3 A;  1ISY A;  1BFC A;  1TIE A;  3H6R A;  3ZC9 A;  5B2H A;  3EF2 A;  5DZU A;  2D43 A;  2RQ9 A;  3NBD A;  4OW4 A;  1IIL A;  2HWM A;  4IY8 A;  4I96 A;  5E24 E;  4OWL A;  1V6U A;  2BEA A;  5FZU A;  1IT0 A;  4XFS A;  2MIB A;  1D0H A;  1M2T B;  4HJJ A;  3N7M A;  5BXT A;  4A7K A;  2FDB M;  2WRY A;  3FJH A;  4GAF A;  5FZY A;  3UD8 A;  3R4U A;  4F34 A;  4QD2 B;  3PG0 A;  4EFR A;  3CRG A;  3VT1 A;  1RML A;  4JP0 A;  1T9F A;  3BAO A;  1G82 A;  1W3F A;  3RMX A;  1S0F A;  1TP0 A;  3ZC8 A;  3MAL A;  3AH2 A;  3VUO A;  3AKF A;  3BRG C;  1PUM B;  2RG9 B;  2FFV A;  1WBC A;  3ILA A;  3V79 C;  4I4P A;  4GP3 A;  3OBR A;  4EKX B;  5JMC A;  4R6U B;  3T8S A;  4I7I A;  1JY0 A;  2J3P A;  4YOL A;  4ZFU B;  1YXW A;  3HSM A;  4LO3 C;  2AAI B;  2ZQO A;  3FUQ A;  1YYN A;  5EG6 C;  4KBB A;  1SZ6 B;  4GOV A;  3A23 A;  1WBA A;  3OGG A;  3POK A;  5JLV A;  4H04 A;  2DS0 A;  4IZE A;  1FV3 A;  5G00 A;  2NVH A;  1DFC A;  1S0D A;  3O49 A;  3PUB A;  1JLY A;  1FV2 A;  3UJ4 A;  4QAL A;  4KEJ A;  1G9A A;  1AVA C;  2AXM A;  2UUS A;  4OEG A;  3VWC A;  4P0L A;  1BAR A;  1UPS A;  6I1B A;  2DRY A;  3CRH A;  1EVT A;  3AKH A;  4I4X A;  3ZXD A;  1TFM B;  4I4S A;  1HCD A;  2GZB A;  1N4K A;  4OUJ A;  3BAU A;  3A22 A;  2HZ9 A;  1S0G A;  3F62 B;  4FGF A;  3OBT A;  1QXM A;  3VSZ A;  4I2S A;  4I4U A;  3BX1 C;  1BFB A;  1ISX A;  4X37 A;  3CA4 A;  3SNV A;  4A7Z A;  4I4O A;  1PUU B;  4JPZ A;  3P6J A;  1FWV A;  3OJ2 A;  3BA4 A;  3FUO A;  4IY9 A;  3HBW A;  4ION A;  5FZZ A;  2K4A B;  4Q9G A;  5F8Y A;  3HAL A;  1Z0H A;  4J2S A;  2DRZ A;  3VT0 A;  2VLC A;  4ZGR B;  3O5W B;  5D62 A;  1JT3 A;  4DEP A;  4ISR A; 
#chains in the Genus database with same CATH homology
 41BI A;  4J2X A;  3BA7 A;  3AZW A;  1HWO B;  4FVV A;  4JKX B;  1I1B A;  3FJE A;  3O4O A;  3IIR A;  3RTJ B;  2D20 A;  2VU9 A;  4QC4 A;  4LO8 B;  3WO2 A;  1TTU A;  3HMY A;  4ZBV B;  2MLL B;  3MPP G;  1AVW B;  2HW9 A;  3S8J A;  4I4V A;  1HWN B;  3N0K A;  3BAH A;  4L4I A;  3I2X A;  1G9C A;  3LTQ A;  4D8H A;  4USP A;  3I2A A;  4QKR A;  4H9W A;  1JLX A;  3WO4 A;  3P6I A;  4P0K A;  5D63 A;  1BFG A;  1IRP A;  1EYL A;  1HIB A;  1MD6 A;  1G9D A;  2F8X C;  1CVS A;  8I1B A;  2P23 A;  2NTD A;  1HKN A;  2FO1 A;  1NZK A;  3FJB A;  4J2K A;  2MC2 A;  2KI6 B;  1KNM A;  4G9M A;  2IWT B;  1YF8 B;  1DZC A;  1AF9 A;  2K43 A;  4G6M A;  3D7W B;  4I8M A;  4KEK A;  1L2H A;  3FFZ A;  4G6J A;  3N7J A;  5EHA A;  5FNW A;  4CJM A;  1A8D A;  1JTC A;  1Q03 A;  1F31 A;  1M16 A;  1W3A A;  4OEE A;  1XYF A;  4UY4 A;  3A21 A;  3CAH A;  1XHB A;  5BXR A;  2D23 A;  2NZ9 A;  4H75 A;  3VEQ A;  4LO3 A;  1J0S A;  3FJK A;  4ZLB B;  5DVH A;  3O3Q A;  21BI A;  2XOA A;  3A07 A;  3AKG A;  3BRD A;  2X2S A;  2KH2 A;  3AH1 A;  4L4H A;  1DJS B;  3C9Z A;  3NBE A;  4LO2 C;  4J23 B;  3W9T A;  1JT4 A;  1BFF A;  1XG6 A;  3BA5 A;  4I1E A;  4MZH A;  4P0J A;  3QR5 A;  1JQZ A;  3H6S E;  5BQU A;  1R8O A;  2ZR1 B;  1YTO A;  2LIQ A;  5BQU C;  3BB2 A;  3BAG A;  4LO0 C;  4Z8S B;  4DCK C;  2VXT I;  4XFT A;  3FJC A;  1FN0 A;  1Q04 A;  1K5V A;  2Y9X E;  2ET2 A;  1BLD A;  4LO7 B;  3CA0 A;  2Y9F A;  4I4Y A;  4LO7 C;  1TOO A;  2F2F A;  2F2F C;  2ZQN A;  4OWJ A;  4AN6 A;  3O4C A;  1HWM B;  4X3A A;  4END A;  1RY7 A;  1BA7 A;  3O44 A;  5F8S A;  1V6X A;  1W3G A;  3V0A B;  1RG8 A;  2HWA A;  3V0A A;  5F8W A;  3FJ8 A;  1AVU A;  3CA5 A;  3CA1 A;  4D0Z A;  5BOW A;  1DFQ A;  2R9K B;  2VUA A;  5D61 A;  4IQP A;  2D7I A;  3HN1 A;  3OJV A;  3HOM A;  3N7L A;  1WD3 A;  4Q91 A;  3TC2 A;  2NP0 A;  3RSJ A;  2IHO A;  2VXR A;  1AXM A;  9ILB A;  5GAQ A;  2KKI A;  2Q3N B;  2WBC A;  3WIN C;  1IRA X;  1Q1U A;  3QYD A;  3IAG C;  1EV2 A;  1EPW A;  4EB2 B;  2GO2 A;  4P6A A;  1BLA A;  4HA2 A;  1SR4 A;  1SR4 C;  1ONK B;  2BFH A;  1Z4S A;  1Z2V A;  1PZZ A;  3I29 B;  1V6V A;  3ZX7 A;  3FJI A;  2D22 A;  3LLP A;  3AH4 A;  3UD9 A;  3PHZ A;  1PWA A;  4ZFW B;  4X38 A;  2D1Z A;  1ISW A;  4Q9P A;  5BVP I;  2K8R A;  3Q7X A;  3RTI B;  4IZX A;  3JUT A;  3CU1 B;  1QQL A;  1FWU A;  4I0Y A;  3FJJ A;  5EC5 A;  3FJ9 A;  5DUY A;  2RST A;  2L5X A;  4QBV A;  5BXS A;  3FJF A;  4IHZ A;  3H6R B;  4AN7 B;  4ISQ A;  4ZA3 B;  3WA1 A;  4GOY A;  3R4S A;  4PC4 A;  1GGP B;  1BAS A;  1ABR B;  3JRR A;  3P53 A;  4QO3 A;  4KEI A;  4IYB A;  1K5U A;  4JAW A;  3CQA A;  1G9B A;  1P63 A;  1PC8 B;  5BP5 A;  5BP5 C;  2NM1 A;  2D44 A;  1DLL A;  2FFU A;  2AQZ A;  2QYI B;  1QQK A;  1IOB A;  3FGM A;  2VSE A;  4II0 A;  4QD2 C;  3NBC A;  1OQL B;  5I1B A;  4OWK A;  3B9U A;  4A7Y A;  1S0B A;  2VSA A;  3K1X A;  1AFC A;  3AKI A;  1AVX B;  5FNX A;  4I1B A;  2ESU A;  3BAD A;  3O4A A;  1XZZ A;  4J2Y A;  3CRI A;  3O4D A;  4ZKT B;  1DQG A;  1I1E A;  2P39 A;  4GP0 A;  3AZV A;  4JRA A;  1II4 A;  4LO2 A;  3NBN A;  4I37 A;  2AFG A;  4ZOT A;  2YUG A;  4EEE B;  2DRE A;  1MC9 A;  1T4Q A;  1FQ9 A;  4G1R A;  3IM6 A;  4G9N A;  2Y9W C;  2D7R A;  4JQ0 A;  7I1B A;  1S0L A;  4HR6 C;  1VCL A;  1RZO B;  3AJ5 A;  1FGA A;  4LO0 A;  5HPZ A;  3H6Q A;  31BI A;  3IM7 A;  5BXP A;  3RMY A;  2Z49 A;  1E0O A;  4OEF A;  1FMZ A;  3FJA A;  2Q9X A;  1DZD A;  2X2T A;  3VT2 A;  1IHK A;  1YBI A;  2QN4 A;  3BAV A;  4JKQ A;  4I3N A;  1S0E A;  4KC3 A;  3S8K A;  4QBC A;  4D0T A;  3OJM A;  2NYY A;  3UDA A;  1S0C A;  1DIW A;  4I6I A;  4USO A;  4X39 A;  3WMU A;  1FMM S;  3CA6 A;  3Q7Y A;  1ILR 1;  3Q7W A;  4I4Q A;  4EFQ A;  1JT5 A;  3UD7 A;  4MZG B;  3N7K A;  4F83 A;  4Z9W B;  1TWM A;  2ERM A;  3WIN A;  4MZF B;  1IJT A;  1ITB A;  5F90 A;  3WMV A;  4ZFY B;  2BEB A;  2D24 A;  4GAI A;  1ISZ A;  2LIE A;  4WBC A;  4EFP A;  1CE7 B;  3BAQ A;  2Z48 A;  1WD4 A;  3IM5 A;  3FJD A;  4TLP A;  3V0B B;  1ISV A;  3E8L C;  3O4B A;  3V0B A;  2NS2 A;  3ZXG A;  2M49 A;  2Y9G A;  3BTA A;  2KLL A;  3OGF A;  4QKS A;  1TWE A;  1NUN A;  5DSS B;  1JT7 A;  3VSF A;  4LO1 A;  1V6W A;  4LO1 C;  4DEN A;  1R8N A;  1HCE A;  3NJ5 A;  4XFU A;  4I4R A;  3BRF A;  3CA3 A;  1HWP B;  3UJ0 A;  2FGF A;  3F1R A;  1DQO A;  2I1B A;  4XKI A;  3AJ6 A;  3KMV A;  2KI4 A;  2E4M A;  2E4M C;  3PME A;  3WO3 A;  1ISY A;  1BFC A;  1TIE A;  3H6R A;  3ZC9 A;  5B2H A;  3EF2 A;  5DZU A;  2D43 A;  2RQ9 A;  3NBD A;  4OW4 A;  1IIL A;  2HWM A;  4IY8 A;  4I96 A;  5E24 E;  4OWL A;  1V6U A;  2BEA A;  5FZU A;  1IT0 A;  4XFS A;  2MIB A;  1D0H A;  1M2T B;  4HJJ A;  3N7M A;  5BXT A;  4A7K A;  2FDB M;  2WRY A;  3FJH A;  4GAF A;  5FZY A;  3UD8 A;  3R4U A;  4F34 A;  4QD2 B;  3PG0 A;  4EFR A;  3CRG A;  3VT1 A;  1RML A;  4JP0 A;  1T9F A;  3BAO A;  1G82 A;  1W3F A;  3RMX A;  1S0F A;  1TP0 A;  3ZC8 A;  3MAL A;  3AH2 A;  3VUO A;  3AKF A;  3BRG C;  1PUM B;  2RG9 B;  2FFV A;  1WBC A;  3ILA A;  3V79 C;  4I4P A;  4GP3 A;  3OBR A;  4EKX B;  5JMC A;  4R6U B;  3T8S A;  4I7I A;  1JY0 A;  2J3P A;  4YOL A;  4ZFU B;  1YXW A;  3HSM A;  4LO3 C;  2AAI B;  2ZQO A;  3FUQ A;  1YYN A;  5EG6 C;  4KBB A;  1SZ6 B;  4GOV A;  3A23 A;  1WBA A;  3OGG A;  3POK A;  5JLV A;  4H04 A;  2DS0 A;  4IZE A;  1FV3 A;  5G00 A;  2NVH A;  1DFC A;  1S0D A;  3O49 A;  3PUB A;  1JLY A;  1FV2 A;  3UJ4 A;  4QAL A;  4KEJ A;  1G9A A;  1AVA C;  2AXM A;  2UUS A;  4OEG A;  3VWC A;  4P0L A;  1BAR A;  1UPS A;  6I1B A;  2DRY A;  3CRH A;  1EVT A;  3AKH A;  4I4X A;  3ZXD A;  1TFM B;  4I4S A;  1HCD A;  2GZB A;  1N4K A;  4OUJ A;  3BAU A;  3A22 A;  2HZ9 A;  1S0G A;  3F62 B;  4FGF A;  3OBT A;  1QXM A;  3VSZ A;  4I2S A;  4I4U A;  3BX1 C;  1BFB A;  1ISX A;  4X37 A;  3CA4 A;  3SNV A;  4A7Z A;  4I4O A;  1PUU B;  4JPZ A;  3P6J A;  1FWV A;  3OJ2 A;  3BA4 A;  3FUO A;  4IY9 A;  3HBW A;  4ION A;  5FZZ A;  2K4A B;  4Q9G A;  5F8Y A;  3HAL A;  1Z0H A;  4J2S A;  2DRZ A;  3VT0 A;  2VLC A;  4ZGR B;  3O5W B;  5D62 A;  1JT3 A;  4DEP A;  4ISR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...